2MQAA

3d structure of rp domain of misp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
GNAFAQSLSSNLLSSGDFVQMISSTTSTDQAVSVATSVAQNVGNQLGLDANAMNSLLGAVSGYVSTLGNAISDASAYANAISSAIGNVLANSGSISESTASSAASSAASSVTTTLTSYGPAVFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate fibroin 1
publication title 3D structure of RP domain of MiSp
rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.60 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mqaA00
2MQAA 2LYIA 2K3NA 2K3OA
chains in the Genus database with same CATH superfamily
1HQMD 2JA5A 2K3OA 4CQ5A 1T6JA 3GTGA 2LPIA 2NVXA 1Y2MA 4C2MA 3CQZA 1YNJD 1ZYRD 3EZAA 1TWAA 2LYIA 2R93A 2X0PA 3GTKA 1I6VD 4FBSA 2X0OA 2F5JA 1SFOA 2X0QA 4BABA 1W27A 1TWCA 1I3QA 2JA7A 2E2HA 2BE5D 2N1DB 4BAAA 4QIWA 3LR2A 2EZBA 3GTPA 3GTLA 4CEIA 2NVYA 2CW0D 4CEJA 2R92A 2K3QA 1K83A 3GTQA 2JA6A 2FIOA 2K3NA 3H0GA 1YNND 2LTHA 2VUMA 1Y1VA 2YU9A 2A6ED 1TWGA 2EZCA 2VK9A 3LR8A 1IW7D 2MP0A 2MQAA 1EZAA 2A68D 2Y0NA 4C5RA 4CEHA 3NZ4A 2HWGA 1TWFA 2MX9A 3FKIA 2LPJA 1SMYD 4V2QA 1TWHA 2A69D 2B63A 1ZYMA 4C6GA 2FIPA 2LKMB 1Y1WA 2EZAA 1WCMA 2HROA 2R7ZA 2AQLA 3EZBA 2N3EA 3U4QA 2A6HD 3GTJA 2MX8A 1I50A 4C5SA 3EZEA 4V2RA 1R9TA 3LR6A 3GTOA 2O5JD 2E2IA 5IZ2A 3GTMA 4C5UA 1T6PA 3LRDA 3U44A 2YIIA 1EZBA
chains in the Genus database with same CATH topology
1HQMD 2JA5A 2K3OA 3GTGA 2LPIA 2NVXA 4C2MA 3CQZA 1YNJD 1ZYRD 1TWAA 2LYIA 2R93A 2X0PA 3GTKA 1I6VD 4FBSA 2X0OA 2F5JA 1SFOA 2X0QA 1TWCA 1I3QA 2JA7A 2E2HA 2BE5D 2N1DB 4QIWA 3LR2A 3GTPA 3GTLA 4CEIA 2NVYA 2CW0D 4CEJA 2R92A 2K3QA 1K83A 3GTQA 2JA6A 2FIOA 2K3NA 3H0GA 1YNND 2LTHA 2VUMA 1Y1VA 2YU9A 2A6ED 1TWGA 2VK9A 3LR8A 1IW7D 2MQAA 2A68D 2Y0NA 4CEHA 1TWFA 2MX9A 3FKIA 2LPJA 1SMYD 1TWHA 2A69D 2B63A 2FIPA 2LKMB 1Y1WA 1WCMA 2R7ZA 2AQLA 2N3EA 3U4QA 2A6HD 3GTJA 2MX8A 1I50A 1R9TA 3LR6A 3GTOA 2O5JD 2E2IA 5IZ2A 3GTMA 3LRDA 3U44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQA A;  2LYI A;  2K3N A;  2K3O A; 
#chains in the Genus database with same CATH topology
 1HQM D;  2JA5 A;  2K3O A;  4CQ5 A;  1T6J A;  3GTG A;  2LPI A;  2NVX A;  1Y2M A;  4C2M A;  3CQZ A;  1YNJ D;  1ZYR D;  3EZA A;  1TWA A;  2LYI A;  2R93 A;  2X0P A;  3GTK A;  1I6V D;  4FBS A;  2X0O A;  2F5J A;  1SFO A;  2X0Q A;  4BAB A;  1W27 A;  1TWC A;  1I3Q A;  2JA7 A;  2E2H A;  2BE5 D;  2N1D B;  4BAA A;  4QIW A;  3LR2 A;  2EZB A;  3GTP A;  3GTL A;  4CEI A;  2NVY A;  2CW0 D;  4CEJ A;  2R92 A;  2K3Q A;  1K83 A;  3GTQ A;  2JA6 A;  2FIO A;  2K3N A;  3H0G A;  1YNN D;  2LTH A;  2VUM A;  1Y1V A;  2YU9 A;  2A6E D;  1TWG A;  2EZC A;  2VK9 A;  3LR8 A;  1IW7 D;  2MP0 A;  2MQA A;  1EZA A;  2A68 D;  2Y0N A;  4C5R A;  4CEH A;  3NZ4 A;  2HWG A;  1TWF A;  2MX9 A;  3FKI A;  2LPJ A;  1SMY D;  4V2Q A;  1TWH A;  2A69 D;  2B63 A;  1ZYM A;  4C6G A;  2FIP A;  2LKM B;  1Y1W A;  2EZA A;  1WCM A;  2HRO A;  2R7Z A;  2AQL A;  3EZB A;  2N3E A;  3U4Q A;  2A6H D;  3GTJ A;  2MX8 A;  1I50 A;  4C5S A;  3EZE A;  4V2R A;  1R9T A;  3LR6 A;  3GTO A;  2O5J D;  2E2I A;  5IZ2 A;  3GTM A;  4C5U A;  1T6P A;  3LRD A;  3U44 A;  2YII A;  1EZB A; 
#chains in the Genus database with same CATH homology
 1HQM D;  2JA5 A;  2K3O A;  3GTG A;  2LPI A;  2NVX A;  4C2M A;  3CQZ A;  1YNJ D;  1ZYR D;  1TWA A;  2LYI A;  2R93 A;  2X0P A;  3GTK A;  1I6V D;  4FBS A;  2X0O A;  2F5J A;  1SFO A;  2X0Q A;  1TWC A;  1I3Q A;  2JA7 A;  2E2H A;  2BE5 D;  2N1D B;  4QIW A;  3LR2 A;  3GTP A;  3GTL A;  4CEI A;  2NVY A;  2CW0 D;  4CEJ A;  2R92 A;  2K3Q A;  1K83 A;  3GTQ A;  2JA6 A;  2FIO A;  2K3N A;  3H0G A;  1YNN D;  2LTH A;  2VUM A;  1Y1V A;  2YU9 A;  2A6E D;  1TWG A;  2VK9 A;  3LR8 A;  1IW7 D;  2MQA A;  2A68 D;  2Y0N A;  4CEH A;  1TWF A;  2MX9 A;  3FKI A;  2LPJ A;  1SMY D;  1TWH A;  2A69 D;  2B63 A;  2FIP A;  2LKM B;  1Y1W A;  1WCM A;  2R7Z A;  2AQL A;  2N3E A;  3U4Q A;  2A6H D;  3GTJ A;  2MX8 A;  1I50 A;  1R9T A;  3LR6 A;  3GTO A;  2O5J D;  2E2I A;  5IZ2 A;  3GTM A;  3LRD A;  3U44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...