2LKMB

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYRKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 12
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lkmB00
2AQLA 2F5JA 2N1DB 2LKMB 2Y0NA
chains in the Genus database with same CATH superfamily
2VUMA 1W27A 4C5SA 3GTJA 2O5JD 2LYIA 2K3QA 4CEJA 1SMYD 2F5JA 3GTQA 1TWAA 1I50A 2E2IA 2BE5D 3GTLA 3LRDA 2HWGA 1HQMD 2A68D 2Y0NA 1R9TA 2FIPA 2JA5A 4CQ5A 2LPIA 1WCMA 4C6GA 1Y2MA 3EZBA 2NVXA 2VK9A 2X0QA 2LTHA 2EZAA 2AQLA 2MX8A 3H0GA 2JA6A 1TWCA 4BABA 1ZYRD 2HROA 1TWGA 2JA7A 1TWHA 2MP0A 2N3EA 2EZCA 1EZAA 2FIOA 5IZ2A 3GTMA 1T6JA 1Y1VA 3GTOA 2MQAA 2YU9A 4FBSA 2EZBA 3GTPA 3EZEA 3U4QA 4BAAA 1Y1WA 2NVYA 2LKMB 4CEHA 3GTKA 3CQZA 2R7ZA 4V2QA 2E2HA 1YNJD 1YNND 1I6VD 2A6HD 1IW7D 4CEIA 1K83A 3FKIA 2X0OA 2CW0D 2YIIA 3U44A 3NZ4A 1I3QA 2A69D 4C2MA 1T6PA 3LR8A 1ZYMA 2MX9A 3LR2A 1SFOA 2LPJA 3EZAA 3GTGA 1EZBA 4C5RA 2R92A 3LR6A 2K3NA 2X0PA 2K3OA 4V2RA 2R93A 1TWFA 4C5UA 2B63A 2A6ED 2N1DB 4QIWA
chains in the Genus database with same CATH topology
2VUMA 3GTJA 2O5JD 2LYIA 2K3QA 4CEJA 1SMYD 2F5JA 3GTQA 1TWAA 1I50A 2E2IA 2BE5D 3GTLA 3LRDA 1HQMD 2A68D 2Y0NA 1R9TA 2FIPA 2JA5A 2LPIA 1WCMA 2NVXA 2VK9A 2X0QA 2LTHA 2MX8A 2AQLA 3H0GA 2JA6A 1TWCA 1ZYRD 1TWGA 2JA7A 1TWHA 2N3EA 2FIOA 5IZ2A 3GTMA 1Y1VA 3GTOA 2MQAA 2YU9A 4FBSA 3GTPA 3U4QA 1Y1WA 2NVYA 2LKMB 4CEHA 3GTKA 3CQZA 2R7ZA 2E2HA 1YNJD 1YNND 1I6VD 2A6HD 1IW7D 4CEIA 1K83A 3FKIA 2X0OA 2CW0D 3U44A 1I3QA 2A69D 4C2MA 3LR8A 2MX9A 3LR2A 1SFOA 2LPJA 3GTGA 2R92A 3LR6A 2K3NA 2X0PA 2K3OA 2R93A 1TWFA 2B63A 2A6ED 2N1DB 4QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQL A;  2F5J A;  2N1D B;  2LKM B;  2Y0N A; 
#chains in the Genus database with same CATH topology
 2VUM A;  1W27 A;  4C5S A;  3GTJ A;  2O5J D;  2LYI A;  2K3Q A;  4CEJ A;  1SMY D;  2F5J A;  3GTQ A;  1TWA A;  1I50 A;  2E2I A;  2BE5 D;  3GTL A;  3LRD A;  2HWG A;  1HQM D;  2A68 D;  2Y0N A;  1R9T A;  2FIP A;  2JA5 A;  4CQ5 A;  2LPI A;  1WCM A;  4C6G A;  1Y2M A;  3EZB A;  2NVX A;  2VK9 A;  2X0Q A;  2LTH A;  2EZA A;  2AQL A;  2MX8 A;  3H0G A;  2JA6 A;  1TWC A;  4BAB A;  1ZYR D;  2HRO A;  1TWG A;  2JA7 A;  1TWH A;  2MP0 A;  2N3E A;  2EZC A;  1EZA A;  2FIO A;  5IZ2 A;  3GTM A;  1T6J A;  1Y1V A;  3GTO A;  2MQA A;  2YU9 A;  4FBS A;  2EZB A;  3GTP A;  3EZE A;  3U4Q A;  4BAA A;  1Y1W A;  2NVY A;  2LKM B;  4CEH A;  3GTK A;  3CQZ A;  2R7Z A;  4V2Q A;  2E2H A;  1YNJ D;  1YNN D;  1I6V D;  2A6H D;  1IW7 D;  4CEI A;  1K83 A;  3FKI A;  2X0O A;  2CW0 D;  2YII A;  3U44 A;  3NZ4 A;  1I3Q A;  2A69 D;  4C2M A;  1T6P A;  3LR8 A;  1ZYM A;  2MX9 A;  3LR2 A;  1SFO A;  2LPJ A;  3EZA A;  3GTG A;  1EZB A;  4C5R A;  2R92 A;  3LR6 A;  2K3N A;  2X0P A;  2K3O A;  4V2R A;  2R93 A;  1TWF A;  4C5U A;  2B63 A;  2A6E D;  2N1D B;  4QIW A; 
#chains in the Genus database with same CATH homology
 2VUM A;  3GTJ A;  2O5J D;  2LYI A;  2K3Q A;  4CEJ A;  1SMY D;  2F5J A;  3GTQ A;  1TWA A;  1I50 A;  2E2I A;  2BE5 D;  3GTL A;  3LRD A;  1HQM D;  2A68 D;  2Y0N A;  1R9T A;  2FIP A;  2JA5 A;  2LPI A;  1WCM A;  2NVX A;  2VK9 A;  2X0Q A;  2LTH A;  2MX8 A;  2AQL A;  3H0G A;  2JA6 A;  1TWC A;  1ZYR D;  1TWG A;  2JA7 A;  1TWH A;  2N3E A;  2FIO A;  5IZ2 A;  3GTM A;  1Y1V A;  3GTO A;  2MQA A;  2YU9 A;  4FBS A;  3GTP A;  3U4Q A;  1Y1W A;  2NVY A;  2LKM B;  4CEH A;  3GTK A;  3CQZ A;  2R7Z A;  2E2H A;  1YNJ D;  1YNN D;  1I6V D;  2A6H D;  1IW7 D;  4CEI A;  1K83 A;  3FKI A;  2X0O A;  2CW0 D;  3U44 A;  1I3Q A;  2A69 D;  4C2M A;  3LR8 A;  2MX9 A;  3LR2 A;  1SFO A;  2LPJ A;  3GTG A;  2R92 A;  3LR6 A;  2K3N A;  2X0P A;  2K3O A;  2R93 A;  1TWF A;  2B63 A;  2A6E D;  2N1D B;  4QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...