2MX9A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 5.5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
133
structure length
133
Chain Sequence
GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Minor ampullate spidroin
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
total genus 45
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx9A01
2LTHA 3LR6A 3LRDA 5IZ2A 2MX9A 4FBSA 2LPJA 2LPIA 2K3QA 2MX8A 2N3EA 3LR8A 3LR2A
chains in the Genus database with same CATH superfamily
1I50A 2LTHA 2N1DB 4QIWA 2LPJA 2N3EA 1TWFA 2X0PA 2YU9A 1I6VD 2MX8A 2X0OA 3GTLA 3GTGA 3U44A 1WCMA 1YNND 2EZBA 1R9TA 2K3NA 3FKIA 4CEIA 1TWGA 3LR6A 1IW7D 1TWCA 1EZBA 4V2QA 2VK9A 2MP0A 2MQAA 1SMYD 2JA6A 4CEJA 4C5RA 2NVYA 4C5SA 2VUMA 3U4QA 2FIOA 2CW0D 4FBSA 2LPIA 1SFOA 1EZAA 3GTOA 2A6HD 2K3QA 3NZ4A 2JA7A 3LRDA 2R93A 2EZAA 4V2RA 2R7ZA 2R92A 2MX9A 2YIIA 2EZCA 4CEHA 3EZBA 1TWHA 2HROA 1Y1WA 2LYIA 2A68D 1ZYMA 1T6JA 4BAAA 1ZYRD 4C5UA 2A6ED 3GTJA 1W27A 4C6GA 2BE5D 1Y1VA 1HQMD 1T6PA 2E2HA 3GTQA 2E2IA 2FIPA 2Y0NA 3LR2A 3H0GA 5IZ2A 3GTPA 1Y2MA 2AQLA 3EZAA 1TWAA 1YNJD 2F5JA 3EZEA 2HWGA 1K83A 2K3OA 2LKMB 4C2MA 2O5JD 2X0QA 2B63A 3GTKA 4CQ5A 4BABA 3GTMA 2NVXA 3CQZA 1I3QA 2A69D 3LR8A 2JA5A
chains in the Genus database with same CATH topology
1I50A 2LTHA 2N1DB 4QIWA 2LPJA 2N3EA 1TWFA 2X0PA 2YU9A 1I6VD 2MX8A 2X0OA 3GTLA 3GTGA 3U44A 1WCMA 1YNND 1R9TA 2K3NA 3FKIA 4CEIA 1TWGA 3LR6A 1IW7D 1TWCA 2VK9A 2MQAA 1SMYD 2JA6A 4CEJA 2NVYA 2VUMA 3U4QA 2FIOA 2CW0D 4FBSA 2LPIA 1SFOA 3GTOA 2A6HD 2K3QA 2JA7A 3LRDA 2R93A 2R7ZA 2R92A 2MX9A 4CEHA 1TWHA 1Y1WA 2LYIA 2A68D 1ZYRD 2A6ED 3GTJA 2BE5D 1Y1VA 1HQMD 2E2HA 3GTQA 2E2IA 2FIPA 2Y0NA 3LR2A 3H0GA 5IZ2A 3GTPA 2AQLA 1TWAA 1YNJD 2F5JA 1K83A 2K3OA 2LKMB 4C2MA 2O5JD 2X0QA 2B63A 3GTKA 3GTMA 2NVXA 3CQZA 1I3QA 2A69D 3LR8A 2JA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTH A;  3LR6 A;  3LRD A;  5IZ2 A;  2MX9 A;  4FBS A;  2LPJ A;  2LPI A;  2K3Q A;  2MX8 A;  2N3E A;  3LR8 A;  3LR2 A; 
#chains in the Genus database with same CATH topology
 1I50 A;  2LTH A;  2N1D B;  4QIW A;  2LPJ A;  2N3E A;  1TWF A;  2X0P A;  2YU9 A;  1I6V D;  2MX8 A;  2X0O A;  3GTL A;  3GTG A;  3U44 A;  1WCM A;  1YNN D;  2EZB A;  1R9T A;  2K3N A;  3FKI A;  4CEI A;  1TWG A;  3LR6 A;  1IW7 D;  1TWC A;  1EZB A;  4V2Q A;  2VK9 A;  2MP0 A;  2MQA A;  1SMY D;  2JA6 A;  4CEJ A;  4C5R A;  2NVY A;  4C5S A;  2VUM A;  3U4Q A;  2FIO A;  2CW0 D;  4FBS A;  2LPI A;  1SFO A;  1EZA A;  3GTO A;  2A6H D;  2K3Q A;  3NZ4 A;  2JA7 A;  3LRD A;  2R93 A;  2EZA A;  4V2R A;  2R7Z A;  2R92 A;  2MX9 A;  2YII A;  2EZC A;  4CEH A;  3EZB A;  1TWH A;  2HRO A;  1Y1W A;  2LYI A;  2A68 D;  1ZYM A;  1T6J A;  4BAA A;  1ZYR D;  4C5U A;  2A6E D;  3GTJ A;  1W27 A;  4C6G A;  2BE5 D;  1Y1V A;  1HQM D;  1T6P A;  2E2H A;  3GTQ A;  2E2I A;  2FIP A;  2Y0N A;  3LR2 A;  3H0G A;  5IZ2 A;  3GTP A;  1Y2M A;  2AQL A;  3EZA A;  1TWA A;  1YNJ D;  2F5J A;  3EZE A;  2HWG A;  1K83 A;  2K3O A;  2LKM B;  4C2M A;  2O5J D;  2X0Q A;  2B63 A;  3GTK A;  4CQ5 A;  4BAB A;  3GTM A;  2NVX A;  3CQZ A;  1I3Q A;  2A69 D;  3LR8 A;  2JA5 A; 
#chains in the Genus database with same CATH homology
 1I50 A;  2LTH A;  2N1D B;  4QIW A;  2LPJ A;  2N3E A;  1TWF A;  2X0P A;  2YU9 A;  1I6V D;  2MX8 A;  2X0O A;  3GTL A;  3GTG A;  3U44 A;  1WCM A;  1YNN D;  1R9T A;  2K3N A;  3FKI A;  4CEI A;  1TWG A;  3LR6 A;  1IW7 D;  1TWC A;  2VK9 A;  2MQA A;  1SMY D;  2JA6 A;  4CEJ A;  2NVY A;  2VUM A;  3U4Q A;  2FIO A;  2CW0 D;  4FBS A;  2LPI A;  1SFO A;  3GTO A;  2A6H D;  2K3Q A;  2JA7 A;  3LRD A;  2R93 A;  2R7Z A;  2R92 A;  2MX9 A;  4CEH A;  1TWH A;  1Y1W A;  2LYI A;  2A68 D;  1ZYR D;  2A6E D;  3GTJ A;  2BE5 D;  1Y1V A;  1HQM D;  2E2H A;  3GTQ A;  2E2I A;  2FIP A;  2Y0N A;  3LR2 A;  3H0G A;  5IZ2 A;  3GTP A;  2AQL A;  1TWA A;  1YNJ D;  2F5J A;  1K83 A;  2K3O A;  2LKM B;  4C2M A;  2O5J D;  2X0Q A;  2B63 A;  3GTK A;  3GTM A;  2NVX A;  3CQZ A;  1I3Q A;  2A69 D;  3LR8 A;  2JA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...