2MX9A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 5.5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
133
structure length
133
Chain Sequence
b'GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate spidroin
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
molecule tags Structural protein
total genus 45
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx9A01
2K3QA 2N3EA 3LR8A 3LR2A 2LPJA 5IZ2A 2MX8A 2LPIA 3LR6A 2LTHA 3LRDA 2MX9A 4FBSA
chains in the Genus database with same CATH superfamily
2EZBA 2X0QA 2E2HA 3LR2A 1IW7D 4V2RA 2BE5D 3LR6A 2N1DB 2JA6A 3GTOA 3CQZA 1TWGA 2A6HD 2R7ZA 2YU9A 2A68D 2FIPA 3LRDA 1K83A 1TWAA 3GTLA 4C5SA 3GTQA 1YNND 4QIWA 4C5UA 3U4QA 3GTPA 4C2MA 2AQLA 4BAAA 4C5RA 2MP0A 1EZBA 1T6PA 2LKMB 2A69D 2HWGA 2EZAA 2JA7A 1T6JA 1ZYRD 1SFOA 2NVYA 4CQ5A 2Y0NA 2K3NA 3LR8A 4CEHA 2MX8A 2MQAA 1HQMD 2X0OA 3GTJA 2R93A 3EZEA 1YNJD 1SMYD 4BABA 3GTMA 3EZBA 2E2IA 3U44A 4CEIA 2EZCA 2NVXA 3FKIA 2O5JD 1TWFA 1TWHA 2LYIA 2LPJA 2JA5A 1I3QA 2YIIA 2B63A 1W27A 1I6VD 2FIOA 2MX9A 4FBSA 2A6ED 2K3QA 2HROA 3GTKA 1TWCA 3NZ4A 4CEJA 1EZAA 3EZAA 1ZYMA 1I50A 2F5JA 4C6GA 1R9TA 1Y1WA 4V2QA 2R92A 2K3OA 3H0GA 1Y2MA 2X0PA 2VUMA 2LTHA 2CW0D 1WCMA 2N3EA 3GTGA 2VK9A 1Y1VA 2LPIA 5IZ2A
chains in the Genus database with same CATH topology
2X0QA 2E2HA 3LR2A 1IW7D 2BE5D 3LR6A 2N1DB 2JA6A 3GTOA 3CQZA 1TWGA 2A6HD 2R7ZA 2YU9A 2A68D 2FIPA 3LRDA 1K83A 1TWAA 3GTLA 3GTQA 1YNND 4QIWA 3U4QA 3GTPA 4C2MA 2AQLA 2LKMB 2A69D 2JA7A 1ZYRD 1SFOA 2NVYA 2Y0NA 2K3NA 3LR8A 4CEHA 2MX8A 2MQAA 1HQMD 2X0OA 3GTJA 2R93A 1YNJD 1SMYD 3GTMA 2E2IA 3U44A 4CEIA 2NVXA 3FKIA 2O5JD 1TWFA 1TWHA 2LYIA 2LPJA 2JA5A 1I3QA 2B63A 1I6VD 2FIOA 2MX9A 4FBSA 2A6ED 2K3QA 3GTKA 1TWCA 4CEJA 1I50A 2F5JA 1R9TA 1Y1WA 2R92A 2K3OA 3H0GA 2X0PA 2VUMA 2LTHA 2CW0D 1WCMA 2N3EA 3GTGA 2VK9A 1Y1VA 2LPIA 5IZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Q A;  2N3E A;  3LR8 A;  3LR2 A;  2LPJ A;  5IZ2 A;  2MX8 A;  2LPI A;  3LR6 A;  2LTH A;  3LRD A;  2MX9 A;  4FBS A; 
#chains in the Genus database with same CATH topology
 2EZB A;  2X0Q A;  2E2H A;  3LR2 A;  1IW7 D;  4V2R A;  2BE5 D;  3LR6 A;  2N1D B;  2JA6 A;  3GTO A;  3CQZ A;  1TWG A;  2A6H D;  2R7Z A;  2YU9 A;  2A68 D;  2FIP A;  3LRD A;  1K83 A;  1TWA A;  3GTL A;  4C5S A;  3GTQ A;  1YNN D;  4QIW A;  4C5U A;  3U4Q A;  3GTP A;  4C2M A;  2AQL A;  4BAA A;  4C5R A;  2MP0 A;  1EZB A;  1T6P A;  2LKM B;  2A69 D;  2HWG A;  2EZA A;  2JA7 A;  1T6J A;  1ZYR D;  1SFO A;  2NVY A;  4CQ5 A;  2Y0N A;  2K3N A;  3LR8 A;  4CEH A;  2MX8 A;  2MQA A;  1HQM D;  2X0O A;  3GTJ A;  2R93 A;  3EZE A;  1YNJ D;  1SMY D;  4BAB A;  3GTM A;  3EZB A;  2E2I A;  3U44 A;  4CEI A;  2EZC A;  2NVX A;  3FKI A;  2O5J D;  1TWF A;  1TWH A;  2LYI A;  2LPJ A;  2JA5 A;  1I3Q A;  2YII A;  2B63 A;  1W27 A;  1I6V D;  2FIO A;  2MX9 A;  4FBS A;  2A6E D;  2K3Q A;  2HRO A;  3GTK A;  1TWC A;  3NZ4 A;  4CEJ A;  1EZA A;  3EZA A;  1ZYM A;  1I50 A;  2F5J A;  4C6G A;  1R9T A;  1Y1W A;  4V2Q A;  2R92 A;  2K3O A;  3H0G A;  1Y2M A;  2X0P A;  2VUM A;  2LTH A;  2CW0 D;  1WCM A;  2N3E A;  3GTG A;  2VK9 A;  1Y1V A;  2LPI A;  5IZ2 A; 
#chains in the Genus database with same CATH homology
 2X0Q A;  2E2H A;  3LR2 A;  1IW7 D;  2BE5 D;  3LR6 A;  2N1D B;  2JA6 A;  3GTO A;  3CQZ A;  1TWG A;  2A6H D;  2R7Z A;  2YU9 A;  2A68 D;  2FIP A;  3LRD A;  1K83 A;  1TWA A;  3GTL A;  3GTQ A;  1YNN D;  4QIW A;  3U4Q A;  3GTP A;  4C2M A;  2AQL A;  2LKM B;  2A69 D;  2JA7 A;  1ZYR D;  1SFO A;  2NVY A;  2Y0N A;  2K3N A;  3LR8 A;  4CEH A;  2MX8 A;  2MQA A;  1HQM D;  2X0O A;  3GTJ A;  2R93 A;  1YNJ D;  1SMY D;  3GTM A;  2E2I A;  3U44 A;  4CEI A;  2NVX A;  3FKI A;  2O5J D;  1TWF A;  1TWH A;  2LYI A;  2LPJ A;  2JA5 A;  1I3Q A;  2B63 A;  1I6V D;  2FIO A;  2MX9 A;  4FBS A;  2A6E D;  2K3Q A;  3GTK A;  1TWC A;  4CEJ A;  1I50 A;  2F5J A;  1R9T A;  1Y1W A;  2R92 A;  2K3O A;  3H0G A;  2X0P A;  2VUM A;  2LTH A;  2CW0 D;  1WCM A;  2N3E A;  3GTG A;  2VK9 A;  1Y1V A;  2LPI A;  5IZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...