2MX9A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 5.5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
133
structure length
133
Chain Sequence
GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
molecule tags Structural protein
molecule keywords Minor ampullate spidroin
total genus 45
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx9A01
2LTHA 4FBSA 2MX8A 2LPJA 3LR2A 5IZ2A 2MX9A 3LR6A 3LR8A 2LPIA 3LRDA 2N3EA 2K3QA
chains in the Genus database with same CATH superfamily
2CW0D 2LPJA 1I3QA 1HQMD 3U4QA 2O5JD 3NZ4A 2MX8A 2AQLA 3GTOA 2R92A 2MP0A 1EZBA 1W27A 2N1DB 2JA6A 1ZYRD 1R9TA 2R7ZA 3EZBA 3GTMA 2VK9A 2YU9A 2FIOA 1YNND 1T6JA 1SMYD 1TWHA 2YIIA 2LPIA 2X0PA 4BABA 4BAAA 1K83A 2A6HD 1I6VD 3GTJA 2MQAA 2LYIA 1T6PA 2MX9A 4V2RA 3GTLA 2JA5A 4V2QA 2VUMA 4FBSA 4QIWA 1SFOA 3GTQA 3GTPA 1EZAA 1I50A 4C2MA 1Y1WA 1Y1VA 1ZYMA 2X0QA 2EZAA 2E2IA 3GTGA 2K3OA 2NVYA 2F5JA 3U44A 2BE5D 3H0GA 2E2HA 2R93A 4CEIA 1TWAA 2K3QA 2K3NA 4C5UA 3GTKA 2HROA 2HWGA 2B63A 2A69D 2LTHA 3EZEA 2FIPA 4C5SA 2N3EA 2A6ED 1TWCA 1WCMA 5IZ2A 2EZBA 3LR6A 4C6GA 1TWGA 3EZAA 2NVXA 1Y2MA 3CQZA 3LRDA 2EZCA 2X0OA 2JA7A 2Y0NA 2LKMB 3FKIA 1YNJD 3LR2A 1IW7D 4CEHA 3LR8A 4CQ5A 4CEJA 4C5RA 2A68D 1TWFA
chains in the Genus database with same CATH topology
2CW0D 2LPJA 1I3QA 1HQMD 3U4QA 2O5JD 2MX8A 2AQLA 3GTOA 2R92A 2N1DB 2JA6A 1ZYRD 1R9TA 2R7ZA 3GTMA 2VK9A 2YU9A 2FIOA 1YNND 1SMYD 1TWHA 2LPIA 2X0PA 1K83A 2A6HD 1I6VD 3GTJA 2MQAA 2LYIA 2MX9A 3GTLA 2JA5A 2VUMA 4FBSA 4QIWA 1SFOA 3GTQA 3GTPA 1I50A 4C2MA 1Y1WA 1Y1VA 2X0QA 2E2IA 3GTGA 2K3OA 2NVYA 2F5JA 3U44A 2BE5D 3H0GA 2E2HA 2R93A 4CEIA 1TWAA 2K3QA 2K3NA 3GTKA 2B63A 2A69D 2LTHA 2FIPA 2N3EA 2A6ED 1TWCA 1WCMA 5IZ2A 3LR6A 1TWGA 2NVXA 3CQZA 3LRDA 2X0OA 2JA7A 2Y0NA 2LKMB 3FKIA 1YNJD 3LR2A 1IW7D 4CEHA 3LR8A 4CEJA 2A68D 1TWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTH A;  4FBS A;  2MX8 A;  2LPJ A;  3LR2 A;  5IZ2 A;  2MX9 A;  3LR6 A;  3LR8 A;  2LPI A;  3LRD A;  2N3E A;  2K3Q A; 
#chains in the Genus database with same CATH topology
 2CW0 D;  2LPJ A;  1I3Q A;  1HQM D;  3U4Q A;  2O5J D;  3NZ4 A;  2MX8 A;  2AQL A;  3GTO A;  2R92 A;  2MP0 A;  1EZB A;  1W27 A;  2N1D B;  2JA6 A;  1ZYR D;  1R9T A;  2R7Z A;  3EZB A;  3GTM A;  2VK9 A;  2YU9 A;  2FIO A;  1YNN D;  1T6J A;  1SMY D;  1TWH A;  2YII A;  2LPI A;  2X0P A;  4BAB A;  4BAA A;  1K83 A;  2A6H D;  1I6V D;  3GTJ A;  2MQA A;  2LYI A;  1T6P A;  2MX9 A;  4V2R A;  3GTL A;  2JA5 A;  4V2Q A;  2VUM A;  4FBS A;  4QIW A;  1SFO A;  3GTQ A;  3GTP A;  1EZA A;  1I50 A;  4C2M A;  1Y1W A;  1Y1V A;  1ZYM A;  2X0Q A;  2EZA A;  2E2I A;  3GTG A;  2K3O A;  2NVY A;  2F5J A;  3U44 A;  2BE5 D;  3H0G A;  2E2H A;  2R93 A;  4CEI A;  1TWA A;  2K3Q A;  2K3N A;  4C5U A;  3GTK A;  2HRO A;  2HWG A;  2B63 A;  2A69 D;  2LTH A;  3EZE A;  2FIP A;  4C5S A;  2N3E A;  2A6E D;  1TWC A;  1WCM A;  5IZ2 A;  2EZB A;  3LR6 A;  4C6G A;  1TWG A;  3EZA A;  2NVX A;  1Y2M A;  3CQZ A;  3LRD A;  2EZC A;  2X0O A;  2JA7 A;  2Y0N A;  2LKM B;  3FKI A;  1YNJ D;  3LR2 A;  1IW7 D;  4CEH A;  3LR8 A;  4CQ5 A;  4CEJ A;  4C5R A;  2A68 D;  1TWF A; 
#chains in the Genus database with same CATH homology
 2CW0 D;  2LPJ A;  1I3Q A;  1HQM D;  3U4Q A;  2O5J D;  2MX8 A;  2AQL A;  3GTO A;  2R92 A;  2N1D B;  2JA6 A;  1ZYR D;  1R9T A;  2R7Z A;  3GTM A;  2VK9 A;  2YU9 A;  2FIO A;  1YNN D;  1SMY D;  1TWH A;  2LPI A;  2X0P A;  1K83 A;  2A6H D;  1I6V D;  3GTJ A;  2MQA A;  2LYI A;  2MX9 A;  3GTL A;  2JA5 A;  2VUM A;  4FBS A;  4QIW A;  1SFO A;  3GTQ A;  3GTP A;  1I50 A;  4C2M A;  1Y1W A;  1Y1V A;  2X0Q A;  2E2I A;  3GTG A;  2K3O A;  2NVY A;  2F5J A;  3U44 A;  2BE5 D;  3H0G A;  2E2H A;  2R93 A;  4CEI A;  1TWA A;  2K3Q A;  2K3N A;  3GTK A;  2B63 A;  2A69 D;  2LTH A;  2FIP A;  2N3E A;  2A6E D;  1TWC A;  1WCM A;  5IZ2 A;  3LR6 A;  1TWG A;  2NVX A;  3CQZ A;  3LRD A;  2X0O A;  2JA7 A;  2Y0N A;  2LKM B;  3FKI A;  1YNJ D;  3LR2 A;  1IW7 D;  4CEH A;  3LR8 A;  4CEJ A;  2A68 D;  1TWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...