The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
115
|
structure length |
115
|
Chain Sequence |
PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
source organism |
Bacillus phage phi29
|
publication title |
The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA
pubmed doi rcsb |
molecule keywords |
Late genes activator
|
total genus |
38
|
structure length |
115
|
sequence length |
115
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2005-12-30 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Enzyme I; Chain A, domain 2 | Enzyme I; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 2FIP A; 2FIO A; #chains in the Genus database with same CATH topology 1ZYR D; 2X0Q A; 1YNJ D; 2F5J A; 2LPI A; 4C5S A; 3GTK A; 2NVX A; 2B63 A; 1T6J A; 1SMY D; 4V2R A; 1HQM D; 2MQA A; 2LTH A; 4C5U A; 1I3Q A; 3GTG A; 1EZA A; 3LR6 A; 4CQ5 A; 2R92 A; 2VK9 A; 3U44 A; 1SFO A; 3U4Q A; 1EZB A; 3LR2 A; 2MP0 A; 1IW7 D; 2X0O A; 2LYI A; 2K3Q A; 1T6P A; 2K3O A; 3GTM A; 3LRD A; 2CW0 D; 1TWA A; 2HWG A; 4C6G A; 2AQL A; 2FIO A; 1TWF A; 5IZ2 A; 1Y1V A; 2R7Z A; 3GTJ A; 4C5R A; 2A68 D; 1TWH A; 3EZA A; 1TWC A; 2LPJ A; 3EZB A; 3GTL A; 4QIW A; 3CQZ A; 2N3E A; 2Y0N A; 2EZC A; 1K83 A; 1I50 A; 1YNN D; 4C2M A; 2E2H A; 2EZB A; 4CEJ A; 1WCM A; 4BAA A; 1TWG A; 3GTP A; 2A69 D; 2N1D B; 2O5J D; 4CEH A; 3NZ4 A; 4FBS A; 3GTQ A; 2K3N A; 2E2I A; 2A6H D; 4CEI A; 3GTO A; 2A6E D; 2JA7 A; 1Y2M A; 2R93 A; 2JA6 A; 1R9T A; 1W27 A; 2HRO A; 2BE5 D; 2YU9 A; 2MX9 A; 3FKI A; 2FIP A; 2MX8 A; 2X0P A; 3LR8 A; 4V2Q A; 3H0G A; 1I6V D; 2JA5 A; 2VUM A; 1ZYM A; 2NVY A; 4BAB A; 3EZE A; 2LKM B; 2EZA A; 2YII A; 1Y1W A; #chains in the Genus database with same CATH homology 1ZYR D; 2X0Q A; 1YNJ D; 2F5J A; 2LPI A; 3GTK A; 2NVX A; 2B63 A; 1SMY D; 1HQM D; 2MQA A; 2LTH A; 1I3Q A; 3GTG A; 3LR6 A; 2R92 A; 2VK9 A; 3U44 A; 1SFO A; 3U4Q A; 3LR2 A; 1IW7 D; 2X0O A; 2LYI A; 2K3Q A; 2K3O A; 3GTM A; 3LRD A; 2CW0 D; 1TWA A; 2AQL A; 2FIO A; 1TWF A; 5IZ2 A; 1Y1V A; 2R7Z A; 3GTJ A; 2A68 D; 1TWH A; 1TWC A; 2LPJ A; 3GTL A; 4QIW A; 3CQZ A; 2N3E A; 2Y0N A; 1K83 A; 1I50 A; 1YNN D; 4C2M A; 2E2H A; 4CEJ A; 1WCM A; 1TWG A; 3GTP A; 2A69 D; 2N1D B; 2O5J D; 4CEH A; 4FBS A; 3GTQ A; 2K3N A; 2E2I A; 2A6H D; 4CEI A; 3GTO A; 2A6E D; 2JA7 A; 2R93 A; 2JA6 A; 1R9T A; 2BE5 D; 2YU9 A; 2MX9 A; 3FKI A; 2FIP A; 2MX8 A; 2X0P A; 3LR8 A; 3H0G A; 1I6V D; 2JA5 A; 2NVY A; 2LKM B; 2VUM A; 1Y1W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...