2LTHA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 5.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
publication title Sequential pH-driven dimerization and stabilization of the N-terminal domain enables rapid spider silk formation.
pubmed doi rcsb
source organism Euprosthenops australis
total genus 49
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lthA01
2MX9A 2MX8A 4FBSA 2LPIA 3LRDA 2LPJA 3LR8A 5IZ2A 2K3QA 3LR6A 2N3EA 2LTHA 3LR2A
chains in the Genus database with same CATH superfamily
1YNND 1TWAA 1T6JA 4BABA 2YU9A 4V2RA 3LR8A 1EZAA 2R92A 3GTMA 2HWGA 2LPIA 1I50A 2A69D 2FIOA 3EZAA 3GTPA 3EZBA 3GTKA 4CEJA 2MX9A 2NVXA 2HROA 1ZYRD 2EZBA 2LTHA 3LR2A 2O5JD 2AQLA 1TWGA 3LRDA 3FKIA 2K3QA 2A68D 2BE5D 4FBSA 2YIIA 5IZ2A 3LR6A 3GTGA 2K3OA 1SMYD 3EZEA 2N1DB 3GTJA 2VUMA 2LYIA 1ZYMA 1TWFA 1K83A 2R93A 3CQZA 2A6ED 2EZCA 1IW7D 2MP0A 2A6HD 4BAAA 2MQAA 2FIPA 2JA7A 2R7ZA 4C5UA 2Y0NA 1I6VD 4CEHA 4V2QA 2K3NA 2E2IA 3GTOA 2X0OA 2EZAA 2NVYA 2X0QA 2X0PA 4C6GA 2VK9A 3U44A 1Y1WA 1YNJD 4C2MA 4QIWA 2JA5A 1I3QA 4C5SA 1EZBA 2JA6A 2LPJA 3GTLA 1T6PA 1TWHA 1HQMD 2B63A 2MX8A 4CQ5A 2E2HA 2N3EA 3NZ4A 4C5RA 1Y1VA 1TWCA 1W27A 2LKMB 1Y2MA 1WCMA 2F5JA 3U4QA 3GTQA 1R9TA 1SFOA 3H0GA 4CEIA 2CW0D
chains in the Genus database with same CATH topology
1YNND 1TWAA 2YU9A 3LR8A 2R92A 3GTMA 2LPIA 1I50A 2A69D 2FIOA 3GTPA 3GTKA 4CEJA 2MX9A 2NVXA 1ZYRD 2LTHA 3LR2A 2O5JD 2AQLA 1TWGA 3LRDA 3FKIA 2K3QA 2A68D 2BE5D 4FBSA 5IZ2A 3LR6A 3GTGA 2K3OA 1SMYD 3GTJA 2N1DB 2VUMA 2LYIA 1TWFA 1K83A 2R93A 3CQZA 2A6ED 1IW7D 2A6HD 2MQAA 2FIPA 2JA7A 2R7ZA 2Y0NA 1I6VD 4CEHA 2E2IA 2K3NA 3GTOA 2X0OA 2NVYA 2X0QA 2X0PA 2VK9A 3U44A 1Y1WA 1YNJD 4C2MA 4QIWA 2JA5A 1I3QA 2JA6A 2LPJA 3GTLA 1HQMD 1TWHA 2B63A 2MX8A 2E2HA 2N3EA 1Y1VA 1TWCA 2LKMB 1WCMA 2F5JA 3U4QA 3GTQA 1R9TA 1SFOA 3H0GA 4CEIA 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MX9 A;  2MX8 A;  4FBS A;  2LPI A;  3LRD A;  2LPJ A;  3LR8 A;  5IZ2 A;  2K3Q A;  3LR6 A;  2N3E A;  2LTH A;  3LR2 A; 
#chains in the Genus database with same CATH topology
 1YNN D;  1TWA A;  1T6J A;  4BAB A;  2YU9 A;  4V2R A;  3LR8 A;  1EZA A;  2R92 A;  3GTM A;  2HWG A;  2LPI A;  1I50 A;  2A69 D;  2FIO A;  3EZA A;  3GTP A;  3EZB A;  3GTK A;  4CEJ A;  2MX9 A;  2NVX A;  2HRO A;  1ZYR D;  2EZB A;  2LTH A;  3LR2 A;  2O5J D;  2AQL A;  1TWG A;  3LRD A;  3FKI A;  2K3Q A;  2A68 D;  2BE5 D;  4FBS A;  2YII A;  5IZ2 A;  3LR6 A;  3GTG A;  2K3O A;  1SMY D;  3EZE A;  2N1D B;  3GTJ A;  2VUM A;  2LYI A;  1ZYM A;  1TWF A;  1K83 A;  2R93 A;  3CQZ A;  2A6E D;  2EZC A;  1IW7 D;  2MP0 A;  2A6H D;  4BAA A;  2MQA A;  2FIP A;  2JA7 A;  2R7Z A;  4C5U A;  2Y0N A;  1I6V D;  4CEH A;  4V2Q A;  2K3N A;  2E2I A;  3GTO A;  2X0O A;  2EZA A;  2NVY A;  2X0Q A;  2X0P A;  4C6G A;  2VK9 A;  3U44 A;  1Y1W A;  1YNJ D;  4C2M A;  4QIW A;  2JA5 A;  1I3Q A;  4C5S A;  1EZB A;  2JA6 A;  2LPJ A;  3GTL A;  1T6P A;  1TWH A;  1HQM D;  2B63 A;  2MX8 A;  4CQ5 A;  2E2H A;  2N3E A;  3NZ4 A;  4C5R A;  1Y1V A;  1TWC A;  1W27 A;  2LKM B;  1Y2M A;  1WCM A;  2F5J A;  3U4Q A;  3GTQ A;  1R9T A;  1SFO A;  3H0G A;  4CEI A;  2CW0 D; 
#chains in the Genus database with same CATH homology
 1YNN D;  1TWA A;  2YU9 A;  3LR8 A;  2R92 A;  3GTM A;  2LPI A;  1I50 A;  2A69 D;  2FIO A;  3GTP A;  3GTK A;  4CEJ A;  2MX9 A;  2NVX A;  1ZYR D;  2LTH A;  3LR2 A;  2O5J D;  2AQL A;  1TWG A;  3LRD A;  3FKI A;  2K3Q A;  2A68 D;  2BE5 D;  4FBS A;  5IZ2 A;  3LR6 A;  3GTG A;  2K3O A;  1SMY D;  3GTJ A;  2N1D B;  2VUM A;  2LYI A;  1TWF A;  1K83 A;  2R93 A;  3CQZ A;  2A6E D;  1IW7 D;  2A6H D;  2MQA A;  2FIP A;  2JA7 A;  2R7Z A;  2Y0N A;  1I6V D;  4CEH A;  2E2I A;  2K3N A;  3GTO A;  2X0O A;  2NVY A;  2X0Q A;  2X0P A;  2VK9 A;  3U44 A;  1Y1W A;  1YNJ D;  4C2M A;  4QIW A;  2JA5 A;  1I3Q A;  2JA6 A;  2LPJ A;  3GTL A;  1HQM D;  1TWH A;  2B63 A;  2MX8 A;  2E2H A;  2N3E A;  1Y1V A;  1TWC A;  2LKM B;  1WCM A;  2F5J A;  3U4Q A;  3GTQ A;  1R9T A;  1SFO A;  3H0G A;  4CEI A;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...