2MQAA

3d structure of rp domain of misp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
GNAFAQSLSSNLLSSGDFVQMISSTTSTDQAVSVATSVAQNVGNQLGLDANAMNSLLGAVSGYVSTLGNAISDASAYANAISSAIGNVLANSGSISESTASSAASSAASSVTTTLTSYGPAVFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate fibroin 1
publication title 3D structure of RP domain of MiSp
rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.60 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mqaA00
2MQAA 2K3OA 2K3NA 2LYIA
chains in the Genus database with same CATH superfamily
4C6GA 4CQ5A 1T6PA 3EZEA 1TWAA 2VK9A 2AQLA 1EZBA 1EZAA 2YIIA 4CEJA 2MQAA 2N3EA 1Y1VA 2X0QA 4C5UA 2FIOA 3LRDA 3EZAA 3GTMA 2K3OA 2Y0NA 3FKIA 4FBSA 2FIPA 2MX9A 1Y2MA 2A69D 1TWCA 1I6VD 2EZAA 3GTJA 1I3QA 2LKMB 1R9TA 3GTGA 2JA5A 1YNND 5IZ2A 2EZCA 3NZ4A 2LTHA 2F5JA 2E2IA 2B63A 1T6JA 3GTPA 2A68D 2LPJA 2YU9A 2HROA 3CQZA 1TWGA 3LR2A 4CEHA 4C2MA 4CEIA 2X0PA 2R7ZA 3EZBA 3GTLA 2MP0A 2K3QA 4C5RA 3U44A 3GTQA 2MX8A 4QIWA 1K83A 1W27A 1HQMD 2VUMA 1TWFA 1Y1WA 4BAAA 2EZBA 4BABA 2LPIA 1ZYRD 2O5JD 4V2RA 4C5SA 1I50A 2A6ED 1SMYD 2R92A 1SFOA 1TWHA 3GTOA 2JA7A 3U4QA 3LR6A 2JA6A 3LR8A 2X0OA 1WCMA 2LYIA 4V2QA 2BE5D 2NVYA 2CW0D 2A6HD 2HWGA 1ZYMA 1IW7D 3H0GA 3GTKA 2N1DB 2K3NA 2E2HA 1YNJD 2NVXA 2R93A
chains in the Genus database with same CATH topology
1TWAA 2VK9A 2AQLA 4CEJA 2MQAA 2N3EA 1Y1VA 2X0QA 2FIOA 3LRDA 3GTMA 2K3OA 2Y0NA 3FKIA 4FBSA 2FIPA 2MX9A 2A69D 1TWCA 1I6VD 3GTJA 1I3QA 2LKMB 1R9TA 3GTGA 2JA5A 1YNND 5IZ2A 2LTHA 2F5JA 2E2IA 2B63A 3GTPA 2A68D 2LPJA 2YU9A 3CQZA 1TWGA 3LR2A 4CEHA 4C2MA 4CEIA 2X0PA 2R7ZA 3GTLA 2K3QA 3U44A 3GTQA 2MX8A 4QIWA 1K83A 1HQMD 2VUMA 1TWFA 1Y1WA 2LPIA 1ZYRD 2O5JD 1I50A 2A6ED 1SMYD 2R92A 1SFOA 1TWHA 3GTOA 2JA7A 3U4QA 3LR6A 2JA6A 3LR8A 2X0OA 1WCMA 2LYIA 2BE5D 2NVYA 2CW0D 2A6HD 1IW7D 3H0GA 3GTKA 2N1DB 2K3NA 2E2HA 1YNJD 2NVXA 2R93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQA A;  2K3O A;  2K3N A;  2LYI A; 
#chains in the Genus database with same CATH topology
 4C6G A;  4CQ5 A;  1T6P A;  3EZE A;  1TWA A;  2VK9 A;  2AQL A;  1EZB A;  1EZA A;  2YII A;  4CEJ A;  2MQA A;  2N3E A;  1Y1V A;  2X0Q A;  4C5U A;  2FIO A;  3LRD A;  3EZA A;  3GTM A;  2K3O A;  2Y0N A;  3FKI A;  4FBS A;  2FIP A;  2MX9 A;  1Y2M A;  2A69 D;  1TWC A;  1I6V D;  2EZA A;  3GTJ A;  1I3Q A;  2LKM B;  1R9T A;  3GTG A;  2JA5 A;  1YNN D;  5IZ2 A;  2EZC A;  3NZ4 A;  2LTH A;  2F5J A;  2E2I A;  2B63 A;  1T6J A;  3GTP A;  2A68 D;  2LPJ A;  2YU9 A;  2HRO A;  3CQZ A;  1TWG A;  3LR2 A;  4CEH A;  4C2M A;  4CEI A;  2X0P A;  2R7Z A;  3EZB A;  3GTL A;  2MP0 A;  2K3Q A;  4C5R A;  3U44 A;  3GTQ A;  2MX8 A;  4QIW A;  1K83 A;  1W27 A;  1HQM D;  2VUM A;  1TWF A;  1Y1W A;  4BAA A;  2EZB A;  4BAB A;  2LPI A;  1ZYR D;  2O5J D;  4V2R A;  4C5S A;  1I50 A;  2A6E D;  1SMY D;  2R92 A;  1SFO A;  1TWH A;  3GTO A;  2JA7 A;  3U4Q A;  3LR6 A;  2JA6 A;  3LR8 A;  2X0O A;  1WCM A;  2LYI A;  4V2Q A;  2BE5 D;  2NVY A;  2CW0 D;  2A6H D;  2HWG A;  1ZYM A;  1IW7 D;  3H0G A;  3GTK A;  2N1D B;  2K3N A;  2E2H A;  1YNJ D;  2NVX A;  2R93 A; 
#chains in the Genus database with same CATH homology
 1TWA A;  2VK9 A;  2AQL A;  4CEJ A;  2MQA A;  2N3E A;  1Y1V A;  2X0Q A;  2FIO A;  3LRD A;  3GTM A;  2K3O A;  2Y0N A;  3FKI A;  4FBS A;  2FIP A;  2MX9 A;  2A69 D;  1TWC A;  1I6V D;  3GTJ A;  1I3Q A;  2LKM B;  1R9T A;  3GTG A;  2JA5 A;  1YNN D;  5IZ2 A;  2LTH A;  2F5J A;  2E2I A;  2B63 A;  3GTP A;  2A68 D;  2LPJ A;  2YU9 A;  3CQZ A;  1TWG A;  3LR2 A;  4CEH A;  4C2M A;  4CEI A;  2X0P A;  2R7Z A;  3GTL A;  2K3Q A;  3U44 A;  3GTQ A;  2MX8 A;  4QIW A;  1K83 A;  1HQM D;  2VUM A;  1TWF A;  1Y1W A;  2LPI A;  1ZYR D;  2O5J D;  1I50 A;  2A6E D;  1SMY D;  2R92 A;  1SFO A;  1TWH A;  3GTO A;  2JA7 A;  3U4Q A;  3LR6 A;  2JA6 A;  3LR8 A;  2X0O A;  1WCM A;  2LYI A;  2BE5 D;  2NVY A;  2CW0 D;  2A6H D;  1IW7 D;  3H0G A;  3GTK A;  2N1D B;  2K3N A;  2E2H A;  1YNJ D;  2NVX A;  2R93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...