2LKMB

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYRKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 12
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lkmB00
2AQLA 2F5JA 2Y0NA 2LKMB 2N1DB
chains in the Genus database with same CATH superfamily
1SFOA 2E2IA 1W27A 2A6ED 2CW0D 4QIWA 2FIPA 4V2RA 1Y1VA 1Y1WA 2A6HD 3LR6A 4C2MA 2EZBA 2MX8A 3GTGA 2N1DB 2K3OA 3EZEA 2YU9A 2R7ZA 2LPIA 4CQ5A 4CEIA 3EZBA 3U44A 2K3NA 1EZBA 4BAAA 2E2HA 2NVYA 3LR8A 2X0OA 4C5SA 2B63A 1I6VD 3GTKA 3U4QA 3FKIA 2EZCA 2MQAA 2EZAA 2A69D 2X0PA 2YIIA 2MX9A 1ZYRD 2HROA 1I50A 1Y2MA 4C5RA 2NVXA 2LYIA 2F5JA 2FIOA 1R9TA 3GTJA 1T6JA 2LKMB 2N3EA 3GTPA 3LR2A 3GTQA 4V2QA 1IW7D 1TWGA 2A68D 4CEHA 1HQMD 2R93A 2AQLA 2Y0NA 2HWGA 3CQZA 1T6PA 4FBSA 1YNND 2LPJA 2O5JD 4C6GA 2JA6A 2VK9A 5IZ2A 1EZAA 3NZ4A 3EZAA 3LRDA 1TWFA 4C5UA 1TWCA 3GTMA 2X0QA 4CEJA 1SMYD 1K83A 2VUMA 2BE5D 4BABA 1I3QA 1ZYMA 1TWHA 2JA5A 2LTHA 1TWAA 2JA7A 3GTOA 2K3QA 3H0GA 1WCMA 1YNJD 2MP0A 2R92A 3GTLA
chains in the Genus database with same CATH topology
1SFOA 2E2IA 2A6ED 2CW0D 4QIWA 2FIPA 1Y1VA 1Y1WA 2A6HD 3LR6A 4C2MA 2MX8A 3GTGA 2N1DB 2K3OA 2YU9A 2R7ZA 2LPIA 4CEIA 3U44A 2K3NA 2E2HA 2NVYA 3LR8A 2X0OA 2B63A 1I6VD 3GTKA 3U4QA 3FKIA 2MQAA 2A69D 2X0PA 2MX9A 1ZYRD 1I50A 2NVXA 2LYIA 2F5JA 2FIOA 1R9TA 3GTJA 2LKMB 2N3EA 3GTPA 3LR2A 3GTQA 1IW7D 1TWGA 2A68D 4CEHA 1HQMD 2R93A 2AQLA 2Y0NA 3CQZA 4FBSA 1YNND 2LPJA 2O5JD 2JA6A 2VK9A 5IZ2A 3LRDA 1TWFA 1TWCA 3GTMA 2X0QA 4CEJA 1SMYD 1K83A 2VUMA 2BE5D 1I3QA 1TWHA 2JA5A 2LTHA 1TWAA 2JA7A 3GTOA 2K3QA 3H0GA 1WCMA 1YNJD 2R92A 3GTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQL A;  2F5J A;  2Y0N A;  2LKM B;  2N1D B; 
#chains in the Genus database with same CATH topology
 1SFO A;  2E2I A;  1W27 A;  2A6E D;  2CW0 D;  4QIW A;  2FIP A;  4V2R A;  1Y1V A;  1Y1W A;  2A6H D;  3LR6 A;  4C2M A;  2EZB A;  2MX8 A;  3GTG A;  2N1D B;  2K3O A;  3EZE A;  2YU9 A;  2R7Z A;  2LPI A;  4CQ5 A;  4CEI A;  3EZB A;  3U44 A;  2K3N A;  1EZB A;  4BAA A;  2E2H A;  2NVY A;  3LR8 A;  2X0O A;  4C5S A;  2B63 A;  1I6V D;  3GTK A;  3U4Q A;  3FKI A;  2EZC A;  2MQA A;  2EZA A;  2A69 D;  2X0P A;  2YII A;  2MX9 A;  1ZYR D;  2HRO A;  1I50 A;  1Y2M A;  4C5R A;  2NVX A;  2LYI A;  2F5J A;  2FIO A;  1R9T A;  3GTJ A;  1T6J A;  2LKM B;  2N3E A;  3GTP A;  3LR2 A;  3GTQ A;  4V2Q A;  1IW7 D;  1TWG A;  2A68 D;  4CEH A;  1HQM D;  2R93 A;  2AQL A;  2Y0N A;  2HWG A;  3CQZ A;  1T6P A;  4FBS A;  1YNN D;  2LPJ A;  2O5J D;  4C6G A;  2JA6 A;  2VK9 A;  5IZ2 A;  1EZA A;  3NZ4 A;  3EZA A;  3LRD A;  1TWF A;  4C5U A;  1TWC A;  3GTM A;  2X0Q A;  4CEJ A;  1SMY D;  1K83 A;  2VUM A;  2BE5 D;  4BAB A;  1I3Q A;  1ZYM A;  1TWH A;  2JA5 A;  2LTH A;  1TWA A;  2JA7 A;  3GTO A;  2K3Q A;  3H0G A;  1WCM A;  1YNJ D;  2MP0 A;  2R92 A;  3GTL A; 
#chains in the Genus database with same CATH homology
 1SFO A;  2E2I A;  2A6E D;  2CW0 D;  4QIW A;  2FIP A;  1Y1V A;  1Y1W A;  2A6H D;  3LR6 A;  4C2M A;  2MX8 A;  3GTG A;  2N1D B;  2K3O A;  2YU9 A;  2R7Z A;  2LPI A;  4CEI A;  3U44 A;  2K3N A;  2E2H A;  2NVY A;  3LR8 A;  2X0O A;  2B63 A;  1I6V D;  3GTK A;  3U4Q A;  3FKI A;  2MQA A;  2A69 D;  2X0P A;  2MX9 A;  1ZYR D;  1I50 A;  2NVX A;  2LYI A;  2F5J A;  2FIO A;  1R9T A;  3GTJ A;  2LKM B;  2N3E A;  3GTP A;  3LR2 A;  3GTQ A;  1IW7 D;  1TWG A;  2A68 D;  4CEH A;  1HQM D;  2R93 A;  2AQL A;  2Y0N A;  3CQZ A;  4FBS A;  1YNN D;  2LPJ A;  2O5J D;  2JA6 A;  2VK9 A;  5IZ2 A;  3LRD A;  1TWF A;  1TWC A;  3GTM A;  2X0Q A;  4CEJ A;  1SMY D;  1K83 A;  2VUM A;  2BE5 D;  1I3Q A;  1TWH A;  2JA5 A;  2LTH A;  1TWA A;  2JA7 A;  3GTO A;  2K3Q A;  3H0G A;  1WCM A;  1YNJ D;  2R92 A;  3GTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...