The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
52
|
structure length |
52
|
Chain Sequence |
GSPEYLSDEIFSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination.
pubmed doi rcsb |
| molecule tags |
Cell cycle
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
Cell division control protein 4
|
| total genus |
17
|
| structure length |
52
|
| sequence length |
52
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2007-03-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF16856 | CDC4_D | Cell division control protein 4 dimerisation domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 2P63 A; #chains in the Genus database with same CATH topology 3A4N A; 3Q0J A; 4U1A A; 2GTR A; 2UZF A; 3SLL A; 5KJP A; 2ZQQ A; 2VRE A; 4F47 A; 3H81 A; 3OC7 A; 1MJ3 A; 4GEH B; 4NEK A; 1DCI A; 2F6Q A; 1EY3 A; 3RQF A; 4MOU A; 3MOY A; 3T8A A; 3A4M A; 2HW5 A; 2QQ3 A; 4FZW C; 1UIY A; 1NZY B; 4QII A; 3TLF A; 3AJM A; 2P63 A; 3RQG A; 3HIN A; 3SWX A; 3ADB A; 3HRX A; 2ZQR A; 3MYB A; 1DUB A; 3R0O A; 4I52 A; 3R9T A; 1NZY A; 4KNP A; 3ADD A; 3L8J A; 3AM1 A; 4ELW A; 3G64 A; 1Y64 B; 3RSI A; 2VX2 A; 4U19 A; 4JOT A; 4OG1 A; 1JXZ A; 4FZW A; 4U18 A; 3L8I A; 2FW2 A; 3A4L A; 4EML A; 3T88 A; 3Q1T A; 1WZ8 A; 1EF9 A; 2PPY A; 3P5M A; 4IZD A; 4QIJ A; 4ELX A; 3W8H B; 4JWV A; 1EF8 A; 3RQE A; 4JFC A; 1RJM A; 1Q51 A; 3W8I B; 3R9S A; 4FJW D; 3O4X E; 3Q0G A; 4JYL A; 4K3W A; 4IZB A; 2IEX A; 3KQF A; 4WCZ A; 3IRB A; 3H02 A; 1UX5 A; 2EJ5 A; 5JBW A; 4IZC A; 3T89 A; 3QXZ A; 3FDU A; 2DUB A; 1Q52 A; 4I4Z A; 4MI2 A; 1HZD A; 2PBP A; 4NNQ A; 4OLQ A; 3PZK A; 3QXI A; 1RJN A; 4ELS A; 3TRR A; 3I47 A; 4ZU2 A; 4K2N A; 4JCS A; 2FBM A; 5C9G A; 3ADC A; 3QK8 A; 1UX4 A; 5JBX A; 4I42 A; #chains in the Genus database with same CATH homology 3A4N A; 3W8H B; 3RQE A; 1UX4 A; 3ADD A; 1RJM A; 4GEH B; 3L8J A; 3W8I B; 3AM1 A; 3RQF A; 1Y64 B; 4NNQ A; 3O4X E; 3A4M A; 3IRB A; 3AJM A; 2P63 A; 3RQG A; 1UX5 A; 3ADC A; 3L8I A; 3A4L A; 3ADB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
