5IZ2A

Crystal structure of the n. clavipes spidroin ntd at ph 6.5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
119
Chain Sequence
QNTPWSSTELADAFINAFMNEAGRTGAFTADQLDDMSTIGDTIKTAMDKMARSNKSSKGKLQALNMAFASSMAEIAAGLSVDAKTNAIADSLNSAFYQTTGAANPQFVNEIRSLINMFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nephila clavipes Major Ampullate Spidroin 1A N-terminal Domain Reveals Plasticity at the Dimer Interface.
pubmed doi rcsb
source organism Nephila clavipes
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1A
total genus 46
structure length 119
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 5iz2A01
2K3QA 3LR8A 2LPIA 2LPJA 5IZ2A 2N3EA 2LTHA 3LR6A 2MX8A 3LR2A 2MX9A 3LRDA 4FBSA
chains in the Genus database with same CATH superfamily
2BE5D 1I3QA 3LR2A 2HWGA 2X0OA 2A68D 4BAAA 3EZBA 4C6GA 4CEHA 2X0QA 3GTMA 2R7ZA 4V2QA 1EZBA 2AQLA 2YIIA 2F5JA 3GTPA 3LRDA 4CEJA 4QIWA 3EZEA 3GTJA 2B63A 4C5SA 3CQZA 1SFOA 3H0GA 1K83A 1T6JA 2NVXA 2K3NA 5IZ2A 4C2MA 1HQMD 2CW0D 1R9TA 2O5JD 1ZYRD 2K3OA 2HROA 2VK9A 2A6ED 4C5UA 1Y1VA 3GTKA 1YNND 1YNJD 2VUMA 1I50A 1W27A 2MP0A 3GTLA 2FIPA 4CEIA 2E2IA 2JA6A 2R93A 2E2HA 1TWFA 4BABA 2K3QA 2EZCA 2LYIA 3LR8A 2LPIA 1TWCA 1IW7D 2MX8A 2Y0NA 2X0PA 2JA7A 3GTQA 3U4QA 2LKMB 2NVYA 2A6HD 3GTOA 2LTHA 1Y1WA 2MX9A 4FBSA 2N1DB 3NZ4A 2EZAA 1TWGA 1Y2MA 2FIOA 3EZAA 2A69D 2MQAA 1WCMA 3FKIA 4V2RA 2YU9A 1T6PA 2JA5A 2EZBA 2LPJA 2R92A 1EZAA 4CQ5A 3GTGA 1I6VD 4C5RA 3U44A 2N3EA 3LR6A 1SMYD 1ZYMA 1TWHA 1TWAA
chains in the Genus database with same CATH topology
2BE5D 1I3QA 3LR2A 2X0OA 2A68D 4CEHA 2X0QA 3GTMA 2R7ZA 2AQLA 2F5JA 3GTPA 3LRDA 4CEJA 4QIWA 3GTJA 2B63A 3CQZA 1SFOA 3H0GA 1K83A 2NVXA 2K3NA 5IZ2A 1HQMD 4C2MA 2CW0D 1R9TA 2O5JD 1ZYRD 2K3OA 2VK9A 2A6ED 1Y1VA 3GTKA 1YNND 1YNJD 2VUMA 1I50A 3GTLA 2FIPA 4CEIA 2E2IA 2JA6A 2R93A 2E2HA 1TWFA 2K3QA 2LYIA 3LR8A 2LPIA 1TWCA 1IW7D 2MX8A 2Y0NA 2X0PA 2JA7A 3GTQA 3U4QA 2LKMB 2NVYA 2A6HD 3GTOA 2LTHA 1Y1WA 2MX9A 4FBSA 2N1DB 1TWGA 2FIOA 2A69D 2MQAA 1WCMA 3FKIA 2YU9A 2JA5A 2LPJA 2R92A 1I6VD 3U44A 2N3EA 3LR6A 1SMYD 3GTGA 1TWHA 1TWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Q A;  3LR8 A;  2LPI A;  2LPJ A;  5IZ2 A;  2N3E A;  2LTH A;  3LR6 A;  2MX8 A;  3LR2 A;  2MX9 A;  3LRD A;  4FBS A; 
#chains in the Genus database with same CATH topology
 2BE5 D;  1I3Q A;  3LR2 A;  2HWG A;  2X0O A;  2A68 D;  4BAA A;  3EZB A;  4C6G A;  4CEH A;  2X0Q A;  3GTM A;  2R7Z A;  4V2Q A;  1EZB A;  2AQL A;  2YII A;  2F5J A;  3GTP A;  3LRD A;  4CEJ A;  4QIW A;  3EZE A;  3GTJ A;  2B63 A;  4C5S A;  3CQZ A;  1SFO A;  3H0G A;  1K83 A;  1T6J A;  2NVX A;  2K3N A;  5IZ2 A;  4C2M A;  1HQM D;  2CW0 D;  1R9T A;  2O5J D;  1ZYR D;  2K3O A;  2HRO A;  2VK9 A;  2A6E D;  4C5U A;  1Y1V A;  3GTK A;  1YNN D;  1YNJ D;  2VUM A;  1I50 A;  1W27 A;  2MP0 A;  3GTL A;  2FIP A;  4CEI A;  2E2I A;  2JA6 A;  2R93 A;  2E2H A;  1TWF A;  4BAB A;  2K3Q A;  2EZC A;  2LYI A;  3LR8 A;  2LPI A;  1TWC A;  1IW7 D;  2MX8 A;  2Y0N A;  2X0P A;  2JA7 A;  3GTQ A;  3U4Q A;  2LKM B;  2NVY A;  2A6H D;  3GTO A;  2LTH A;  1Y1W A;  2MX9 A;  4FBS A;  2N1D B;  3NZ4 A;  2EZA A;  1TWG A;  1Y2M A;  2FIO A;  3EZA A;  2A69 D;  2MQA A;  1WCM A;  3FKI A;  4V2R A;  2YU9 A;  1T6P A;  2JA5 A;  2EZB A;  2LPJ A;  2R92 A;  1EZA A;  4CQ5 A;  3GTG A;  1I6V D;  4C5R A;  3U44 A;  2N3E A;  3LR6 A;  1SMY D;  1ZYM A;  1TWH A;  1TWA A; 
#chains in the Genus database with same CATH homology
 2BE5 D;  1I3Q A;  3LR2 A;  2X0O A;  2A68 D;  4CEH A;  2X0Q A;  3GTM A;  2R7Z A;  2AQL A;  2F5J A;  3GTP A;  3LRD A;  4CEJ A;  4QIW A;  3GTJ A;  2B63 A;  3CQZ A;  1SFO A;  3H0G A;  1K83 A;  2NVX A;  2K3N A;  5IZ2 A;  1HQM D;  4C2M A;  2CW0 D;  1R9T A;  2O5J D;  1ZYR D;  2K3O A;  2VK9 A;  2A6E D;  1Y1V A;  3GTK A;  1YNN D;  1YNJ D;  2VUM A;  1I50 A;  3GTL A;  2FIP A;  4CEI A;  2E2I A;  2JA6 A;  2R93 A;  2E2H A;  1TWF A;  2K3Q A;  2LYI A;  3LR8 A;  2LPI A;  1TWC A;  1IW7 D;  2MX8 A;  2Y0N A;  2X0P A;  2JA7 A;  3GTQ A;  3U4Q A;  2LKM B;  2NVY A;  2A6H D;  3GTO A;  2LTH A;  1Y1W A;  2MX9 A;  4FBS A;  2N1D B;  1TWG A;  2FIO A;  2A69 D;  2MQA A;  1WCM A;  3FKI A;  2YU9 A;  2JA5 A;  2LPJ A;  2R92 A;  1I6V D;  3U44 A;  2N3E A;  3LR6 A;  1SMY D;  3GTG A;  1TWH A;  1TWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...