2MQAA

3d structure of rp domain of misp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
b'GNAFAQSLSSNLLSSGDFVQMISSTTSTDQAVSVATSVAQNVGNQLGLDANAMNSLLGAVSGYVSTLGNAISDASAYANAISSAIGNVLANSGSISESTASSAASSAASSVTTTLTSYGPAVFYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate fibroin 1
molecule tags Structural protein
source organism Nephila antipodiana
publication title 3D structure of RP domain of MiSp
rcsb
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.60 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mqaA00
2K3OA 2K3NA 2MQAA 2LYIA
chains in the Genus database with same CATH superfamily
4CQ5A 3NZ4A 2BE5D 4BABA 2MX9A 2YIIA 1I50A 2VUMA 1Y2MA 4C5UA 2CW0D 1T6PA 2K3OA 2X0QA 4V2QA 3GTLA 4C5SA 3GTOA 1HQMD 1YNJD 3EZAA 3LR6A 1IW7D 2LTHA 2EZCA 1SFOA 3EZBA 2MQAA 1TWAA 3GTGA 3GTKA 1ZYRD 1TWFA 2LPIA 1WCMA 2LPJA 1I3QA 2JA7A 2N1DB 1SMYD 1T6JA 3GTQA 2X0OA 5IZ2A 2E2IA 1Y1VA 2B63A 2R93A 2JA6A 2MP0A 4BAAA 2R92A 2MX8A 1Y1WA 2A6HD 1EZBA 2N3EA 3EZEA 3FKIA 2FIPA 2EZAA 2O5JD 2FIOA 3CQZA 4FBSA 1YNND 1ZYMA 4CEJA 2A68D 2VK9A 2Y0NA 1TWHA 2HWGA 2R7ZA 2F5JA 4C5RA 3LR2A 4CEHA 1EZAA 2K3QA 2LKMB 2A6ED 4QIWA 2K3NA 2A69D 2AQLA 2EZBA 3U44A 1W27A 3LRDA 3GTPA 3GTMA 1I6VD 1K83A 2YU9A 2E2HA 2X0PA 3H0GA 3LR8A 2HROA 3GTJA 2NVXA 2JA5A 2LYIA 4V2RA 1TWCA 4CEIA 1R9TA 3U4QA 2NVYA 4C2MA 1TWGA 4C6GA
chains in the Genus database with same CATH topology
2BE5D 2MX9A 1I50A 2VUMA 2CW0D 2K3OA 2X0QA 3GTLA 3GTOA 1HQMD 1YNJD 3LR6A 1IW7D 2LTHA 1SFOA 2MQAA 1TWAA 3GTGA 3GTKA 1ZYRD 1TWFA 2LPIA 1WCMA 2LPJA 1I3QA 2JA7A 2N1DB 1SMYD 3GTQA 2X0OA 5IZ2A 2E2IA 1Y1VA 2B63A 2R93A 2JA6A 2R92A 2MX8A 1Y1WA 2A6HD 2N3EA 3FKIA 2FIPA 2O5JD 2FIOA 3CQZA 4FBSA 1YNND 4CEJA 2A68D 2VK9A 2Y0NA 1TWHA 2R7ZA 2F5JA 3LR2A 4CEHA 2K3QA 2LKMB 2A6ED 4QIWA 2K3NA 2A69D 2AQLA 3U44A 3LRDA 3GTPA 3GTMA 1I6VD 1K83A 2YU9A 2E2HA 2X0PA 3H0GA 3LR8A 3GTJA 2NVXA 2JA5A 2LYIA 4CEIA 1TWCA 1R9TA 3U4QA 2NVYA 4C2MA 1TWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3O A;  2K3N A;  2MQA A;  2LYI A; 
#chains in the Genus database with same CATH topology
 4CQ5 A;  3NZ4 A;  2BE5 D;  4BAB A;  2MX9 A;  2YII A;  1I50 A;  2VUM A;  1Y2M A;  4C5U A;  2CW0 D;  1T6P A;  2K3O A;  2X0Q A;  4V2Q A;  3GTL A;  4C5S A;  3GTO A;  1HQM D;  1YNJ D;  3EZA A;  3LR6 A;  1IW7 D;  2LTH A;  2EZC A;  1SFO A;  3EZB A;  2MQA A;  1TWA A;  3GTG A;  3GTK A;  1ZYR D;  1TWF A;  2LPI A;  1WCM A;  2LPJ A;  1I3Q A;  2JA7 A;  2N1D B;  1SMY D;  1T6J A;  3GTQ A;  2X0O A;  5IZ2 A;  2E2I A;  1Y1V A;  2B63 A;  2R93 A;  2JA6 A;  2MP0 A;  4BAA A;  2R92 A;  2MX8 A;  1Y1W A;  2A6H D;  1EZB A;  2N3E A;  3EZE A;  3FKI A;  2FIP A;  2EZA A;  2O5J D;  2FIO A;  3CQZ A;  4FBS A;  1YNN D;  1ZYM A;  4CEJ A;  2A68 D;  2VK9 A;  2Y0N A;  1TWH A;  2HWG A;  2R7Z A;  2F5J A;  4C5R A;  3LR2 A;  4CEH A;  1EZA A;  2K3Q A;  2LKM B;  2A6E D;  4QIW A;  2K3N A;  2A69 D;  2AQL A;  2EZB A;  3U44 A;  1W27 A;  3LRD A;  3GTP A;  3GTM A;  1I6V D;  1K83 A;  2YU9 A;  2E2H A;  2X0P A;  3H0G A;  3LR8 A;  2HRO A;  3GTJ A;  2NVX A;  2JA5 A;  2LYI A;  4V2R A;  1TWC A;  4CEI A;  1R9T A;  3U4Q A;  2NVY A;  4C2M A;  1TWG A;  4C6G A; 
#chains in the Genus database with same CATH homology
 2BE5 D;  2MX9 A;  1I50 A;  2VUM A;  2CW0 D;  2K3O A;  2X0Q A;  3GTL A;  3GTO A;  1HQM D;  1YNJ D;  3LR6 A;  1IW7 D;  2LTH A;  1SFO A;  2MQA A;  1TWA A;  3GTG A;  3GTK A;  1ZYR D;  1TWF A;  2LPI A;  1WCM A;  2LPJ A;  1I3Q A;  2JA7 A;  2N1D B;  1SMY D;  3GTQ A;  2X0O A;  5IZ2 A;  2E2I A;  1Y1V A;  2B63 A;  2R93 A;  2JA6 A;  2R92 A;  2MX8 A;  1Y1W A;  2A6H D;  2N3E A;  3FKI A;  2FIP A;  2O5J D;  2FIO A;  3CQZ A;  4FBS A;  1YNN D;  4CEJ A;  2A68 D;  2VK9 A;  2Y0N A;  1TWH A;  2R7Z A;  2F5J A;  3LR2 A;  4CEH A;  2K3Q A;  2LKM B;  2A6E D;  4QIW A;  2K3N A;  2A69 D;  2AQL A;  3U44 A;  3LRD A;  3GTP A;  3GTM A;  1I6V D;  1K83 A;  2YU9 A;  2E2H A;  2X0P A;  3H0G A;  3LR8 A;  3GTJ A;  2NVX A;  2JA5 A;  2LYI A;  4CEI A;  1TWC A;  1R9T A;  3U4Q A;  2NVY A;  4C2M A;  1TWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...