2LTHA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 5.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
b'GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Sequential pH-driven dimerization and stabilization of the N-terminal domain enables rapid spider silk formation.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 49
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lthA01
4FBSA 3LRDA 2LPIA 2MX9A 2K3QA 2LTHA 2LPJA 2N3EA 3LR2A 2MX8A 3LR8A 5IZ2A 3LR6A
chains in the Genus database with same CATH superfamily
1ZYMA 2YU9A 2MX9A 2LTHA 3GTMA 2HWGA 4C5RA 1R9TA 2LKMB 2R93A 1I6VD 2MQAA 1ZYRD 2FIOA 3GTJA 4V2QA 4C2MA 3FKIA 2X0OA 3H0GA 5IZ2A 3GTOA 4CEJA 2F5JA 2LPJA 3LR8A 2EZBA 2N3EA 2AQLA 3GTQA 2CW0D 3NZ4A 3EZAA 1I50A 2BE5D 3GTPA 3U44A 4FBSA 2X0QA 4BABA 2NVXA 3CQZA 2JA7A 2VUMA 2MP0A 3GTGA 1T6JA 2JA6A 2X0PA 2MX8A 2FIPA 1TWHA 3LRDA 1YNND 1WCMA 4CEHA 4C6GA 4QIWA 1TWAA 4C5UA 4CEIA 1EZAA 1YNJD 3GTKA 2E2HA 1IW7D 2LPIA 2N1DB 1I3QA 3EZEA 2A6HD 4V2RA 1SMYD 1K83A 1EZBA 2R7ZA 3EZBA 3LR6A 4CQ5A 2E2IA 3LR2A 1TWGA 2R92A 1Y1WA 2YIIA 2K3NA 2HROA 2EZAA 4BAAA 1TWFA 1TWCA 4C5SA 3GTLA 2O5JD 1HQMD 1Y1VA 2A69D 2B63A 2NVYA 2JA5A 2LYIA 1SFOA 2A6ED 1Y2MA 2EZCA 2K3OA 1T6PA 2Y0NA 3U4QA 2K3QA 1W27A 2VK9A 2A68D
chains in the Genus database with same CATH topology
2YU9A 2MX9A 2LTHA 3GTMA 1R9TA 2LKMB 2R93A 1I6VD 2MQAA 1ZYRD 2FIOA 3GTJA 4C2MA 3FKIA 2X0OA 3H0GA 5IZ2A 3GTOA 4CEJA 2F5JA 2LPJA 2N3EA 3LR8A 3GTQA 2AQLA 2CW0D 1I50A 2BE5D 3GTPA 3U44A 4FBSA 2X0QA 2NVXA 3CQZA 2JA7A 2VUMA 3GTGA 2JA6A 2X0PA 2MX8A 2FIPA 1TWHA 3LRDA 1YNND 1WCMA 4CEHA 4QIWA 1TWAA 4CEIA 1YNJD 3GTKA 2E2HA 1IW7D 2LPIA 2N1DB 1I3QA 2A6HD 1SMYD 1K83A 2R7ZA 3LR6A 2E2IA 3LR2A 1TWGA 2R92A 1Y1WA 2K3NA 1TWFA 1TWCA 3GTLA 2O5JD 1HQMD 1Y1VA 2A69D 2B63A 2NVYA 2JA5A 2LYIA 1SFOA 2A6ED 2K3OA 2Y0NA 3U4QA 2K3QA 2VK9A 2A68D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBS A;  3LRD A;  2LPI A;  2MX9 A;  2K3Q A;  2LTH A;  2LPJ A;  2N3E A;  3LR2 A;  2MX8 A;  3LR8 A;  5IZ2 A;  3LR6 A; 
#chains in the Genus database with same CATH topology
 1ZYM A;  2YU9 A;  2MX9 A;  2LTH A;  3GTM A;  2HWG A;  4C5R A;  1R9T A;  2LKM B;  2R93 A;  1I6V D;  2MQA A;  1ZYR D;  2FIO A;  3GTJ A;  4V2Q A;  4C2M A;  3FKI A;  2X0O A;  3H0G A;  5IZ2 A;  3GTO A;  4CEJ A;  2F5J A;  2LPJ A;  3LR8 A;  2EZB A;  2N3E A;  2AQL A;  3GTQ A;  2CW0 D;  3NZ4 A;  3EZA A;  1I50 A;  2BE5 D;  3GTP A;  3U44 A;  4FBS A;  2X0Q A;  4BAB A;  2NVX A;  3CQZ A;  2JA7 A;  2VUM A;  2MP0 A;  3GTG A;  1T6J A;  2JA6 A;  2X0P A;  2MX8 A;  2FIP A;  1TWH A;  3LRD A;  1YNN D;  1WCM A;  4CEH A;  4C6G A;  4QIW A;  1TWA A;  4C5U A;  4CEI A;  1EZA A;  1YNJ D;  3GTK A;  2E2H A;  1IW7 D;  2LPI A;  2N1D B;  1I3Q A;  3EZE A;  2A6H D;  4V2R A;  1SMY D;  1K83 A;  1EZB A;  2R7Z A;  3EZB A;  3LR6 A;  4CQ5 A;  2E2I A;  3LR2 A;  1TWG A;  2R92 A;  1Y1W A;  2YII A;  2K3N A;  2HRO A;  2EZA A;  4BAA A;  1TWF A;  1TWC A;  4C5S A;  3GTL A;  2O5J D;  1HQM D;  1Y1V A;  2A69 D;  2B63 A;  2NVY A;  2JA5 A;  2LYI A;  1SFO A;  2A6E D;  1Y2M A;  2EZC A;  2K3O A;  1T6P A;  2Y0N A;  3U4Q A;  2K3Q A;  1W27 A;  2VK9 A;  2A68 D; 
#chains in the Genus database with same CATH homology
 2YU9 A;  2MX9 A;  2LTH A;  3GTM A;  1R9T A;  2LKM B;  2R93 A;  1I6V D;  2MQA A;  1ZYR D;  2FIO A;  3GTJ A;  4C2M A;  3FKI A;  2X0O A;  3H0G A;  5IZ2 A;  3GTO A;  4CEJ A;  2F5J A;  2LPJ A;  2N3E A;  3LR8 A;  3GTQ A;  2AQL A;  2CW0 D;  1I50 A;  2BE5 D;  3GTP A;  3U44 A;  4FBS A;  2X0Q A;  2NVX A;  3CQZ A;  2JA7 A;  2VUM A;  3GTG A;  2JA6 A;  2X0P A;  2MX8 A;  2FIP A;  1TWH A;  3LRD A;  1YNN D;  1WCM A;  4CEH A;  4QIW A;  1TWA A;  4CEI A;  1YNJ D;  3GTK A;  2E2H A;  1IW7 D;  2LPI A;  2N1D B;  1I3Q A;  2A6H D;  1SMY D;  1K83 A;  2R7Z A;  3LR6 A;  2E2I A;  3LR2 A;  1TWG A;  2R92 A;  1Y1W A;  2K3N A;  1TWF A;  1TWC A;  3GTL A;  2O5J D;  1HQM D;  1Y1V A;  2A69 D;  2B63 A;  2NVY A;  2JA5 A;  2LYI A;  1SFO A;  2A6E D;  2K3O A;  2Y0N A;  3U4Q A;  2K3Q A;  2VK9 A;  2A68 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...