3L8IA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
b'TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8iA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8iA02
3TULA 2PBEA 1WWPA 3RQFA 1K40A 2JPUA 3C8GD 3RQEA 2KK1A 1UFBA 1PV3A 3RQGA 2HSBA 3GM2A 1KTMA 2Q00A 3B71A 3GM1A 2LK4A 3K7DA 3S9OA 1KNYA 1V4AA 3W8IB 3C18A 4XEFA 1K04A 3L8IA 3GM3A 3U3FA 4GEHB 4EBJA 2YWAA 1WTYA 3L8JA 2L6FA 2L6HA 3C8GB 3AJMA 4XEVA 3W8HB 3U0CA 4R32A 3C8GA 1ZZPA 3JYYA 4EBKA 2L6GA 1OW6A 3O10A 3MFNA 4XEKA 4NQFA 1O3UA 5F28E 1OW8A 3BRJA 3JZ0A 2JX0A 1QVXA 1OW7A 1WOLA 1JOGA 1K05A
chains in the Genus database with same CATH superfamily
4F4BA 4AL0A 4E7SA 1Y6DA 4DOZA 1V54C 2Q9AA 3U8VA 2RD9A 3GORA 3R9TA 3IRBA 3ABKC 2LP4A 2WZGA 4E17A 3ZC4A 4XLPF 4XEKA 1QSPA 4IWBA 3ABLC 3VF0A 2LCHA 2XRHA 2A6EF 1JPNA 1QQ3A 3Q0GA 3Q7GA 3EG9A 2LFFA 3QVYA 3MFNA 1T01A 1A7DA 1NU9C 3FOPA 3LLKA 3N24A 4OIPF 3KMIA 2IXPA 1G5ZA 2J0WA 4KBLA 1C02A 2PX0A 3LNRA 3T88A 3CZ6A 3WG7C 4N6HA 4XPXA 1NBBA 2XXAA 3NDBB 3TOLA 4ELSA 3QZCA 5A6AA 1PV3A 4ZLDA 1M2VB 3LNMB 1YLMA 2AWYA 3KPHA 4AX2A 4Q7CA 3ADBA 2CCYA 4LDQA 1U0BB 3JYHA 5A6BA 1L7CA 3ZIBA 3ZG1A 4MTGA 3K1IA 5JVEA 3S28A 3MOYA 4JCHA 1A41A 2PX3A 3WODF 3EGXA 2YLIA 2YKZA 3I4UA 2J8WA 4JWVA 3DAFA 1YARO 3DAGA 3HKKA 4H4KC 4JC7A 1XWJA 1G8XA 3E70C 2HSBA 2EPMX 2ZD9A 4ZU2A 2OKUA 3NYLA 4XPYA 3TLFA 1TFOB 3UGOA 2IBFA 4B6IA 1D0XA 3Q1TA 5E33A 1GQAA 1K05A 2Y69C 1O5HA 3C8GD 4IARA 3UR3C 4FZWA 2FGYA 3ZDLA 5JS5A 4G7ZF 1JRAA 1YA7O 4OIRF 1M6TA 2EIJC 4IZBA 1CGOA 1TQGA 2YRFA 1Z23A 4I1OB 3T4RA 4EMLA 4P6IC 1YVIA 4CJOA 4PJNA 3QMKA 4KNWA 4DXWA 4YT8A 3B29A 3DE9A 2O9XA 1ORYA 3DD7A 1LI5A 4JJGA 1Z63A 3U3BA 5KJPA 4CBEA 2G3VA 1LE2A 4LLEA 3FVYA 1EF9A 1TWHA 2L7AA 2QQ3A 2HZ8A 1HW2A 3A9CA 2FAPB 3LJBA 1TWAA 1OCRC 1QPUA 1ZU5A 4BJ5C 3SEOA 3A4LA 3I5QA 1RCPA 1OW6A 2XLOA 2OG2A 1OW8A 4N4WA 3NRHA 5A6JA 3K7DA 1Y4CA 4U5EE 3OEOA 1Z5ZA 3H2VA 4RD9A 4ULVA 2P0NA 3ABMC 1FAPB 4XLNF 1N1CA 2HMQA 5BQIA 4PFPA 5B3IA 2W4MA 2G3KA 1RKEB 2MWQA 1DCIA 1O3UA 5KYNA 3MLGA 5B1AC 3GM2A 5BUOA 2Q00A 4Z9HA 1EQ1A 1AEPA 5E2QA 2H8AA 1SF8A 2W9YA 1PD1A 3DJNB 3HJCA 3EGDA 4U18A 3EFOB 2J45A 4FESA 1U6HA 4FZWC 2F6QA 5JLIA 3T8AA 4NY3A 4HE8D 2EIMC 5BQHA 1OXKA 2CYDA 1LS4A 1QLEC 1H9GA 2XLMA 2IOQA 1B68A 5JT4A 3QXZA 2GA0A 3QK8A 4WABA 1J8MF 1G4WR 3S29A 3UMHA 2Q3TA 2YL1A 2BL2A 2HKVA 3SYNA 4DVZA 1H6GA 3EJNA 2G62A 5KYUB 4MVSA 1SZIA 3A4MA 1SR2A 2LD6A 1OR3A 5JBXA 1BR2A 3ZTZA 4WGZA 3SLLA 1FFTC 3IEEA 4MVUA 1TKNA 4ANJA 1OW7A 4K3WA 1VLTA 3GANA 4PJLA 2OEVA 5L0IA 3W8IB 1ZHTA 2MYSA 3HNIA 4R32A 2A1DD 2A69F 3PMRA 4ELXA 2DI3A 2HMZA 2IXNA 2XSEA 3QW0A 1JPJA 4F47A 4NCQA 4U1AA 3PCVA 4YN0B 1VYIA 3CQZA 2LQGA 5CI8A 1E85A 4G7OF 4YL3A 2A0UA 1RKEA 3MX3A 2WL8A 1KTMA 3V5XA 3GM1A 3RSIA 3GEHA 3S84A 2CDQA 4A4AA 2WVQA 3HNLA 2R7RA 3SWXA 2IEXA 5DQZA 1YJGA 2Y3HA 2YEVA 1ZW2A 1HMDA 5DS5A 3LS0A 4G7HF 1WWPA 3EFOA 4ULWA 3U9JA 3G4ZA 4DBQA 4OG1A 1ZYRF 4EIYA 2DYRC 3EHNA 4AE4B 3VRCA 1MMNA 3KQFA 2EPNA 2P63A 2QNLA 2EPOA 4OIOF 4MOUA 3EH2A 2I8BA 5KYUA 1MMAA 1Z3IX 1XZPA 2DGJA 4J32B 3ZQYA 2LFDA 3R9SA 1E86A 4QI2A 1EY3A 3RW0A 2UUIA 2KGOA 4K0DA 2YL0A 3RIPA 4DBRA 4CX9A 4BJTA 3L0IA 5L3VA 4K1OA 4KNPA 1NFNA 3T89A 4MVOA 1WOLA 1ZHYA 2OJQA 4ER9A 2HW5A 4JOTA 3ASNC 1OR2A 3W8IA 1WTYA 1ZW3A 2Q9BA 3C8GB 5B3SC 4WJ0A 3IQ6A 4JFCA 1ZZPA 3FOOA 1O87A 2GFHA 2QUPA 2OU6A 4MTOA 1AUEA 3RQFA 3S27A 1LPEA 1S7ZA 3LUTB 4JEBA 3SXMA 2QTVA 1WATA 3AG4C 3NMJA 4FX5A 4NTAA 3GWNA 1YAUO 2R25A 3R2PA 2XLEA 3H2UA 3X1OA 3B9QA 3AOUA 2X51A 2KJGA 2GWWA 2CNWD 2A0BA 3JRTA 4DRJB 3DWWA 3I5PA 1I5NA 1HW1A 3ADDA 3NMIA 1TWCA 2ICWG 2J9BA 4OIQF 4YK5A 3KH2A 5DQTA 3C63A 2Y3GA 4U5HA 2NUTB 3CEXA 2ZQQA 4IAQA 4AE4A 3NG1A 2FFHA 3JRMO 3VYWA 2NSFA 3MYIA 4HFKB 3L34A 5A6BD 1D0YA 3ZSUA 3T6GB 5CI9A 2OJED 1OKKD 1NU7D 1C17M 3T6JA 4XTKA 3HNKA 4NTFA 2DYSC 3O10A 1AVOB 4WGYA 2KW3C 2D4UA 2W4BA 1I4ZA 2Z15A 2Y39A 5E3CA 4JYLA 3NMKA 1LKXA 2OOCA 5EGYA 2BC5A 3A11A 2Q7RA 1D1BA 4JW1A 2YL3A 4J30B 5AC5A 4I3MA 2IXOA 2FW2A 3LEVA 4U5DE 4D4NA 2E87A 3JT1A 3AGTA 2WZFA 1G4US 4XQ1A 1D0ZA 4IAOA 2ASRA 3OWTA 4JCZA 1TR2A 2BE5F 1ST6A 3ZQVA 4G0HA 2OCCC 2HJMA 4A2NB 3V7OA 5DLJA 4U19A 1JR8A 3GODA 1K04A 1LS1A 4GEHB 1E84A 2HUJA 4E0IA 2W45A 3B0UX 2HSQA 3SNHA 1M2OA 5JSLA 2FBMA 4QIJA 3POVA 2VC9A 1PCXA 3W2WA 2Q9CA 1MMGA 5L0HA 1YYXA 1ZVZA 2VCCA 1SMYF 2GDCA 3DKAA 3N2ZB 1ORJA 1M2VA 1FMWA 4P9FA 1EI7A 3R0OA 1ZU4A 2L6HA 4BPMA 3RKOF 4OINF 3K1IC 4XEVA 4KNVA 1WGWA 2C03A 3BEHA 1EKYA 1XZQA 4E18A 1TWGA 2UUHA 4O7GA 3TJ6A 1HE1A 2L9JA 1FMVA 1OCCC 2EINC 1VLSA 2IM8A 4BJ1A 3T6BA 1WN0A 2XLHA 3NKDA 4JURI 2J9VA 1NLXA 4CIHA 1L3PA 1HMOA 4K7BA 3RVYA 2VH3A 4U5FE 3FDUA 1JXZA 4ONSA 3Q6NA 4I44A 5EHHA 3OA1A 5B1BC 5IY5C 2VASA 5JBWA 1VYKA 1UIYA 2J7PD 3UMIA 1UX5A 2TMVP 1HZDA 1OCOC 2YLDA 4IRUA 1M56C 1KNYA 4CS8A 2RSEB 4JZAA 3CAXA 4CDAA 4JCSA 5AGFA 3AM1A 1MNDA 4H54A 4JIOA 1RJ9B 3H65A 1BR1A 4O6YA 2C04A 4PR9A 1HE9A 4I52A 4GEHA 3HINA 3FXHA 2EIKC 3QW1A 3F46A 2NG1A 2WVOA 4WCZA 2JX0A 3S0XA 1RMVA 3HTKC 4JTAB 4OD5A 5KYYB 4JEAA 3ITFA 2GTRA 4C3DA 4MVZA 4DVYP 2PF4E 1T5OA 3JYYA 4CIPA 4DRHB 1NZYB 4YT2A 5FZTA 3W2VA 2VCBA 2JPUA 2ZQRA 1BBHA 3K1HA 1FR0A 3M4CA 2EJ5A 4O79A 1FNTc 3W8HB 2M4EA 3PZKA 3JSZA 3F47A 4QIIA 2R7XA 3VAYA 2XLVA 2J0XA 2I15A 1J8YF 2R7QA 5EK0A 4Z9IA 3AG2C 2MHRA 3ADCA 4W8PA 4BJ6A 2ZXOA 1IZMA 2LSEA 4EUKB 4K2NA 3RVZA 3LESA 4GQHA 3VM6A 2VREA 1MMDA 2YLGA 4KI2A 4PJMA 3WHNA 1CPRA 4EBBA 3I47A 3JSEO 5COMA 1VB5A 3DI5A 1F1MA 5T3WA 3NYJA 4QI0A 3M1CB 3TD7A 3EPVA 2R7OA 1WASA 2CGEA 3LLIA 3M15A 1Q0MA 2J9WA 1I4YA 1VMAA 2XLDA 2R9RB 4MVMA 4XEFA 2IXMA 4G78A 3ZWIA 3SXKA 3AG3C 3SXZA 3U2MA 1LI7A 3CSKA 2AWCA 4U5GA 3S9OA 4LERA 4MQ9F 1V4AA 4MVRA 3IHUA 3K33A 3AGUA 4X0RA 3K66A 4LDKA 2QLAA 1HY5A 2NPUA 1T6IA 3GEEA 4CDVA 3ZTMA 3HRXA 4AK9A 2KC3A 3U8PA 4DRIB 5KYYA 5AC4A 2KYHA 2R7SA 1V74B 4NC3A 3QVZA 1YZAA 2R02A 3MBGA 3DXJF 1IW7F 3RYLA 4CSAA 3WAQA 2R7VA 2XM4A 2R7UA 1Q52A 4NNQA 4OD4A 1CGME 4Q4ZF 5L0FA 2DUBA 1OCZC 3AJMA 2YQYA 4DJ9A 5CIVA 3W8HA 5T1DB 2Y3DA 5HSWA 2Y3BA 1QZXA 4MI2A 3EZIA 4BJ6C 2WVNA 1BR4A 2CW0F 2P61A 4D4XA 5L3QA 4HEAJ 2VX2A 4RBNA 3ATPA 3AG1C 4E0HA 2R05A 3V5YA 1Z6AA 3TRRA 4EWCA 2CNWA 4EHPA 2HFIA 1A7VA 2V26A 4U9DA 3U2LA 1CGNA 2PP4A 3TQOA 3LS1A 3RQGA 3FMSA 1VK5A 1BDJB 1H9TA 4JTCB 3QTHA 3C7JA 5KYXB 3HLZA 5D91A 2H7VC 4CS9A 4ELWA 4CS7A 4NQFA 5COFA 5KYWB 1VOMA 3M4BA 1YDIA 1APCA 1V55C 4MNDA 1Q51A 1H7IA 1T6UA 4BJ5A 1SYQA 4U5CE 4JKVA 5F28E 3G4XA 1OKKA 1MJ3A 4JRZA 4C7OB 3DM9B 1RKCA 3C18A 1YYJA 2ZXRA 1ZHWA 2HV7A 4CSAC 2L6FA 2YL7A 2PNOA 1NZEA 3L8IA 1RJNA 3TULA 2J9UA 1LIHA 1LVKA 3QXIA 1OQCA 4MVQA 3S90A 2HV6A 1RXQA 2KQ9A 3RFYA 3M79A 3EQLF 3C8GA 3Q7LA 3EGDB 2M64A 4N6CA 1GGQA 1GM5A 5GPGB 2KK1A 2LK4A 3W4YA 2ZXPA 4JJFA 1CPQA 5K0IA 3U3FA 2X0CA 4YJWA 2L81A 3UNGC 4I4ZA 5JP7A 1YZCA 1MNEA 4C3BA 4BEMJ 5L0DA 3GWLA 2XL6A 3EH1A 4FJWD 2AP3A 3IQTA 3DZAA 2NUPB 3FHDA 4RDAA 1RJMA 4J7TA 1MQVA 3FAPB 5C9GA 2L6GA 4JVSA 4IGGA 3DE8A 1JMWA 3G64A 3TJ5A 3H02A 2A6HF 4OLQA 3DMDA 3PDMP 5JRAA 2YZSA 4Z9JA 1FFHA 1DOVA 4O6MA 2NUTA 4AL1A 4CS9C 3JCUQ 4QDLA 2EILC 5KYXA 2HS5A 5COGA 2UZFA 3KYIA 3LEOA 1QKRA 1EF8A 4CDYA 3B0VC 3G50A 5E3AA 5KYWA 1GS9A 1UFBA 5JUAA 3H81A 1OXBA 1R5ID 3P5MA 5HV9A 1ZHXA 2QY9A 3L8JA 3OC7A 1A0BA 5L0CA 3A4NA 4UDVA 1UX4A 5A6KA 3O6XA 2B0JA 4YL0A 2OQMA 2R7WA 4PJJA 1K40A 1T9KA 1E83A 4C7OA 4PFOA 2D5RB 4XWJA 2XS8A 2EPKX 3KKBA 5L0GA 1YA9A 4PK4A 3MYFA 2J46A 3JZ0A 4O6NA 4LDRA 3V5ZA 2F22A 3MYBA 4MW8A 2NSGA 3O4XE 4YT4A 2YVKA 4CJGA 2J7PA 1VTMP 3U0CA 2H7OA 2PPYA 4JE9A 1D1AA 4YWQA 4HFFB 4XPWA 5L0JA 4LLCA 3O55A 3FAJA 2XL8A 2YHSA 1KU2A 3GEIA 4MS2A 2LIGA 2P6VA 1ORSC 2JD3A 3E9VA 4IJJA 3SXYA 2WZLA 1BZ4A 2NUPA 3RQEA 2V3CC 5F5HA 2R03A 4NEKA 4MTFA 3X2QC 5T3TA 3UMKA 1ZHZA 3HNJA 4EBKA 3NYMA 5TJ5E 3BRJA 4NTBA 2ETSA 1DUBA 3LAYA 2HJ3A 1T6QA 1W2WA 1NG1A 3Q0JA 1D1CA 4EBJA 3IPMO 3AQCA 1S05A 4P9TA 3O39A 2IYLD 1JAFA 3RH3A 3PHF2 4ZLCA 1C03A 256BA 4I42A 2ZPAA 4N06A 3IQ5A 4YT5A 1Y64B 5D92A 4IB4A 3SP1A 3TOMA 3B0PA 3JTLO 4BG0A 4PACA 1U89A 2PBEA 2VB6A 2DB4A 3Q6MA 4KC9A 1DOWA 3L1MA 2OEXA 1UG7A 3EG9B 3J06A 3EHMA 3KL4A 3TK0A 2ZXWC 3RF3A 2Q4FA 1NFOA 1M57C 1QVXA 4LACB 1NSGB 2B0HA 4Q5SF 3C62A 4CS8C 2P7VA 2A68F 4MW3A 4JTDB 3DJUB 2XS1A 3K6BA 4U5BE 3U9MA 4J7YA 1E2XA 4M63A 1LE4A 5F5FA 2R7TA 2XXAB 1A7EA 2GAQA 4YL1A 3KYJA 1Z7Qc 3US6A 3NKEA 3B71A 3U5SA 4IZDA 3ASOC 3FDQA 1Q0GA 1LM3B 1RJ9A 3UGPA 3AQBA 2PBPA 2VCAA 5DVWA 2XL4A 1PD0A 4E7ZA 1FTSA 3R7CA 2KSFA 2XM0A 2XLWA 3C8ZA 3SZRA 1R4TA 5A69A 1Q0DA 4U9EA 2H7BA 3T9OA 5DS6A 4GYTA 4FAPB 2KNHA 4FWVA 5BQGA 3N0TA 2EPLX 4EKWA 1TFKB 2AU5A 2P1AA 3GM3A 3EGXB 4IZCA 5FCLA 5DS4A 2WB7A 2PFDA 3IQCA 1NZYA 4I1MA 1Q0FA 1EA8A 4W8KA 2AVKA 3EZHA 2YWAA 4C3EA 4BEJA 3ECSA 3ZVRA 2QE9A 4L6RA 3DM5A 1WZ8A 1Q0KA 1JOGA
chains in the Genus database with same CATH topology
3TULA 2JPUA 3RQEA 1UFBA 3S9OA 1V4AA 1K04A 4GEHB 3IRBA 3L8JA 3W8HB 3C8GA 4EBKA 3A4NA 4XEKA 1UX4A 3BRJA 1WOLA 1UX5A 1K40A 2KK1A 3RQGA 2HSBA 1KTMA 3B71A 3GM1A 2LK4A 1KNYA 3U3FA 4EBJA 1WTYA 3A4LA 3C8GB 3ADCA 1ZZPA 3O10A 1OW6A 3MFNA 4NQFA 1OW8A 3JZ0A 1K05A 3K7DA 4NNQA 3AM1A 1WWPA 3RQFA 3C8GD 3A4MA 1RJMA 3O4XE 3GM3A 1Y64B 2L6HA 3AJMA 3U0CA 2L6GA 1O3UA 5F28E 2JX0A 4XEVA 1OW7A 2PBEA 2P63A 3GM2A 1PV3A 2Q00A 3W8IB 3C18A 4XEFA 2YWAA 3ADBA 2L6FA 4R32A 3ADDA 3JYYA 1QVXA 1JOGA 3L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUL A;  2PBE A;  1WWP A;  3RQF A;  1K40 A;  2JPU A;  3C8G D;  3RQE A;  2KK1 A;  1UFB A;  1PV3 A;  3RQG A;  2HSB A;  3GM2 A;  1KTM A;  2Q00 A;  3B71 A;  3GM1 A;  2LK4 A;  3K7D A;  3S9O A;  1KNY A;  1V4A A;  3W8I B;  3C18 A;  4XEF A;  1K04 A;  3L8I A;  3GM3 A;  3U3F A;  4GEH B;  4EBJ A;  2YWA A;  1WTY A;  3L8J A;  2L6F A;  2L6H A;  3C8G B;  3AJM A;  4XEV A;  3W8H B;  3U0C A;  4R32 A;  3C8G A;  1ZZP A;  3JYY A;  4EBK A;  2L6G A;  1OW6 A;  3O10 A;  3MFN A;  4XEK A;  4NQF A;  1O3U A;  5F28 E;  1OW8 A;  3BRJ A;  3JZ0 A;  2JX0 A;  1QVX A;  1OW7 A;  1WOL A;  1JOG A;  1K05 A; 
#chains in the Genus database with same CATH topology
 4F4B A;  4AL0 A;  4E7S A;  1Y6D A;  4DOZ A;  1V54 C;  2Q9A A;  3U8V A;  2RD9 A;  3GOR A;  3R9T A;  3IRB A;  3ABK C;  2LP4 A;  2WZG A;  4E17 A;  3ZC4 A;  4XLP F;  4XEK A;  1QSP A;  4IWB A;  3ABL C;  3VF0 A;  2LCH A;  2XRH A;  2A6E F;  1JPN A;  1QQ3 A;  3Q0G A;  3Q7G A;  3EG9 A;  2LFF A;  3QVY A;  3MFN A;  1T01 A;  1A7D A;  1NU9 C;  3FOP A;  3LLK A;  3N24 A;  4OIP F;  3KMI A;  2IXP A;  1G5Z A;  2J0W A;  4KBL A;  1C02 A;  2PX0 A;  3LNR A;  3T88 A;  3CZ6 A;  3WG7 C;  4N6H A;  4XPX A;  1NBB A;  2XXA A;  3NDB B;  3TOL A;  4ELS A;  3QZC A;  5A6A A;  1PV3 A;  4ZLD A;  1M2V B;  3LNM B;  1YLM A;  2AWY A;  3KPH A;  4AX2 A;  4Q7C A;  3ADB A;  2CCY A;  4LDQ A;  1U0B B;  3JYH A;  5A6B A;  1L7C A;  3ZIB A;  3ZG1 A;  4MTG A;  3K1I A;  5JVE A;  3S28 A;  3MOY A;  4JCH A;  1A41 A;  2PX3 A;  3WOD F;  3EGX A;  2YLI A;  2YKZ A;  3I4U A;  2J8W A;  4JWV A;  3DAF A;  1YAR O;  3DAG A;  3HKK A;  4H4K C;  4JC7 A;  1XWJ A;  1G8X A;  3E70 C;  2HSB A;  2EPM X;  2ZD9 A;  4ZU2 A;  2OKU A;  3NYL A;  4XPY A;  3TLF A;  1TFO B;  3UGO A;  2IBF A;  4B6I A;  1D0X A;  3Q1T A;  5E33 A;  1GQA A;  1K05 A;  2Y69 C;  1O5H A;  3C8G D;  4IAR A;  3UR3 C;  4FZW A;  2FGY A;  3ZDL A;  5JS5 A;  4G7Z F;  1JRA A;  1YA7 O;  4OIR F;  1M6T A;  2EIJ C;  4IZB A;  1CGO A;  1TQG A;  2YRF A;  1Z23 A;  4I1O B;  3T4R A;  4EML A;  4P6I C;  1YVI A;  4CJO A;  4PJN A;  3QMK A;  4KNW A;  4DXW A;  4YT8 A;  3B29 A;  3DE9 A;  2O9X A;  1ORY A;  3DD7 A;  1LI5 A;  4JJG A;  1Z63 A;  3U3B A;  5KJP A;  4CBE A;  2G3V A;  1LE2 A;  4LLE A;  3FVY A;  1EF9 A;  1TWH A;  2L7A A;  2QQ3 A;  2HZ8 A;  1HW2 A;  3A9C A;  2FAP B;  3LJB A;  1TWA A;  1OCR C;  1QPU A;  1ZU5 A;  4BJ5 C;  3SEO A;  3A4L A;  3I5Q A;  1RCP A;  1OW6 A;  2XLO A;  2OG2 A;  1OW8 A;  4N4W A;  3NRH A;  5A6J A;  3K7D A;  1Y4C A;  4U5E E;  3OEO A;  1Z5Z A;  3H2V A;  4RD9 A;  4ULV A;  2P0N A;  3ABM C;  1FAP B;  4XLN F;  1N1C A;  2HMQ A;  5BQI A;  4PFP A;  5B3I A;  2W4M A;  2G3K A;  1RKE B;  2MWQ A;  1DCI A;  1O3U A;  5KYN A;  3MLG A;  5B1A C;  3GM2 A;  5BUO A;  2Q00 A;  4Z9H A;  1EQ1 A;  1AEP A;  5E2Q A;  2H8A A;  1SF8 A;  2W9Y A;  1PD1 A;  3DJN B;  3HJC A;  3EGD A;  4U18 A;  3EFO B;  2J45 A;  4FES A;  1U6H A;  4FZW C;  2F6Q A;  5JLI A;  3T8A A;  4NY3 A;  4HE8 D;  2EIM C;  5BQH A;  1OXK A;  2CYD A;  1LS4 A;  1QLE C;  1H9G A;  2XLM A;  2IOQ A;  1B68 A;  5JT4 A;  3QXZ A;  2GA0 A;  3QK8 A;  4WAB A;  1J8M F;  1G4W R;  3S29 A;  3UMH A;  2Q3T A;  2YL1 A;  2BL2 A;  2HKV A;  3SYN A;  4DVZ A;  1H6G A;  3EJN A;  2G62 A;  5KYU B;  4MVS A;  1SZI A;  3A4M A;  1SR2 A;  2LD6 A;  1OR3 A;  5JBX A;  1BR2 A;  3ZTZ A;  4WGZ A;  3SLL A;  1FFT C;  3IEE A;  4MVU A;  1TKN A;  4ANJ A;  1OW7 A;  4K3W A;  1VLT A;  3GAN A;  4PJL A;  2OEV A;  5L0I A;  3W8I B;  1ZHT A;  2MYS A;  3HNI A;  4R32 A;  2A1D D;  2A69 F;  3PMR A;  4ELX A;  2DI3 A;  2HMZ A;  2IXN A;  2XSE A;  3QW0 A;  1JPJ A;  4F47 A;  4NCQ A;  4U1A A;  3PCV A;  4YN0 B;  1VYI A;  3CQZ A;  2LQG A;  5CI8 A;  1E85 A;  4G7O F;  4YL3 A;  2A0U A;  1RKE A;  3MX3 A;  2WL8 A;  1KTM A;  3V5X A;  3GM1 A;  3RSI A;  3GEH A;  3S84 A;  2CDQ A;  4A4A A;  2WVQ A;  3HNL A;  2R7R A;  3SWX A;  2IEX A;  5DQZ A;  1YJG A;  2Y3H A;  2YEV A;  1ZW2 A;  1HMD A;  5DS5 A;  3LS0 A;  4G7H F;  1WWP A;  3EFO A;  4ULW A;  3U9J A;  3G4Z A;  4DBQ A;  4OG1 A;  1ZYR F;  4EIY A;  2DYR C;  3EHN A;  4AE4 B;  3VRC A;  1MMN A;  3KQF A;  2EPN A;  2P63 A;  2QNL A;  2EPO A;  4OIO F;  4MOU A;  3EH2 A;  2I8B A;  5KYU A;  1MMA A;  1Z3I X;  1XZP A;  2DGJ A;  4J32 B;  3ZQY A;  2LFD A;  3R9S A;  1E86 A;  4QI2 A;  1EY3 A;  3RW0 A;  2UUI A;  2KGO A;  4K0D A;  2YL0 A;  3RIP A;  4DBR A;  4CX9 A;  4BJT A;  3L0I A;  5L3V A;  4K1O A;  4KNP A;  1NFN A;  3T89 A;  4MVO A;  1WOL A;  1ZHY A;  2OJQ A;  4ER9 A;  2HW5 A;  4JOT A;  3ASN C;  1OR2 A;  3W8I A;  1WTY A;  1ZW3 A;  2Q9B A;  3C8G B;  5B3S C;  4WJ0 A;  3IQ6 A;  4JFC A;  1ZZP A;  3FOO A;  1O87 A;  2GFH A;  2QUP A;  2OU6 A;  4MTO A;  1AUE A;  3RQF A;  3S27 A;  1LPE A;  1S7Z A;  3LUT B;  4JEB A;  3SXM A;  2QTV A;  1WAT A;  3AG4 C;  3NMJ A;  4FX5 A;  4NTA A;  3GWN A;  1YAU O;  2R25 A;  3R2P A;  2XLE A;  3H2U A;  3X1O A;  3B9Q A;  3AOU A;  2X51 A;  2KJG A;  2GWW A;  2CNW D;  2A0B A;  3JRT A;  4DRJ B;  3DWW A;  3I5P A;  1I5N A;  1HW1 A;  3ADD A;  3NMI A;  1TWC A;  2ICW G;  2J9B A;  4OIQ F;  4YK5 A;  3KH2 A;  5DQT A;  3C63 A;  2Y3G A;  4U5H A;  2NUT B;  3CEX A;  2ZQQ A;  4IAQ A;  4AE4 A;  3NG1 A;  2FFH A;  3JRM O;  3VYW A;  2NSF A;  3MYI A;  4HFK B;  3L34 A;  5A6B D;  1D0Y A;  3ZSU A;  3T6G B;  5CI9 A;  2OJE D;  1OKK D;  1NU7 D;  1C17 M;  3T6J A;  4XTK A;  3HNK A;  4NTF A;  2DYS C;  3O10 A;  1AVO B;  4WGY A;  2KW3 C;  2D4U A;  2W4B A;  1I4Z A;  2Z15 A;  2Y39 A;  5E3C A;  4JYL A;  3NMK A;  1LKX A;  2OOC A;  5EGY A;  2BC5 A;  3A11 A;  2Q7R A;  1D1B A;  4JW1 A;  2YL3 A;  4J30 B;  5AC5 A;  4I3M A;  2IXO A;  2FW2 A;  3LEV A;  4U5D E;  4D4N A;  2E87 A;  3JT1 A;  3AGT A;  2WZF A;  1G4U S;  4XQ1 A;  1D0Z A;  4IAO A;  2ASR A;  3OWT A;  4JCZ A;  1TR2 A;  2BE5 F;  1ST6 A;  3ZQV A;  4G0H A;  2OCC C;  2HJM A;  4A2N B;  3V7O A;  5DLJ A;  4U19 A;  1JR8 A;  3GOD A;  1K04 A;  1LS1 A;  4GEH B;  1E84 A;  2HUJ A;  4E0I A;  2W45 A;  3B0U X;  2HSQ A;  3SNH A;  1M2O A;  5JSL A;  2FBM A;  4QIJ A;  3POV A;  2VC9 A;  1PCX A;  3W2W A;  2Q9C A;  1MMG A;  5L0H A;  1YYX A;  1ZVZ A;  2VCC A;  1SMY F;  2GDC A;  3DKA A;  3N2Z B;  1ORJ A;  1M2V A;  1FMW A;  4P9F A;  1EI7 A;  3R0O A;  1ZU4 A;  2L6H A;  4BPM A;  3RKO F;  4OIN F;  3K1I C;  4XEV A;  4KNV A;  1WGW A;  2C03 A;  3BEH A;  1EKY A;  1XZQ A;  4E18 A;  1TWG A;  2UUH A;  4O7G A;  3TJ6 A;  1HE1 A;  2L9J A;  1FMV A;  1OCC C;  2EIN C;  1VLS A;  2IM8 A;  4BJ1 A;  3T6B A;  1WN0 A;  2XLH A;  3NKD A;  4JUR I;  2J9V A;  1NLX A;  4CIH A;  1L3P A;  1HMO A;  4K7B A;  3RVY A;  2VH3 A;  4U5F E;  3FDU A;  1JXZ A;  4ONS A;  3Q6N A;  4I44 A;  5EHH A;  3OA1 A;  5B1B C;  5IY5 C;  2VAS A;  5JBW A;  1VYK A;  1UIY A;  2J7P D;  3UMI A;  1UX5 A;  2TMV P;  1HZD A;  1OCO C;  2YLD A;  4IRU A;  1M56 C;  1KNY A;  4CS8 A;  2RSE B;  4JZA A;  3CAX A;  4CDA A;  4JCS A;  5AGF A;  3AM1 A;  1MND A;  4H54 A;  4JIO A;  1RJ9 B;  3H65 A;  1BR1 A;  4O6Y A;  2C04 A;  4PR9 A;  1HE9 A;  4I52 A;  4GEH A;  3HIN A;  3FXH A;  2EIK C;  3QW1 A;  3F46 A;  2NG1 A;  2WVO A;  4WCZ A;  2JX0 A;  3S0X A;  1RMV A;  3HTK C;  4JTA B;  4OD5 A;  5KYY B;  4JEA A;  3ITF A;  2GTR A;  4C3D A;  4MVZ A;  4DVY P;  2PF4 E;  1T5O A;  3JYY A;  4CIP A;  4DRH B;  1NZY B;  4YT2 A;  5FZT A;  3W2V A;  2VCB A;  2JPU A;  2ZQR A;  1BBH A;  3K1H A;  1FR0 A;  3M4C A;  2EJ5 A;  4O79 A;  1FNT c;  3W8H B;  2M4E A;  3PZK A;  3JSZ A;  3F47 A;  4QII A;  2R7X A;  3VAY A;  2XLV A;  2J0X A;  2I15 A;  1J8Y F;  2R7Q A;  5EK0 A;  4Z9I A;  3AG2 C;  2MHR A;  3ADC A;  4W8P A;  4BJ6 A;  2ZXO A;  1IZM A;  2LSE A;  4EUK B;  4K2N A;  3RVZ A;  3LES A;  4GQH A;  3VM6 A;  2VRE A;  1MMD A;  2YLG A;  4KI2 A;  4PJM A;  3WHN A;  1CPR A;  4EBB A;  3I47 A;  3JSE O;  5COM A;  1VB5 A;  3DI5 A;  1F1M A;  5T3W A;  3NYJ A;  4QI0 A;  3M1C B;  3TD7 A;  3EPV A;  2R7O A;  1WAS A;  2CGE A;  3LLI A;  3M15 A;  1Q0M A;  2J9W A;  1I4Y A;  1VMA A;  2XLD A;  2R9R B;  4MVM A;  4XEF A;  2IXM A;  4G78 A;  3ZWI A;  3SXK A;  3AG3 C;  3SXZ A;  3U2M A;  1LI7 A;  3CSK A;  2AWC A;  4U5G A;  3S9O A;  4LER A;  4MQ9 F;  1V4A A;  4MVR A;  3IHU A;  3K33 A;  3AGU A;  4X0R A;  3K66 A;  4LDK A;  2QLA A;  1HY5 A;  2NPU A;  1T6I A;  3GEE A;  4CDV A;  3ZTM A;  3HRX A;  4AK9 A;  2KC3 A;  3U8P A;  4DRI B;  5KYY A;  5AC4 A;  2KYH A;  2R7S A;  1V74 B;  4NC3 A;  3QVZ A;  1YZA A;  2R02 A;  3MBG A;  3DXJ F;  1IW7 F;  3RYL A;  4CSA A;  3WAQ A;  2R7V A;  2XM4 A;  2R7U A;  1Q52 A;  4NNQ A;  4OD4 A;  1CGM E;  4Q4Z F;  5L0F A;  2DUB A;  1OCZ C;  3AJM A;  2YQY A;  4DJ9 A;  5CIV A;  3W8H A;  5T1D B;  2Y3D A;  5HSW A;  2Y3B A;  1QZX A;  4MI2 A;  3EZI A;  4BJ6 C;  2WVN A;  1BR4 A;  2CW0 F;  2P61 A;  4D4X A;  5L3Q A;  4HEA J;  2VX2 A;  4RBN A;  3ATP A;  3AG1 C;  4E0H A;  2R05 A;  3V5Y A;  1Z6A A;  3TRR A;  4EWC A;  2CNW A;  4EHP A;  2HFI A;  1A7V A;  2V26 A;  4U9D A;  3U2L A;  1CGN A;  2PP4 A;  3TQO A;  3LS1 A;  3RQG A;  3FMS A;  1VK5 A;  1BDJ B;  1H9T A;  4JTC B;  3QTH A;  3C7J A;  5KYX B;  3HLZ A;  5D91 A;  2H7V C;  4CS9 A;  4ELW A;  4CS7 A;  4NQF A;  5COF A;  5KYW B;  1VOM A;  3M4B A;  1YDI A;  1APC A;  1V55 C;  4MND A;  1Q51 A;  1H7I A;  1T6U A;  4BJ5 A;  1SYQ A;  4U5C E;  4JKV A;  5F28 E;  3G4X A;  1OKK A;  1MJ3 A;  4JRZ A;  4C7O B;  3DM9 B;  1RKC A;  3C18 A;  1YYJ A;  2ZXR A;  1ZHW A;  2HV7 A;  4CSA C;  2L6F A;  2YL7 A;  2PNO A;  1NZE A;  3L8I A;  1RJN A;  3TUL A;  2J9U A;  1LIH A;  1LVK A;  3QXI A;  1OQC A;  4MVQ A;  3S90 A;  2HV6 A;  1RXQ A;  2KQ9 A;  3RFY A;  3M79 A;  3EQL F;  3C8G A;  3Q7L A;  3EGD B;  2M64 A;  4N6C A;  1GGQ A;  1GM5 A;  5GPG B;  2KK1 A;  2LK4 A;  3W4Y A;  2ZXP A;  4JJF A;  1CPQ A;  5K0I A;  3U3F A;  2X0C A;  4YJW A;  2L81 A;  3UNG C;  4I4Z A;  5JP7 A;  1YZC A;  1MNE A;  4C3B A;  4BEM J;  5L0D A;  3GWL A;  2XL6 A;  3EH1 A;  4FJW D;  2AP3 A;  3IQT A;  3DZA A;  2NUP B;  3FHD A;  4RDA A;  1RJM A;  4J7T A;  1MQV A;  3FAP B;  5C9G A;  2L6G A;  4JVS A;  4IGG A;  3DE8 A;  1JMW A;  3G64 A;  3TJ5 A;  3H02 A;  2A6H F;  4OLQ A;  3DMD A;  3PDM P;  5JRA A;  2YZS A;  4Z9J A;  1FFH A;  1DOV A;  4O6M A;  2NUT A;  4AL1 A;  4CS9 C;  3JCU Q;  4QDL A;  2EIL C;  5KYX A;  2HS5 A;  5COG A;  2UZF A;  3KYI A;  3LEO A;  1QKR A;  1EF8 A;  4CDY A;  3B0V C;  3G50 A;  5E3A A;  5KYW A;  1GS9 A;  1UFB A;  5JUA A;  3H81 A;  1OXB A;  1R5I D;  3P5M A;  5HV9 A;  1ZHX A;  2QY9 A;  3L8J A;  3OC7 A;  1A0B A;  5L0C A;  3A4N A;  4UDV A;  1UX4 A;  5A6K A;  3O6X A;  2B0J A;  4YL0 A;  2OQM A;  2R7W A;  4PJJ A;  1K40 A;  1T9K A;  1E83 A;  4C7O A;  4PFO A;  2D5R B;  4XWJ A;  2XS8 A;  2EPK X;  3KKB A;  5L0G A;  1YA9 A;  4PK4 A;  3MYF A;  2J46 A;  3JZ0 A;  4O6N A;  4LDR A;  3V5Z A;  2F22 A;  3MYB A;  4MW8 A;  2NSG A;  3O4X E;  4YT4 A;  2YVK A;  4CJG A;  2J7P A;  1VTM P;  3U0C A;  2H7O A;  2PPY A;  4JE9 A;  1D1A A;  4YWQ A;  4HFF B;  4XPW A;  5L0J A;  4LLC A;  3O55 A;  3FAJ A;  2XL8 A;  2YHS A;  1KU2 A;  3GEI A;  4MS2 A;  2LIG A;  2P6V A;  1ORS C;  2JD3 A;  3E9V A;  4IJJ A;  3SXY A;  2WZL A;  1BZ4 A;  2NUP A;  3RQE A;  2V3C C;  5F5H A;  2R03 A;  4NEK A;  4MTF A;  3X2Q C;  5T3T A;  3UMK A;  1ZHZ A;  3HNJ A;  4EBK A;  3NYM A;  5TJ5 E;  3BRJ A;  4NTB A;  2ETS A;  1DUB A;  3LAY A;  2HJ3 A;  1T6Q A;  1W2W A;  1NG1 A;  3Q0J A;  1D1C A;  4EBJ A;  3IPM O;  3AQC A;  1S05 A;  4P9T A;  3O39 A;  2IYL D;  1JAF A;  3RH3 A;  3PHF 2;  4ZLC A;  1C03 A;  256B A;  4I42 A;  2ZPA A;  4N06 A;  3IQ5 A;  4YT5 A;  1Y64 B;  5D92 A;  4IB4 A;  3SP1 A;  3TOM A;  3B0P A;  3JTL O;  4BG0 A;  4PAC A;  1U89 A;  2PBE A;  2VB6 A;  2DB4 A;  3Q6M A;  4KC9 A;  1DOW A;  3L1M A;  2OEX A;  1UG7 A;  3EG9 B;  3J06 A;  3EHM A;  3KL4 A;  3TK0 A;  2ZXW C;  3RF3 A;  2Q4F A;  1NFO A;  1M57 C;  1QVX A;  4LAC B;  1NSG B;  2B0H A;  4Q5S F;  3C62 A;  4CS8 C;  2P7V A;  2A68 F;  4MW3 A;  4JTD B;  3DJU B;  2XS1 A;  3K6B A;  4U5B E;  3U9M A;  4J7Y A;  1E2X A;  4M63 A;  1LE4 A;  5F5F A;  2R7T A;  2XXA B;  1A7E A;  2GAQ A;  4YL1 A;  3KYJ A;  1Z7Q c;  3US6 A;  3NKE A;  3B71 A;  3U5S A;  4IZD A;  3ASO C;  3FDQ A;  1Q0G A;  1LM3 B;  1RJ9 A;  3UGP A;  3AQB A;  2PBP A;  2VCA A;  5DVW A;  2XL4 A;  1PD0 A;  4E7Z A;  1FTS A;  3R7C A;  2KSF A;  2XM0 A;  2XLW A;  3C8Z A;  3SZR A;  1R4T A;  5A69 A;  1Q0D A;  4U9E A;  2H7B A;  3T9O A;  5DS6 A;  4GYT A;  4FAP B;  2KNH A;  4FWV A;  5BQG A;  3N0T A;  2EPL X;  4EKW A;  1TFK B;  2AU5 A;  2P1A A;  3GM3 A;  3EGX B;  4IZC A;  5FCL A;  5DS4 A;  2WB7 A;  2PFD A;  3IQC A;  1NZY A;  4I1M A;  1Q0F A;  1EA8 A;  4W8K A;  2AVK A;  3EZH A;  2YWA A;  4C3E A;  4BEJ A;  3ECS A;  3ZVR A;  2QE9 A;  4L6R A;  3DM5 A;  1WZ8 A;  1Q0K A;  1JOG A; 
#chains in the Genus database with same CATH homology
 3TUL A;  2JPU A;  3RQE A;  1UFB A;  3S9O A;  1V4A A;  1K04 A;  4GEH B;  3IRB A;  3L8J A;  3W8H B;  3C8G A;  4EBK A;  3A4N A;  4XEK A;  1UX4 A;  3BRJ A;  1WOL A;  1UX5 A;  1K40 A;  2KK1 A;  3RQG A;  2HSB A;  1KTM A;  3B71 A;  3GM1 A;  2LK4 A;  1KNY A;  3U3F A;  4EBJ A;  1WTY A;  3A4L A;  3C8G B;  3ADC A;  1ZZP A;  3O10 A;  1OW6 A;  3MFN A;  4NQF A;  1OW8 A;  3JZ0 A;  1K05 A;  3K7D A;  4NNQ A;  3AM1 A;  1WWP A;  3RQF A;  3C8G D;  3A4M A;  1RJM A;  3O4X E;  3GM3 A;  1Y64 B;  2L6H A;  3AJM A;  3U0C A;  2L6G A;  1O3U A;  5F28 E;  2JX0 A;  4XEV A;  1OW7 A;  2PBE A;  2P63 A;  3GM2 A;  1PV3 A;  2Q00 A;  3W8I B;  3C18 A;  4XEF A;  2YWA A;  3ADB A;  2L6F A;  4R32 A;  3ADD A;  3JYY A;  1QVX A;  1JOG A;  3L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...