2LKMB

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYRKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PHD finger protein 12
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lkmB00
2F5JA 2N1DB 2Y0NA 2LKMB 2AQLA
chains in the Genus database with same CATH superfamily
2K3QA 3GTOA 3GTGA 3GTQA 3GTPA 2JA5A 2BE5D 2YIIA 2LKMB 4V2QA 4BAAA 4CQ5A 3U4QA 1YNND 2LYIA 2K3NA 2NVXA 2N1DB 2HWGA 1I50A 1Y1VA 2X0QA 2R7ZA 1I3QA 3FKIA 3GTLA 1HQMD 1ZYMA 1W27A 2R93A 2K3OA 1Y2MA 4FBSA 1T6JA 1YNJD 2MQAA 4BABA 2HROA 3CQZA 2EZAA 2VUMA 3GTKA 1IW7D 1TWFA 3LR8A 2A68D 2FIPA 1ZYRD 4C6GA 1I6VD 2MX8A 5IZ2A 3EZEA 1SFOA 1EZBA 1TWCA 4C5SA 2JA7A 2X0OA 1Y1WA 3LRDA 2LPJA 2LPIA 2AQLA 2E2HA 2JA6A 2EZCA 3EZBA 1TWHA 2A69D 1SMYD 2F5JA 2O5JD 2FIOA 2VK9A 1R9TA 3EZAA 2MX9A 2R92A 4C5UA 3H0GA 4CEIA 2X0PA 2MP0A 1K83A 2N3EA 2E2IA 2A6ED 1TWAA 1T6PA 4CEJA 4CEHA 1WCMA 2Y0NA 2EZBA 2NVYA 3GTMA 2CW0D 3LR2A 4V2RA 2B63A 1EZAA 1TWGA 2A6HD 3NZ4A 3LR6A 4C5RA 4QIWA 2LTHA 4C2MA 3U44A 3GTJA 2YU9A
chains in the Genus database with same CATH topology
2K3QA 3GTOA 3GTGA 3GTQA 3GTPA 2JA5A 2BE5D 2LKMB 3U4QA 1YNND 2LYIA 2K3NA 2NVXA 2N1DB 1I50A 1Y1VA 2X0QA 2R7ZA 1I3QA 3FKIA 3GTLA 1HQMD 2R93A 2K3OA 4FBSA 1YNJD 2MQAA 3CQZA 2VUMA 3GTKA 1IW7D 1TWFA 3LR8A 2A68D 2FIPA 1ZYRD 1I6VD 2MX8A 5IZ2A 1SFOA 1TWCA 2JA7A 2X0OA 1Y1WA 3LRDA 2LPJA 2LPIA 2AQLA 2E2HA 2JA6A 1TWHA 2A69D 1SMYD 2F5JA 2O5JD 2FIOA 2VK9A 1R9TA 2MX9A 2R92A 4CEIA 3H0GA 2X0PA 1K83A 2N3EA 2E2IA 2A6ED 1TWAA 4CEJA 4CEHA 1WCMA 2Y0NA 2NVYA 3GTMA 2CW0D 3LR2A 2B63A 1TWGA 2A6HD 3LR6A 4QIWA 2LTHA 4C2MA 3U44A 3GTJA 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5J A;  2N1D B;  2Y0N A;  2LKM B;  2AQL A; 
#chains in the Genus database with same CATH topology
 2K3Q A;  3GTO A;  3GTG A;  3GTQ A;  3GTP A;  2JA5 A;  2BE5 D;  2YII A;  2LKM B;  4V2Q A;  4BAA A;  4CQ5 A;  3U4Q A;  1YNN D;  2LYI A;  2K3N A;  2NVX A;  2N1D B;  2HWG A;  1I50 A;  1Y1V A;  2X0Q A;  2R7Z A;  1I3Q A;  3FKI A;  3GTL A;  1HQM D;  1ZYM A;  1W27 A;  2R93 A;  2K3O A;  1Y2M A;  4FBS A;  1T6J A;  1YNJ D;  2MQA A;  4BAB A;  2HRO A;  3CQZ A;  2EZA A;  2VUM A;  3GTK A;  1IW7 D;  1TWF A;  3LR8 A;  2A68 D;  2FIP A;  1ZYR D;  4C6G A;  1I6V D;  2MX8 A;  5IZ2 A;  3EZE A;  1SFO A;  1EZB A;  1TWC A;  4C5S A;  2JA7 A;  2X0O A;  1Y1W A;  3LRD A;  2LPJ A;  2LPI A;  2AQL A;  2E2H A;  2JA6 A;  2EZC A;  3EZB A;  1TWH A;  2A69 D;  1SMY D;  2F5J A;  2O5J D;  2FIO A;  2VK9 A;  1R9T A;  3EZA A;  2MX9 A;  2R92 A;  4C5U A;  3H0G A;  4CEI A;  2X0P A;  2MP0 A;  1K83 A;  2N3E A;  2E2I A;  2A6E D;  1TWA A;  1T6P A;  4CEJ A;  4CEH A;  1WCM A;  2Y0N A;  2EZB A;  2NVY A;  3GTM A;  2CW0 D;  3LR2 A;  4V2R A;  2B63 A;  1EZA A;  1TWG A;  2A6H D;  3NZ4 A;  3LR6 A;  4C5R A;  4QIW A;  2LTH A;  4C2M A;  3U44 A;  3GTJ A;  2YU9 A; 
#chains in the Genus database with same CATH homology
 2K3Q A;  3GTO A;  3GTG A;  3GTQ A;  3GTP A;  2JA5 A;  2BE5 D;  2LKM B;  3U4Q A;  1YNN D;  2LYI A;  2K3N A;  2NVX A;  2N1D B;  1I50 A;  1Y1V A;  2X0Q A;  2R7Z A;  1I3Q A;  3FKI A;  3GTL A;  1HQM D;  2R93 A;  2K3O A;  4FBS A;  1YNJ D;  2MQA A;  3CQZ A;  2VUM A;  3GTK A;  1IW7 D;  1TWF A;  3LR8 A;  2A68 D;  2FIP A;  1ZYR D;  1I6V D;  2MX8 A;  5IZ2 A;  1SFO A;  1TWC A;  2JA7 A;  2X0O A;  1Y1W A;  3LRD A;  2LPJ A;  2LPI A;  2AQL A;  2E2H A;  2JA6 A;  1TWH A;  2A69 D;  1SMY D;  2F5J A;  2O5J D;  2FIO A;  2VK9 A;  1R9T A;  2MX9 A;  2R92 A;  4CEI A;  3H0G A;  2X0P A;  1K83 A;  2N3E A;  2E2I A;  2A6E D;  1TWA A;  4CEJ A;  4CEH A;  1WCM A;  2Y0N A;  2NVY A;  3GTM A;  2CW0 D;  3LR2 A;  2B63 A;  1TWG A;  2A6H D;  3LR6 A;  4QIW A;  2LTH A;  4C2M A;  3U44 A;  3GTJ A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...