5IZ2A

Crystal structure of the n. clavipes spidroin ntd at ph 6.5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
119
Chain Sequence
b'QNTPWSSTELADAFINAFMNEAGRTGAFTADQLDDMSTIGDTIKTAMDKMARSNKSSKGKLQALNMAFASSMAEIAAGLSVDAKTNAIADSLNSAFYQTTGAANPQFVNEIRSLINMFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1A
publication title Crystal Structure of the Nephila clavipes Major Ampullate Spidroin 1A N-terminal Domain Reveals Plasticity at the Dimer Interface.
pubmed doi rcsb
source organism Nephila clavipes
molecule tags Structural protein
total genus 46
structure length 119
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 5iz2A01
3LR8A 3LRDA 2LPIA 2LPJA 2K3QA 2N3EA 4FBSA 2MX9A 3LR2A 5IZ2A 3LR6A 2LTHA 2MX8A
chains in the Genus database with same CATH superfamily
2EZCA 3U4QA 2NVXA 3LR2A 3FKIA 2JA6A 2EZBA 2CW0D 2X0QA 1YNND 3LR8A 2JA5A 1EZAA 2YU9A 5IZ2A 3LR6A 1TWHA 2VUMA 2LTHA 2MQAA 3EZAA 3EZBA 2F5JA 1I6VD 2AQLA 3GTGA 2N3EA 1Y1VA 3CQZA 3GTKA 2R7ZA 3NZ4A 2R93A 2E2HA 1SFOA 4QIWA 2A6HD 1YNJD 2X0PA 1I50A 1W27A 4C6GA 2N1DB 4V2RA 4C5RA 1TWAA 2BE5D 2A6ED 2MP0A 1T6JA 2VK9A 3GTPA 1SMYD 2EZAA 2O5JD 4CEHA 2Y0NA 3H0GA 2HROA 1Y1WA 1EZBA 4C5SA 1R9TA 1IW7D 2YIIA 4CQ5A 2JA7A 2FIPA 1T6PA 1ZYMA 2NVYA 1TWCA 1ZYRD 1HQMD 2MX9A 2MX8A 3GTOA 4BAAA 2LPIA 3EZEA 1TWGA 2HWGA 1K83A 2A68D 3LRDA 2FIOA 4CEJA 4BABA 2A69D 2K3NA 4CEIA 4C2MA 3GTMA 3U44A 3GTLA 2K3QA 3GTQA 4FBSA 1Y2MA 1TWFA 1WCMA 2X0OA 2E2IA 2LPJA 2R92A 4V2QA 4C5UA 2K3OA 3GTJA 2LYIA 2LKMB 2B63A 1I3QA
chains in the Genus database with same CATH topology
3U4QA 2NVXA 3LR2A 3FKIA 2JA6A 2CW0D 2X0QA 1YNND 3LR8A 2JA5A 2YU9A 5IZ2A 3LR6A 1TWHA 2VUMA 2LTHA 2MQAA 2F5JA 1I6VD 2AQLA 3GTGA 2N3EA 1Y1VA 3CQZA 3GTKA 2R7ZA 2R93A 2E2HA 1SFOA 4QIWA 2A6HD 1YNJD 2X0PA 1I50A 2N1DB 1TWAA 2BE5D 2A6ED 2VK9A 3GTPA 1SMYD 2O5JD 4CEHA 2Y0NA 3H0GA 1Y1WA 1R9TA 1IW7D 2JA7A 2FIPA 2NVYA 1TWCA 1ZYRD 1HQMD 2MX9A 2MX8A 3GTOA 2LPIA 1TWGA 1K83A 2A68D 3LRDA 2FIOA 4CEJA 2A69D 2K3NA 4CEIA 4C2MA 3GTMA 3GTLA 3U44A 2K3QA 3GTQA 4FBSA 1TWFA 1WCMA 2X0OA 2E2IA 2LPJA 2R92A 2K3OA 3GTJA 2LYIA 2LKMB 2B63A 1I3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  3LRD A;  2LPI A;  2LPJ A;  2K3Q A;  2N3E A;  4FBS A;  2MX9 A;  3LR2 A;  5IZ2 A;  3LR6 A;  2LTH A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 2EZC A;  3U4Q A;  2NVX A;  3LR2 A;  3FKI A;  2JA6 A;  2EZB A;  2CW0 D;  2X0Q A;  1YNN D;  3LR8 A;  2JA5 A;  1EZA A;  2YU9 A;  5IZ2 A;  3LR6 A;  1TWH A;  2VUM A;  2LTH A;  2MQA A;  3EZA A;  3EZB A;  2F5J A;  1I6V D;  2AQL A;  3GTG A;  2N3E A;  1Y1V A;  3CQZ A;  3GTK A;  2R7Z A;  3NZ4 A;  2R93 A;  2E2H A;  1SFO A;  4QIW A;  2A6H D;  1YNJ D;  2X0P A;  1I50 A;  1W27 A;  4C6G A;  2N1D B;  4V2R A;  4C5R A;  1TWA A;  2BE5 D;  2A6E D;  2MP0 A;  1T6J A;  2VK9 A;  3GTP A;  1SMY D;  2EZA A;  2O5J D;  4CEH A;  2Y0N A;  3H0G A;  2HRO A;  1Y1W A;  1EZB A;  4C5S A;  1R9T A;  1IW7 D;  2YII A;  4CQ5 A;  2JA7 A;  2FIP A;  1T6P A;  1ZYM A;  2NVY A;  1TWC A;  1ZYR D;  1HQM D;  2MX9 A;  2MX8 A;  3GTO A;  4BAA A;  2LPI A;  3EZE A;  1TWG A;  2HWG A;  1K83 A;  2A68 D;  3LRD A;  2FIO A;  4CEJ A;  4BAB A;  2A69 D;  2K3N A;  4CEI A;  4C2M A;  3GTM A;  3U44 A;  3GTL A;  2K3Q A;  3GTQ A;  4FBS A;  1Y2M A;  1TWF A;  1WCM A;  2X0O A;  2E2I A;  2LPJ A;  2R92 A;  4V2Q A;  4C5U A;  2K3O A;  3GTJ A;  2LYI A;  2LKM B;  2B63 A;  1I3Q A; 
#chains in the Genus database with same CATH homology
 3U4Q A;  2NVX A;  3LR2 A;  3FKI A;  2JA6 A;  2CW0 D;  2X0Q A;  1YNN D;  3LR8 A;  2JA5 A;  2YU9 A;  5IZ2 A;  3LR6 A;  1TWH A;  2VUM A;  2LTH A;  2MQA A;  2F5J A;  1I6V D;  2AQL A;  3GTG A;  2N3E A;  1Y1V A;  3CQZ A;  3GTK A;  2R7Z A;  2R93 A;  2E2H A;  1SFO A;  4QIW A;  2A6H D;  1YNJ D;  2X0P A;  1I50 A;  2N1D B;  1TWA A;  2BE5 D;  2A6E D;  2VK9 A;  3GTP A;  1SMY D;  2O5J D;  4CEH A;  2Y0N A;  3H0G A;  1Y1W A;  1R9T A;  1IW7 D;  2JA7 A;  2FIP A;  2NVY A;  1TWC A;  1ZYR D;  1HQM D;  2MX9 A;  2MX8 A;  3GTO A;  2LPI A;  1TWG A;  1K83 A;  2A68 D;  3LRD A;  2FIO A;  4CEJ A;  2A69 D;  2K3N A;  4CEI A;  4C2M A;  3GTM A;  3GTL A;  3U44 A;  2K3Q A;  3GTQ A;  4FBS A;  1TWF A;  1WCM A;  2X0O A;  2E2I A;  2LPJ A;  2R92 A;  2K3O A;  3GTJ A;  2LYI A;  2LKM B;  2B63 A;  1I3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...