5IZ2A

Crystal structure of the n. clavipes spidroin ntd at ph 6.5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
119
Chain Sequence
QNTPWSSTELADAFINAFMNEAGRTGAFTADQLDDMSTIGDTIKTAMDKMARSNKSSKGKLQALNMAFASSMAEIAAGLSVDAKTNAIADSLNSAFYQTTGAANPQFVNEIRSLINMFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1A
publication title Crystal Structure of the Nephila clavipes Major Ampullate Spidroin 1A N-terminal Domain Reveals Plasticity at the Dimer Interface.
pubmed doi rcsb
source organism Nephila clavipes
molecule tags Structural protein
total genus 46
structure length 119
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 5iz2A01
3LR8A 5IZ2A 2LPIA 2MX9A 2MX8A 3LR6A 3LRDA 2K3QA 2LPJA 2N3EA 4FBSA 3LR2A 2LTHA
chains in the Genus database with same CATH superfamily
1I50A 4C5RA 3LR8A 1ZYMA 2YU9A 2R93A 1EZBA 3GTMA 2BE5D 2LPIA 2MX8A 2JA6A 2X0PA 1YNND 3GTJA 2E2HA 4CEIA 2LYIA 3EZAA 2FIOA 2E2IA 1HQMD 2X0QA 2R7ZA 3GTKA 4V2QA 2EZAA 2VUMA 1SMYD 2NVYA 2LTHA 2B63A 4C6GA 3U4QA 2HROA 1K83A 4CEHA 3U44A 2YIIA 4CQ5A 5IZ2A 2FIPA 4C5SA 2N1DB 1W27A 1ZYRD 1TWFA 2R92A 2EZCA 3CQZA 1Y2MA 2O5JD 3GTQA 3GTLA 2A6HD 1TWHA 1IW7D 4BAAA 2K3NA 3EZEA 3FKIA 3EZBA 2X0OA 2N3EA 1EZAA 2Y0NA 1YNJD 3LR2A 2LKMB 2VK9A 3NZ4A 3H0GA 2F5JA 1Y1VA 1I3QA 2A6ED 2K3QA 2LPJA 4C5UA 1R9TA 3GTOA 1I6VD 2MX9A 2CW0D 2MP0A 3LRDA 1SFOA 4FBSA 4BABA 4CEJA 2JA7A 1TWGA 2EZBA 1T6JA 2MQAA 4C2MA 3LR6A 2HWGA 4V2RA 3GTGA 1T6PA 1WCMA 2A68D 2AQLA 3GTPA 1Y1WA 1TWAA 2K3OA 4QIWA 2JA5A 1TWCA 2NVXA 2A69D
chains in the Genus database with same CATH topology
1I50A 3LR8A 2YU9A 2R93A 3GTMA 2BE5D 2LPIA 2MX8A 2JA6A 2X0PA 1YNND 3GTJA 2E2HA 4CEIA 2LYIA 2FIOA 2E2IA 1HQMD 2X0QA 2R7ZA 3GTKA 2VUMA 1SMYD 2NVYA 2LTHA 2B63A 3U4QA 1K83A 4CEHA 3U44A 5IZ2A 2FIPA 2N1DB 1ZYRD 1TWFA 2R92A 3CQZA 2O5JD 3GTQA 3GTLA 2A6HD 1TWHA 1IW7D 2K3NA 3FKIA 2X0OA 2N3EA 2Y0NA 1YNJD 3LR2A 2LKMB 2VK9A 3H0GA 2F5JA 1Y1VA 1I3QA 2A6ED 2K3QA 2LPJA 1R9TA 3GTOA 1I6VD 2MX9A 2CW0D 3LRDA 1SFOA 4FBSA 4CEJA 2JA7A 1TWGA 2MQAA 4C2MA 3LR6A 3GTGA 1WCMA 2A68D 2AQLA 3GTPA 1Y1WA 1TWAA 2K3OA 4QIWA 2JA5A 1TWCA 2NVXA 2A69D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  5IZ2 A;  2LPI A;  2MX9 A;  2MX8 A;  3LR6 A;  3LRD A;  2K3Q A;  2LPJ A;  2N3E A;  4FBS A;  3LR2 A;  2LTH A; 
#chains in the Genus database with same CATH topology
 1I50 A;  4C5R A;  3LR8 A;  1ZYM A;  2YU9 A;  2R93 A;  1EZB A;  3GTM A;  2BE5 D;  2LPI A;  2MX8 A;  2JA6 A;  2X0P A;  1YNN D;  3GTJ A;  2E2H A;  4CEI A;  2LYI A;  3EZA A;  2FIO A;  2E2I A;  1HQM D;  2X0Q A;  2R7Z A;  3GTK A;  4V2Q A;  2EZA A;  2VUM A;  1SMY D;  2NVY A;  2LTH A;  2B63 A;  4C6G A;  3U4Q A;  2HRO A;  1K83 A;  4CEH A;  3U44 A;  2YII A;  4CQ5 A;  5IZ2 A;  2FIP A;  4C5S A;  2N1D B;  1W27 A;  1ZYR D;  1TWF A;  2R92 A;  2EZC A;  3CQZ A;  1Y2M A;  2O5J D;  3GTQ A;  3GTL A;  2A6H D;  1TWH A;  1IW7 D;  4BAA A;  2K3N A;  3EZE A;  3FKI A;  3EZB A;  2X0O A;  2N3E A;  1EZA A;  2Y0N A;  1YNJ D;  3LR2 A;  2LKM B;  2VK9 A;  3NZ4 A;  3H0G A;  2F5J A;  1Y1V A;  1I3Q A;  2A6E D;  2K3Q A;  2LPJ A;  4C5U A;  1R9T A;  3GTO A;  1I6V D;  2MX9 A;  2CW0 D;  2MP0 A;  3LRD A;  1SFO A;  4FBS A;  4BAB A;  4CEJ A;  2JA7 A;  1TWG A;  2EZB A;  1T6J A;  2MQA A;  4C2M A;  3LR6 A;  2HWG A;  4V2R A;  3GTG A;  1T6P A;  1WCM A;  2A68 D;  2AQL A;  3GTP A;  1Y1W A;  1TWA A;  2K3O A;  4QIW A;  2JA5 A;  1TWC A;  2NVX A;  2A69 D; 
#chains in the Genus database with same CATH homology
 1I50 A;  3LR8 A;  2YU9 A;  2R93 A;  3GTM A;  2BE5 D;  2LPI A;  2MX8 A;  2JA6 A;  2X0P A;  1YNN D;  3GTJ A;  2E2H A;  4CEI A;  2LYI A;  2FIO A;  2E2I A;  1HQM D;  2X0Q A;  2R7Z A;  3GTK A;  2VUM A;  1SMY D;  2NVY A;  2LTH A;  2B63 A;  3U4Q A;  1K83 A;  4CEH A;  3U44 A;  5IZ2 A;  2FIP A;  2N1D B;  1ZYR D;  1TWF A;  2R92 A;  3CQZ A;  2O5J D;  3GTQ A;  3GTL A;  2A6H D;  1TWH A;  1IW7 D;  2K3N A;  3FKI A;  2X0O A;  2N3E A;  2Y0N A;  1YNJ D;  3LR2 A;  2LKM B;  2VK9 A;  3H0G A;  2F5J A;  1Y1V A;  1I3Q A;  2A6E D;  2K3Q A;  2LPJ A;  1R9T A;  3GTO A;  1I6V D;  2MX9 A;  2CW0 D;  3LRD A;  1SFO A;  4FBS A;  4CEJ A;  2JA7 A;  1TWG A;  2MQA A;  4C2M A;  3LR6 A;  3GTG A;  1WCM A;  2A68 D;  2AQL A;  3GTP A;  1Y1W A;  1TWA A;  2K3O A;  4QIW A;  2JA5 A;  1TWC A;  2NVX A;  2A69 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...