2MX9A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 5.5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
133
structure length
133
Chain Sequence
GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate spidroin
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
molecule tags Structural protein
total genus 45
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx9A01
2MX8A 3LR8A 4FBSA 2K3QA 2LPJA 3LR2A 2MX9A 3LR6A 2LPIA 3LRDA 5IZ2A 2LTHA 2N3EA
chains in the Genus database with same CATH superfamily
3LR8A 2X0QA 4C5UA 3GTLA 1Y1VA 2YIIA 2LPIA 4C5RA 4V2RA 5IZ2A 3EZAA 1TWHA 2X0OA 1TWFA 3GTGA 1EZBA 1Y2MA 1ZYRD 2LPJA 4C2MA 2YU9A 2MQAA 4BAAA 2B63A 1SMYD 2A6HD 3NZ4A 2EZCA 2O5JD 3CQZA 1I3QA 1EZAA 4CEIA 2FIOA 2A6ED 2BE5D 1TWGA 1T6JA 1TWCA 3GTQA 3GTMA 3H0GA 2Y0NA 3LR2A 4C6GA 3EZEA 2K3OA 2HWGA 1YNJD 2A68D 2FIPA 3U44A 2R92A 3U4QA 1SFOA 1IW7D 2N1DB 4QIWA 2JA7A 1R9TA 1I6VD 4C5SA 3GTOA 2EZAA 2K3QA 2MX9A 1I50A 2JA5A 1YNND 2VK9A 4CEJA 2EZBA 2F5JA 3EZBA 4V2QA 1WCMA 2NVXA 2LYIA 2CW0D 3FKIA 2K3NA 2JA6A 3LRDA 1HQMD 1K83A 2E2HA 2A69D 2MX8A 2NVYA 4FBSA 2LKMB 1T6PA 3LR6A 2LTHA 1TWAA 2R93A 4CEHA 3GTPA 2MP0A 2HROA 2E2IA 1ZYMA 3GTKA 4BABA 2X0PA 3GTJA 2R7ZA 2N3EA 2AQLA 2VUMA 4CQ5A 1W27A 1Y1WA
chains in the Genus database with same CATH topology
3LR8A 2X0QA 3GTLA 1Y1VA 2LPIA 5IZ2A 1TWHA 2X0OA 1TWFA 3GTGA 1ZYRD 2LPJA 4C2MA 2YU9A 2MQAA 2B63A 1SMYD 2A6HD 2O5JD 3CQZA 1I3QA 4CEIA 2FIOA 2A6ED 2BE5D 1TWGA 1TWCA 3GTQA 3GTMA 3H0GA 2Y0NA 3LR2A 2K3OA 1YNJD 2A68D 3U44A 2FIPA 2R92A 3U4QA 1SFOA 1IW7D 2N1DB 4QIWA 2JA7A 1R9TA 1I6VD 3GTOA 2K3QA 2MX9A 1I50A 2JA5A 1YNND 2VK9A 4CEJA 2F5JA 1WCMA 2NVXA 2LYIA 2CW0D 3FKIA 2K3NA 2JA6A 3LRDA 1HQMD 1K83A 2E2HA 2A69D 2MX8A 2NVYA 4FBSA 2LKMB 3LR6A 2LTHA 1TWAA 2R93A 4CEHA 3GTPA 2E2IA 3GTKA 2X0PA 3GTJA 2R7ZA 2N3EA 2AQLA 2VUMA 1Y1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MX8 A;  3LR8 A;  4FBS A;  2K3Q A;  2LPJ A;  3LR2 A;  2MX9 A;  3LR6 A;  2LPI A;  3LRD A;  5IZ2 A;  2LTH A;  2N3E A; 
#chains in the Genus database with same CATH topology
 3LR8 A;  2X0Q A;  4C5U A;  3GTL A;  1Y1V A;  2YII A;  2LPI A;  4C5R A;  4V2R A;  5IZ2 A;  3EZA A;  1TWH A;  2X0O A;  1TWF A;  3GTG A;  1EZB A;  1Y2M A;  1ZYR D;  2LPJ A;  4C2M A;  2YU9 A;  2MQA A;  4BAA A;  2B63 A;  1SMY D;  2A6H D;  3NZ4 A;  2EZC A;  2O5J D;  3CQZ A;  1I3Q A;  1EZA A;  4CEI A;  2FIO A;  2A6E D;  2BE5 D;  1TWG A;  1T6J A;  1TWC A;  3GTQ A;  3GTM A;  3H0G A;  2Y0N A;  3LR2 A;  4C6G A;  3EZE A;  2K3O A;  2HWG A;  1YNJ D;  2A68 D;  2FIP A;  3U44 A;  2R92 A;  3U4Q A;  1SFO A;  1IW7 D;  2N1D B;  4QIW A;  2JA7 A;  1R9T A;  1I6V D;  4C5S A;  3GTO A;  2EZA A;  2K3Q A;  2MX9 A;  1I50 A;  2JA5 A;  1YNN D;  2VK9 A;  4CEJ A;  2EZB A;  2F5J A;  3EZB A;  4V2Q A;  1WCM A;  2NVX A;  2LYI A;  2CW0 D;  3FKI A;  2K3N A;  2JA6 A;  3LRD A;  1HQM D;  1K83 A;  2E2H A;  2A69 D;  2MX8 A;  2NVY A;  4FBS A;  2LKM B;  1T6P A;  3LR6 A;  2LTH A;  1TWA A;  2R93 A;  4CEH A;  3GTP A;  2MP0 A;  2HRO A;  2E2I A;  1ZYM A;  3GTK A;  4BAB A;  2X0P A;  3GTJ A;  2R7Z A;  2N3E A;  2AQL A;  2VUM A;  4CQ5 A;  1W27 A;  1Y1W A; 
#chains in the Genus database with same CATH homology
 3LR8 A;  2X0Q A;  3GTL A;  1Y1V A;  2LPI A;  5IZ2 A;  1TWH A;  2X0O A;  1TWF A;  3GTG A;  1ZYR D;  2LPJ A;  4C2M A;  2YU9 A;  2MQA A;  2B63 A;  1SMY D;  2A6H D;  2O5J D;  3CQZ A;  1I3Q A;  4CEI A;  2FIO A;  2A6E D;  2BE5 D;  1TWG A;  1TWC A;  3GTQ A;  3GTM A;  3H0G A;  2Y0N A;  3LR2 A;  2K3O A;  1YNJ D;  2A68 D;  3U44 A;  2FIP A;  2R92 A;  3U4Q A;  1SFO A;  1IW7 D;  2N1D B;  4QIW A;  2JA7 A;  1R9T A;  1I6V D;  3GTO A;  2K3Q A;  2MX9 A;  1I50 A;  2JA5 A;  1YNN D;  2VK9 A;  4CEJ A;  2F5J A;  1WCM A;  2NVX A;  2LYI A;  2CW0 D;  3FKI A;  2K3N A;  2JA6 A;  3LRD A;  1HQM D;  1K83 A;  2E2H A;  2A69 D;  2MX8 A;  2NVY A;  4FBS A;  2LKM B;  3LR6 A;  2LTH A;  1TWA A;  2R93 A;  4CEH A;  3GTP A;  2E2I A;  3GTK A;  2X0P A;  3GTJ A;  2R7Z A;  2N3E A;  2AQL A;  2VUM A;  1Y1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...