2LKMB

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
b'SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYRKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 12
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 46
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lkmB00
2N1DB 2LKMB 2Y0NA 2AQLA 2F5JA
chains in the Genus database with same CATH superfamily
2JA6A 3GTGA 3CQZA 3LRDA 2HWGA 2FIOA 3U44A 1TWFA 3GTJA 1R9TA 2A68D 1T6PA 3EZEA 4CEIA 3GTQA 4C5SA 2MX8A 3NZ4A 3GTOA 2JA7A 4QIWA 2R7ZA 3GTKA 3LR2A 1TWGA 2Y0NA 1YNJD 3GTLA 1W27A 2EZBA 2X0QA 3LR6A 1Y1WA 2MX9A 2AQLA 1TWAA 4C5RA 1HQMD 2A6HD 2LPIA 3EZAA 1ZYRD 1YNND 2MP0A 3EZBA 1SFOA 2K3NA 2K3QA 4C2MA 4CEJA 2X0OA 2A69D 2R93A 2VK9A 2LYIA 2F5JA 2YU9A 1T6JA 1SMYD 1EZBA 2R92A 2BE5D 2E2IA 2JA5A 2EZAA 2HROA 1I50A 4CEHA 4V2QA 4BAAA 2B63A 2LKMB 2CW0D 2E2HA 3GTPA 1ZYMA 1Y2MA 2LTHA 3U4QA 2O5JD 4CQ5A 3GTMA 4V2RA 2X0PA 3LR8A 4C5UA 1TWCA 2MQAA 3FKIA 1WCMA 1TWHA 1EZAA 1IW7D 1Y1VA 2FIPA 1K83A 2N1DB 2VUMA 2LPJA 2N3EA 3H0GA 5IZ2A 2A6ED 2NVYA 4BABA 2NVXA 1I6VD 2EZCA 1I3QA 2YIIA 2K3OA 4C6GA 4FBSA
chains in the Genus database with same CATH topology
2JA6A 3GTGA 3CQZA 3LRDA 2FIOA 3U44A 1TWFA 3GTJA 1R9TA 2A68D 4CEIA 3GTQA 2MX8A 3GTOA 2JA7A 4QIWA 2R7ZA 3GTKA 3LR2A 1TWGA 2Y0NA 1YNJD 3GTLA 2X0QA 3LR6A 1Y1WA 2MX9A 2AQLA 1TWAA 1HQMD 2A6HD 2LPIA 1ZYRD 1YNND 1SFOA 2K3NA 2K3QA 4C2MA 4CEJA 2X0OA 2R93A 2A69D 2VK9A 2LYIA 2YU9A 2F5JA 1SMYD 2R92A 2BE5D 2E2IA 2JA5A 1I50A 4CEHA 2B63A 2LKMB 2CW0D 2E2HA 3GTPA 2LTHA 3U4QA 2O5JD 3GTMA 2X0PA 3LR8A 1TWCA 2MQAA 3FKIA 1WCMA 1TWHA 1IW7D 1Y1VA 2FIPA 1K83A 2N1DB 2VUMA 2LPJA 2N3EA 3H0GA 5IZ2A 2A6ED 2NVYA 2NVXA 1I6VD 1I3QA 2K3OA 4FBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1D B;  2LKM B;  2Y0N A;  2AQL A;  2F5J A; 
#chains in the Genus database with same CATH topology
 2JA6 A;  3GTG A;  3CQZ A;  3LRD A;  2HWG A;  2FIO A;  3U44 A;  1TWF A;  3GTJ A;  1R9T A;  2A68 D;  1T6P A;  3EZE A;  4CEI A;  3GTQ A;  4C5S A;  2MX8 A;  3NZ4 A;  3GTO A;  2JA7 A;  4QIW A;  2R7Z A;  3GTK A;  3LR2 A;  1TWG A;  2Y0N A;  1YNJ D;  3GTL A;  1W27 A;  2EZB A;  2X0Q A;  3LR6 A;  1Y1W A;  2MX9 A;  2AQL A;  1TWA A;  4C5R A;  1HQM D;  2A6H D;  2LPI A;  3EZA A;  1ZYR D;  1YNN D;  2MP0 A;  3EZB A;  1SFO A;  2K3N A;  2K3Q A;  4C2M A;  4CEJ A;  2X0O A;  2A69 D;  2R93 A;  2VK9 A;  2LYI A;  2F5J A;  2YU9 A;  1T6J A;  1SMY D;  1EZB A;  2R92 A;  2BE5 D;  2E2I A;  2JA5 A;  2EZA A;  2HRO A;  1I50 A;  4CEH A;  4V2Q A;  4BAA A;  2B63 A;  2LKM B;  2CW0 D;  2E2H A;  3GTP A;  1ZYM A;  1Y2M A;  2LTH A;  3U4Q A;  2O5J D;  4CQ5 A;  3GTM A;  4V2R A;  2X0P A;  3LR8 A;  4C5U A;  1TWC A;  2MQA A;  3FKI A;  1WCM A;  1TWH A;  1EZA A;  1IW7 D;  1Y1V A;  2FIP A;  1K83 A;  2N1D B;  2VUM A;  2LPJ A;  2N3E A;  3H0G A;  5IZ2 A;  2A6E D;  2NVY A;  4BAB A;  2NVX A;  1I6V D;  2EZC A;  1I3Q A;  2YII A;  2K3O A;  4C6G A;  4FBS A; 
#chains in the Genus database with same CATH homology
 2JA6 A;  3GTG A;  3CQZ A;  3LRD A;  2FIO A;  3U44 A;  1TWF A;  3GTJ A;  1R9T A;  2A68 D;  4CEI A;  3GTQ A;  2MX8 A;  3GTO A;  2JA7 A;  4QIW A;  2R7Z A;  3GTK A;  3LR2 A;  1TWG A;  2Y0N A;  1YNJ D;  3GTL A;  2X0Q A;  3LR6 A;  1Y1W A;  2MX9 A;  2AQL A;  1TWA A;  1HQM D;  2A6H D;  2LPI A;  1ZYR D;  1YNN D;  1SFO A;  2K3N A;  2K3Q A;  4C2M A;  4CEJ A;  2X0O A;  2R93 A;  2A69 D;  2VK9 A;  2LYI A;  2YU9 A;  2F5J A;  1SMY D;  2R92 A;  2BE5 D;  2E2I A;  2JA5 A;  1I50 A;  4CEH A;  2B63 A;  2LKM B;  2CW0 D;  2E2H A;  3GTP A;  2LTH A;  3U4Q A;  2O5J D;  3GTM A;  2X0P A;  3LR8 A;  1TWC A;  2MQA A;  3FKI A;  1WCM A;  1TWH A;  1IW7 D;  1Y1V A;  2FIP A;  1K83 A;  2N1D B;  2VUM A;  2LPJ A;  2N3E A;  3H0G A;  5IZ2 A;  2A6E D;  2NVY A;  2NVX A;  1I6V D;  1I3Q A;  2K3O A;  4FBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...