2MQAA

3d structure of rp domain of misp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
GNAFAQSLSSNLLSSGDFVQMISSTTSTDQAVSVATSVAQNVGNQLGLDANAMNSLLGAVSGYVSTLGNAISDASAYANAISSAIGNVLANSGSISESTASSAASSAASSVTTTLTSYGPAVFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D structure of RP domain of MiSp
rcsb
source organism Nephila antipodiana
molecule tags Structural protein
molecule keywords Minor ampullate fibroin 1
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.60 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mqaA00
2MQAA 2LYIA 2K3OA 2K3NA
chains in the Genus database with same CATH superfamily
2X0OA 2VK9A 2A6ED 2R92A 1IW7D 4CEIA 2A68D 2NVXA 1TWAA 3U44A 1Y1WA 1ZYMA 3EZEA 2X0QA 2JA5A 3U4QA 1I50A 1W27A 2CW0D 1EZAA 2HWGA 1SFOA 3LR6A 2X0PA 2R7ZA 2AQLA 4C5RA 3EZAA 3GTGA 2BE5D 2N3EA 2VUMA 5IZ2A 2HROA 1TWCA 2E2HA 4CEHA 2LPJA 2EZAA 2FIOA 2EZCA 2MX8A 2N1DB 2YIIA 1SMYD 3LR2A 1TWHA 1EZBA 2A69D 3GTOA 2B63A 3GTJA 1T6PA 2MQAA 2LPIA 2LTHA 2EZBA 2K3NA 3EZBA 2JA7A 2MP0A 2LYIA 2LKMB 3LRDA 3GTPA 1K83A 4FBSA 3CQZA 1WCMA 2Y0NA 3GTKA 4BABA 3GTLA 3NZ4A 1T6JA 2K3OA 3H0GA 1YNND 2NVYA 1I6VD 3LR8A 4C5SA 1HQMD 3FKIA 4C5UA 1TWGA 4V2QA 4CEJA 2F5JA 4C6GA 1I3QA 2R93A 1R9TA 4C2MA 4V2RA 1Y2MA 1Y1VA 2O5JD 2K3QA 2MX9A 2A6HD 2FIPA 3GTQA 1TWFA 3GTMA 4CQ5A 2YU9A 1ZYRD 2E2IA 1YNJD 2JA6A 4BAAA 4QIWA
chains in the Genus database with same CATH topology
2X0OA 2VK9A 2A6ED 2R92A 1IW7D 4CEIA 2A68D 2NVXA 1TWAA 3U44A 1Y1WA 2X0QA 2JA5A 3U4QA 1I50A 2CW0D 1SFOA 3LR6A 2X0PA 2R7ZA 2AQLA 3GTGA 2BE5D 2N3EA 2VUMA 5IZ2A 1TWCA 2E2HA 4CEHA 2LPJA 2FIOA 2MX8A 2N1DB 1SMYD 3LR2A 1TWHA 2A69D 3GTOA 2B63A 3GTJA 2MQAA 2LPIA 2LTHA 2K3NA 2JA7A 2LYIA 2LKMB 3LRDA 3GTPA 1K83A 4FBSA 3CQZA 1WCMA 2Y0NA 3GTKA 3GTLA 2K3OA 3H0GA 1YNND 2NVYA 1I6VD 3LR8A 1HQMD 3FKIA 1TWGA 4CEJA 2F5JA 1I3QA 2R93A 1R9TA 4C2MA 1Y1VA 2O5JD 2K3QA 2MX9A 2A6HD 2FIPA 3GTQA 1TWFA 3GTMA 2YU9A 1ZYRD 2E2IA 1YNJD 2JA6A 4QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQA A;  2LYI A;  2K3O A;  2K3N A; 
#chains in the Genus database with same CATH topology
 2X0O A;  2VK9 A;  2A6E D;  2R92 A;  1IW7 D;  4CEI A;  2A68 D;  2NVX A;  1TWA A;  3U44 A;  1Y1W A;  1ZYM A;  3EZE A;  2X0Q A;  2JA5 A;  3U4Q A;  1I50 A;  1W27 A;  2CW0 D;  1EZA A;  2HWG A;  1SFO A;  3LR6 A;  2X0P A;  2R7Z A;  2AQL A;  4C5R A;  3EZA A;  3GTG A;  2BE5 D;  2N3E A;  2VUM A;  5IZ2 A;  2HRO A;  1TWC A;  2E2H A;  4CEH A;  2LPJ A;  2EZA A;  2FIO A;  2EZC A;  2MX8 A;  2N1D B;  2YII A;  1SMY D;  3LR2 A;  1TWH A;  1EZB A;  2A69 D;  3GTO A;  2B63 A;  3GTJ A;  1T6P A;  2MQA A;  2LPI A;  2LTH A;  2EZB A;  2K3N A;  3EZB A;  2JA7 A;  2MP0 A;  2LYI A;  2LKM B;  3LRD A;  3GTP A;  1K83 A;  4FBS A;  3CQZ A;  1WCM A;  2Y0N A;  3GTK A;  4BAB A;  3GTL A;  3NZ4 A;  1T6J A;  2K3O A;  3H0G A;  1YNN D;  2NVY A;  1I6V D;  3LR8 A;  4C5S A;  1HQM D;  3FKI A;  4C5U A;  1TWG A;  4V2Q A;  4CEJ A;  2F5J A;  4C6G A;  1I3Q A;  2R93 A;  1R9T A;  4C2M A;  4V2R A;  1Y2M A;  1Y1V A;  2O5J D;  2K3Q A;  2MX9 A;  2A6H D;  2FIP A;  3GTQ A;  1TWF A;  3GTM A;  4CQ5 A;  2YU9 A;  1ZYR D;  2E2I A;  1YNJ D;  2JA6 A;  4BAA A;  4QIW A; 
#chains in the Genus database with same CATH homology
 2X0O A;  2VK9 A;  2A6E D;  2R92 A;  1IW7 D;  4CEI A;  2A68 D;  2NVX A;  1TWA A;  3U44 A;  1Y1W A;  2X0Q A;  2JA5 A;  3U4Q A;  1I50 A;  2CW0 D;  1SFO A;  3LR6 A;  2X0P A;  2R7Z A;  2AQL A;  3GTG A;  2BE5 D;  2N3E A;  2VUM A;  5IZ2 A;  1TWC A;  2E2H A;  4CEH A;  2LPJ A;  2FIO A;  2MX8 A;  2N1D B;  1SMY D;  3LR2 A;  1TWH A;  2A69 D;  3GTO A;  2B63 A;  3GTJ A;  2MQA A;  2LPI A;  2LTH A;  2K3N A;  2JA7 A;  2LYI A;  2LKM B;  3LRD A;  3GTP A;  1K83 A;  4FBS A;  3CQZ A;  1WCM A;  2Y0N A;  3GTK A;  3GTL A;  2K3O A;  3H0G A;  1YNN D;  2NVY A;  1I6V D;  3LR8 A;  1HQM D;  3FKI A;  1TWG A;  4CEJ A;  2F5J A;  1I3Q A;  2R93 A;  1R9T A;  4C2M A;  1Y1V A;  2O5J D;  2K3Q A;  2MX9 A;  2A6H D;  2FIP A;  3GTQ A;  1TWF A;  3GTM A;  2YU9 A;  1ZYR D;  2E2I A;  1YNJ D;  2JA6 A;  4QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...