2LTHA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 5.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential pH-driven dimerization and stabilization of the N-terminal domain enables rapid spider silk formation.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 49
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lthA01
5IZ2A 2MX9A 2LPJA 2LPIA 3LR2A 3LR6A 3LRDA 2N3EA 4FBSA 2LTHA 2K3QA 3LR8A 2MX8A
chains in the Genus database with same CATH superfamily
2JA6A 1YNND 1TWHA 2VK9A 3EZEA 3GTKA 2VUMA 4QIWA 2E2IA 1IW7D 3CQZA 2EZBA 3U44A 1ZYMA 3LR2A 2JA5A 1I3QA 3GTQA 3GTJA 2LYIA 2NVXA 4CEHA 2R93A 1HQMD 3EZBA 4C2MA 1WCMA 4BABA 1Y1VA 1T6PA 3GTPA 2N3EA 4CEIA 2O5JD 2K3NA 2LKMB 3LR8A 4CQ5A 4V2QA 4C5UA 2N1DB 2K3OA 1TWFA 2A6ED 2FIOA 3EZAA 4C6GA 1R9TA 2E2HA 2F5JA 2LPJA 3H0GA 1I6VD 4CEJA 2HWGA 2YIIA 1TWGA 2JA7A 4C5RA 1TWCA 3GTOA 2FIPA 2K3QA 2X0PA 2X0OA 1TWAA 2NVYA 1I50A 3GTGA 1Y1WA 2LPIA 3FKIA 5IZ2A 2R7ZA 1ZYRD 1T6JA 2B63A 4C5SA 3GTMA 1YNJD 2X0QA 2R92A 2CW0D 1SMYD 2EZCA 1SFOA 2AQLA 2YU9A 3NZ4A 2MQAA 2MP0A 3GTLA 2Y0NA 3U4QA 1K83A 4BAAA 2EZAA 2A68D 4V2RA 2HROA 1EZAA 2MX8A 1Y2MA 2MX9A 3LR6A 3LRDA 1EZBA 2BE5D 1W27A 2A69D 4FBSA 2LTHA 2A6HD
chains in the Genus database with same CATH topology
2JA6A 1YNND 1TWHA 2VK9A 3GTKA 2VUMA 4QIWA 2E2IA 1IW7D 3CQZA 3U44A 3LR2A 2JA5A 1I3QA 3GTQA 3GTJA 2LYIA 2NVXA 4CEHA 2R93A 1HQMD 4C2MA 1WCMA 1Y1VA 3GTPA 2N3EA 4CEIA 2O5JD 2K3NA 2LKMB 3LR8A 2N1DB 2K3OA 1TWFA 2A6ED 2FIOA 1R9TA 2E2HA 2F5JA 2LPJA 3H0GA 1I6VD 4CEJA 1TWGA 2JA7A 3GTOA 1TWCA 2FIPA 2K3QA 2X0PA 2X0OA 1TWAA 2NVYA 1I50A 3GTGA 1Y1WA 2LPIA 3FKIA 5IZ2A 2R7ZA 1ZYRD 2B63A 3GTMA 1YNJD 2X0QA 2R92A 2CW0D 1SMYD 1SFOA 2AQLA 2YU9A 2MQAA 3GTLA 2Y0NA 3U4QA 1K83A 2A68D 2MX8A 2MX9A 3LR6A 3LRDA 2BE5D 2A69D 4FBSA 2LTHA 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ2 A;  2MX9 A;  2LPJ A;  2LPI A;  3LR2 A;  3LR6 A;  3LRD A;  2N3E A;  4FBS A;  2LTH A;  2K3Q A;  3LR8 A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 2JA6 A;  1YNN D;  1TWH A;  2VK9 A;  3EZE A;  3GTK A;  2VUM A;  4QIW A;  2E2I A;  1IW7 D;  3CQZ A;  2EZB A;  3U44 A;  1ZYM A;  3LR2 A;  2JA5 A;  1I3Q A;  3GTQ A;  3GTJ A;  2LYI A;  2NVX A;  4CEH A;  2R93 A;  1HQM D;  3EZB A;  4C2M A;  1WCM A;  4BAB A;  1Y1V A;  1T6P A;  3GTP A;  2N3E A;  4CEI A;  2O5J D;  2K3N A;  2LKM B;  3LR8 A;  4CQ5 A;  4V2Q A;  4C5U A;  2N1D B;  2K3O A;  1TWF A;  2A6E D;  2FIO A;  3EZA A;  4C6G A;  1R9T A;  2E2H A;  2F5J A;  2LPJ A;  3H0G A;  1I6V D;  4CEJ A;  2HWG A;  2YII A;  1TWG A;  2JA7 A;  4C5R A;  1TWC A;  3GTO A;  2FIP A;  2K3Q A;  2X0P A;  2X0O A;  1TWA A;  2NVY A;  1I50 A;  3GTG A;  1Y1W A;  2LPI A;  3FKI A;  5IZ2 A;  2R7Z A;  1ZYR D;  1T6J A;  2B63 A;  4C5S A;  3GTM A;  1YNJ D;  2X0Q A;  2R92 A;  2CW0 D;  1SMY D;  2EZC A;  1SFO A;  2AQL A;  2YU9 A;  3NZ4 A;  2MQA A;  2MP0 A;  3GTL A;  2Y0N A;  3U4Q A;  1K83 A;  4BAA A;  2EZA A;  2A68 D;  4V2R A;  2HRO A;  1EZA A;  2MX8 A;  1Y2M A;  2MX9 A;  3LR6 A;  3LRD A;  1EZB A;  2BE5 D;  1W27 A;  2A69 D;  4FBS A;  2LTH A;  2A6H D; 
#chains in the Genus database with same CATH homology
 2JA6 A;  1YNN D;  1TWH A;  2VK9 A;  3GTK A;  2VUM A;  4QIW A;  2E2I A;  1IW7 D;  3CQZ A;  3U44 A;  3LR2 A;  2JA5 A;  1I3Q A;  3GTQ A;  3GTJ A;  2LYI A;  2NVX A;  4CEH A;  2R93 A;  1HQM D;  4C2M A;  1WCM A;  1Y1V A;  3GTP A;  2N3E A;  4CEI A;  2O5J D;  2K3N A;  2LKM B;  3LR8 A;  2N1D B;  2K3O A;  1TWF A;  2A6E D;  2FIO A;  1R9T A;  2E2H A;  2F5J A;  2LPJ A;  3H0G A;  1I6V D;  4CEJ A;  1TWG A;  2JA7 A;  3GTO A;  1TWC A;  2FIP A;  2K3Q A;  2X0P A;  2X0O A;  1TWA A;  2NVY A;  1I50 A;  3GTG A;  1Y1W A;  2LPI A;  3FKI A;  5IZ2 A;  2R7Z A;  1ZYR D;  2B63 A;  3GTM A;  1YNJ D;  2X0Q A;  2R92 A;  2CW0 D;  1SMY D;  1SFO A;  2AQL A;  2YU9 A;  2MQA A;  3GTL A;  2Y0N A;  3U4Q A;  1K83 A;  2A68 D;  2MX8 A;  2MX9 A;  3LR6 A;  3LRD A;  2BE5 D;  2A69 D;  4FBS A;  2LTH A;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...