3L8IA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8iA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8iA02
3C8GD 1OW6A 1K05A 3GM1A 3TULA 3RQEA 1WTYA 2JX0A 1WOLA 1ZZPA 4EBKA 1OW7A 3C8GA 2PBEA 2LK4A 3AJMA 2YWAA 4EBJA 3RQFA 2L6HA 3B71A 4GEHB 3RQGA 5F28E 3O10A 2Q00A 1K04A 1KNYA 1JOGA 1PV3A 3GM2A 2KK1A 4XEFA 3JZ0A 3BRJA 4XEKA 1O3UA 3U0CA 3C18A 3C8GB 3W8HB 1OW8A 1QVXA 4XEVA 3GM3A 3JYYA 4NQFA 1UFBA 3U3FA 1KTMA 3L8IA 4R32A 3MFNA 3L8JA 2L6GA 2L6FA 2HSBA 2JPUA 1WWPA 3K7DA 1V4AA 3S9OA 3W8IB 1K40A
chains in the Genus database with same CATH superfamily
4KNWA 5COFA 2Z15A 4LDRA 4AE4B 2LCHA 2R25A 5A6BD 4YT5A 2IOQA 2EPKX 2AWYA 4I3MA 2YLIA 1OW8A 5JBWA 4DOZA 1AUEA 3L8IA 3LEVA 1YARO 2YZSA 1FAPB 1LPEA 2C04A 3V5YA 1B68A 4XQ1A 5COMA 4ZLDA 4CDYA 2R7UA 2Q9BA 3NMJA 1S05A 5FCLA 4XLPF 3VAYA 3N0TA 3NKEA 3T89A 4JCSA 1T5OA 1NG1A 5FZTA 3QK8A 1NFOA 2VCCA 3SWXA 2NSGA 2KC3A 1O3UA 2ZXWC 3ADBA 2VCAA 4CJGA 3FAJA 1E85A 1G5ZA 3A4NA 3DJNB 4GQHA 3Q6NA 4MVUA 4PJLA 3EG9B 3A11A 3W2WA 1RXQA 1RMVA 3SXKA 2GWWA 3NKDA 2L9JA 2DYSC 3C8GB 1LVKA 3ITFA 2AU5A 3L8JA 2H7BA 3ZIBA 3U2LA 1VLTA 4FZWC 2VCBA 5K0IA 1NU9C 3Q6MA 1RCPA 3U3FA 2L7AA 2ICWG 2X51A 3QXZA 3AG1C 2ZXOA 1FTSA 4JC7A 3M15A 4N6HA 3AM1A 4KBLA 2BC5A 1R5ID 2MWQA 4FZWA 1U89A 3R9SA 4IAOA 1YA7O 1GS9A 3LS1A 1NZYB 5EHHA 3GM1A 5KJPA 2W4MA 4CS9C 2HFIA 3TRRA 2KJGA 5AC4A 1CGME 2WL8A 5DS6A 1TWCA 2NUPA 4C3DA 4MVZA 2P6VA 2XL6A 5DS5A 4YT8A 3TQOA 4OIRF 2JX0A 3MX3A 4O6MA 3J06A 2D4UA 1FFHA 2R03A 4LLEA 3MYFA 1NZEA 2Q00A 4HFKB 2IXNA 1Q0DA 4CS9A 3PHF2 3JSEO 4EIYA 2NSFA 3U5SA 2BL2A 4QDLA 3M4BA 4Q7CA 5C9GA 2HZ8A 4JTAB 4U5DE 2FAPB 1Z63A 4DBRA 3DI5A 2A0UA 3BRJA 1EF8A 3U0CA 3DXJF 3B0VC 1KTMA 3DE9A 3EZHA 5D91A 2YHSA 5A6AA 2XRHA 3DAFA 3RVYA 1FMWA 1NSGB 2B0HA 1EI7A 2EPMX 3RVZA 1G8XA 1VOMA 5E2QA 3SYNA 2QQ3A 1QSPA 1QLEC 4OIQF 3ADDA 3AG3C 2YQYA 5F5HA 2VREA 1HW2A 1U0BB 3QVZA 4WGZA 2M4EA 4I42A 1MQVA 4OIPF 3W8HA 4Z9JA 2V3CC 1K04A 1QKRA 3CEXA 5L0DA 2WVQA 1RKEA 5EK0A 1C03A 5B1BC 3T9OA 3FAPB 4RBNA 4P6IC 3U3BA 3HNKA 3JRMO 4E7SA 1LE4A 2MHRA 2R02A 4XLNF 3O10A 5L3QA 1LI7A 3KYIA 2OG2A 1ZHZA 2A69F 2LSEA 4B6IA 2PPYA 4U5EE 2EILC 1H6GA 4AE4A 4OLQA 1BR1A 3POVA 2IXPA 1Z7Qc 4Q5SF 3R7CA 5AC5A 5E33A 1YVIA 1LS1A 5F5FA 3TJ6A 4LACB 3OC7A 4I1MA 5JLIA 4G0HA 1I5NA 1WATA 4WCZA 4XEVA 4CSAC 2ETSA 1Y64B 2KW3C 5BQHA 4CDAA 2QNLA 1YJGA 4JZAA 1JXZA 1VB5A 1L7CA 3SXZA 4KC9A 3DE8A 4F47A 1M2OA 3HNJA 1EY3A 3UMIA 1PCXA 2P61A 3I5QA 1H7IA 3PCVA 3S27A 3EHMA 4IGGA 4PFPA 256BA 1ORJA 4CSAA 2ZPAA 3SXMA 2YWAA 4JFCA 4JYLA 4BG0A 4FJWD 5E3AA 2ZXPA 3ZTZA 3ZG1A 4U5BE 1YA9A 2EINC 3S28A 3RQEA 2J9WA 3QTHA 2Y3DA 1T6QA 4NC3A 4U18A 4G7ZF 3AOUA 3C8GA 3CAXA 1ZYRF 3S90A 3RF3A 1JPJA 3VF0A 2YLDA 3V5XA 3ABKC 2Q9AA 2L81A 3KH2A 4KNPA 3IEEA 2NUPB 3HNIA 4JCZA 2LP4A 4MQ9F 4G78A 3HLZA 1TFKB 1BZ4A 2V26A 1TWHA 4Q4ZF 4NTBA 2CNWA 3EGXA 2HW5A 3FDUA 1YYXA 2Q4FA 4U5FE 2HV6A 3HINA 2M64A 2VC9A 1UFBA 4U5CE 4R32A 2R7RA 1HY5A 4CDVA 1XZQA 1ZHWA 3RYLA 2XM0A 2GFHA 2OJQA 1OCZC 4GYTA 4DBQA 4YN0B 4K1OA 3JCUQ 1MMNA 5D92A 4M63A 3S0XA 2L6GA 3MYBA 3VM6A 4I52A 2R7QA 2J45A 1HE9A 2XLVA 2OQMA 3M1CB 3H02A 3A4LA 3KQFA 4U1AA 4K3WA 5A6BA 5A6KA 2IXOA 4WGYA 4XPYA 1AVOB 3Q0GA 2GDCA 2CNWD 1WTYA 2I8BA 2IEXA 3ZVRA 1EF9A 4EBJA 3RIPA 3W2VA 1IZMA 2OJED 4XPWA 1A7VA 3W8HB 4AL0A 1BR4A 4JOTA 1Q0KA 3T8AA 4PJJA 1EQ1A 5EGYA 1RKEB 1PD1A 2J7PD 2HV7A 1A0BA 3IHUA 3ZWIA 5B1AC 1T9KA 4MVSA 4N6CA 1ZHXA 4N4WA 3LAYA 3S29A 3IQ5A 1OQCA 4E7ZA 4ULWA 3CZ6A 4EBKA 3B71A 4DRHB 1MNDA 4XEFA 2XLOA 1NLXA 5BQGA 3HRXA 4J7YA 2DB4A 5CIVA 3TOLA 4BJ1A 5JBXA 3ADCA 1UG7A 2LFDA 2WB7A 1HZDA 4XWJA 1ST6A 4NTFA 4E0IA 2HMZA 3FDQA 1S7ZA 1WZ8A 2YL7A 3BEHA 2R05A 2PX3A 1D1CA 1NFNA 3C63A 1SF8A 5HV9A 2YL3A 1ZZPA 4C3EA 2YRFA 4LERA 3R9TA 3UGPA 1LE2A 5HSWA 5JVEA 3GORA 3SNHA 3L34A 2J9BA 3G4XA 2H7VC 2UUIA 2J9VA 3RFYA 2PF4E 1OW6A 2PBPA 2ZXRA 1D0YA 1ZW3A 2CDQA 2DYRC 4MS2A 4J30B 4OINF 1VTMP 4DVZA 1FFTC 2QTVA 2AP3A 4EHPA 3KL4A 3VYWA 4EWCA 3EGXB 3L1MA 1DOVA 2HMQA 3S9OA 1DUBA 4JEBA 2GAQA 5B3SC 2YEVA 2O9XA 4LDKA 3K7DA 2I15A 3A4MA 2HS5A 2WVNA 4ELSA 3ASOC 2R7OA 2CGEA 4BPMA 2R7VA 4IARA 3OWTA 2OKUA 2H8AA 2HSQA 3WODF 4FWVA 2DGJA 2HSBA 2P0NA 2HUJA 2OCCC 4JJFA 2B0JA 1Z23A 4HEAJ 2AVKA 1YDIA 4IB4A 1M56C 2C03A 2XS8A 1Q52A 2J0XA 3G64A 3IQ6A 1A41A 3B29A 3P5MA 1I4YA 3GEEA 4YJWA 2XS1A 1LI5A 3PZKA 3MOYA 2KNHA 3AQBA 1M57C 3GEIA 3L0IA 1N1CA 4YWQA 3DKAA 2LQGA 3EZIA 2EJ5A 2DUBA 5A69A 4C3BA 2Q3TA 1ZHYA 1RJNA 3R0OA 4IJJA 2KK1A 3TOMA 2AWCA 3M79A 1GM5A 4JE9A 2ZQRA 3DMDA 2VB6A 3LS0A 4JJGA 4CIPA 2XL4A 1H9GA 3ABLC 1DOWA 1QPUA 4OG1A 4N06A 3ASNC 4W8PA 3DD7A 4AL1A 2PX0A 1JR8A 2Y3GA 3TK0A 4ONSA 4MTFA 1LS4A 2E87A 2YL0A 3ZQVA 3E9VA 2Y3HA 3MFNA 1QQ3A 4H54A 1K40A 3FOOA 1V55C 2J9UA 3AGUA 4LLCA 4E17A 4QI0A 2XLWA 3GM2A 4F4BA 2MYSA 4XEKA 4U5GA 1XZPA 3C18A 2XLMA 3ECSA 4ZU2A 1G4US 5L0IA 4BJ5C 3KKBA 4U9EA 4JEAA 4EUKB 2FBMA 1EKYA 3LNRA 1OXKA 2P7VA 2XXAA 4HE8D 1V74B 4K2NA 3QW1A 3W4YA 3NYMA 1TWGA 3JYYA 3K33A 3CSKA 1CGNA 2XLEA 5E3CA 2UUHA 4Z9HA 4BJ5A 5KYUA 2W4BA 3G50A 5DS4A 3I5PA 4H4KC 5BUOA 4WJ0A 2ASRA 4OD4A 2GTRA 3KMIA 1LKXA 2WZGA 4MNDA 4YL3A 3EGDA 3HJCA 4ULVA 3T6GB 1VLSA 1OW7A 1OCCC 2LD6A 2KGOA 3TLFA 3K1HA 4ELXA 2CW0F 3DM9B 3LNMB 3NMKA 3F47A 1IW7F 4IZBA 5JT4A 5A6JA 1J8YF 3NRHA 3T4RA 3FHDA 4W8KA 4NTAA 1OR3A 2RD9A 1KNYA 4BEJA 1JMWA 4JWVA 3G4ZA 2OU6A 2F22A 3JRTA 3UR3C 5L0CA 2A6EF 4X0RA 3SZRA 4PFOA 4YL1A 2J7PA 2A6HF 1Z5ZA 3KYJA 3GODA 3RQGA 1BBHA 5GPGB 4KNVA 3W8IA 4K7BA 4D4XA 5KYYB 4MVQA 4FX5A 5JP7A 2HKVA 1ZVZA 4YT2A 3EH2A 1OKKD 4QIIA 2Q7RA 3I47A 4MVOA 4U19A 3DM5A 2QE9A 2EIMC 2KQ9A 2DI3A 1MMGA 2L6FA 2JPUA 2ZD9A 1J8MF 4JCHA 5L0HA 4MW3A 2YKZA 3EJNA 3MLGA 1RJ9A 2J8WA 1E2XA 1BDJB 3B0UX 1ZHTA 3T88A 4QI2A 2PFDA 1Q0FA 3I4UA 4MTGA 2YLGA 3JYHA 2LFFA 1D0XA 3H2UA 1T01A 5JUAA 3V5ZA 4MOUA 1FMVA 4EKWA 3AGTA 1MNEA 3T6JA 3FOPA 3NMIA 4DRIB 3UNGC 3SP1A 4MI2A 1E83A 4NCQA 4O6YA 1Q0GA 4PK4A 3EHNA 3DWWA 4O79A 3U9JA 2RSEB 3IQCA 4P9FA 3LLKA 4DXWA 1H9TA 1LIHA 1AEPA 3HNLA 2IYLD 3LJBA 3UMKA 1WWPA 1PD0A 1V4AA 4MTOA 4AK9A 1Q51A 3SXYA 1L3PA 2G3KA 4O7GA 3T6BA 4CJOA 3EH1A 2R7TA 5JSLA 2H7OA 2NPUA 3X1OA 3AJMA 1M2VA 5JS5A 1JOGA 5KYWA 4CS7A 2Y3BA 1D1AA 4IAQA 3M4CA 2Y69C 3JSZA 1DCIA 4YK5A 1C02A 2IBFA 2XXAB 1WGWA 5T3WA 1GQAA 4A4AA 4CX9A 1D0ZA 5IY5C 2VX2A 1EA8A 5T3TA 1VMAA 4EMLA 4E0HA 5KYUB 4NNQA 1ORYA 4C7OA 3NG1A 3KPHA 4YL0A 2R7WA 2OEXA 2G62A 3U8PA 2W45A 1K05A 3EFOA 1XWJA 2OEVA 3ZSUA 2PBEA 3A9CA 1YZAA 3LLIA 2L6HA 2FGYA 4WABA 3EGDB 4P9TA 4YT4A 1G4WR 1PV3A 1T6UA 2EPOA 2XM4A 2PNOA 5CI9A 1Z6AA 1LM3B 3JT1A 3GWLA 3TJ5A 1MMAA 4IZDA 3ZQYA 1UIYA 2A68F 2OOCA 2D5RB 4DRJB 4KI2A 4MVMA 1JRAA 3HKKA 4JTDB 4I1OB 4XPXA 2EIKC 2NUTB 3ABMC 2J46A 4CBEA 1QZXA 3U9MA 3NDBB 2X0CA 3UMHA 5AGFA 3B9QA 4IRUA 2QY9A 3Q7LA 3TD7A 4Z9IA 3W8IB 5KYXA 3PDMP 1OR2A 2GA0A 4I4ZA 2LIGA 3ZDLA 3QVYA 1Q0MA 2UZFA 3U8VA 2R7SA 4DVYP 3WAQA 2Q9CA 3AG4C 4BJ6C 3RH3A 4RDAA 4DJ9A 4L6RA 3O4XE 3C7JA 3Q7GA 3NYLA 2WZFA 4FAPB 2P1AA 3HTKC 3GM3A 2YVKA 3AQCA 2CYDA 4RD9A 2F6QA 2QUPA 4G7HF 1UX4A 3OA1A 1RJ9B 1Y4CA 3US6A 4BJ6A 1TKNA 5KYYA 3B0PA 3DAGA 4FESA 5L0FA 4JIOA 2QLAA 3H2VA 4GEHA 3U2MA 2HJMA 5DQTA 1UX5A 3LEOA 3ZTMA 3N2ZB 3E70C 5CI8A 3FXHA 3MBGA 4U9DA 3V7OA 3IQTA 3IPMO 3F46A 1O5HA 3RQFA 5L0GA 5BQIA 1YAUO 1VK5A 3VRCA 3LUTB 1M2VB 1ZW2A 2CCYA 1VYKA 5KYWB 5TJ5E 1SMYF 1W2WA 1TFOB 2FW2A 2LK4A 3SEOA 3AG2C 3WHNA 4ZLCA 1Y6DA 1APCA 4NQFA 3K1IC 3ATPA 2XLHA 2EPNA 3RKOF 1JAFA 3QMKA 1NU7D 3X2QC 4G7OF 4C7OB 1SZIA 1TR2A 1T6IA 1HMOA 3JTLO 3EFOB 2VASA 4EBBA 1Z3IX 1F1MA 1QVXA 1FNTc 2WZLA 4BEMJ 3RW0A 3H65A 1HMDA 2KYHA 2PP4A 3TULA 3K1IA 3K6BA 3C8ZA 2IM8A 3DZAA 2VH3A 1YZCA 1FR0A 1BR2A 1NBBA 1MMDA 1SYQA 2XLDA 1OCOC 2XL8A 3CQZA 1OCRC 1KU2A 4NY3A 1D1BA 2NG1A 1CPRA 2BE5F 3S84A 2EIJC 2HJ3A 1A7EA 2WVOA 3H81A 4U5HA 2R7XA 1JPNA 1HW1A 1U6HA 3QZCA 5JRAA 4OD5A 1VYIA 5KYXB 1OKKA 3K66A 4JRZA 3QW0A 5DVWA 3NYJA 4D4NA 3EG9A 3QXIA 4J32B 4IZCA 1M6TA 4UDVA 1MJ3A 4MW8A 2EPLX 4JVSA 3MYIA 3O55A 5T1DB 4QIJA 4IWBA 3RSIA 1WASA 3FMSA 4ANJA 3GANA 4PACA 4OIOF 2NUTA 1I4ZA 5L0JA 1A7DA 1TWAA 3SLLA 2W9YA 4CS8C 4I44A 1WOLA 3LESA 1SR2A 2IXMA 1RKCA 3GEHA 3WG7C 3FVYA 4MVRA 4JKVA 3Q1TA 5DQZA 2A1DD 1O87A 1RJMA 1TQGA 2J0WA 2YL1A 4GEHB 1V54C 1ZU4A 3Q0JA 1CGOA 2Y39A 3ZC4A 4CS8A 1ZU5A 2P63A 1NZYA 4LDQA 2XSEA 1ORSC 4ELWA 3PMRA 5L3VA 1GGQA 3UGOA 1WN0A 4J7TA 3R2PA 3C8GD 2KSFA 1YLMA 4NEKA 5DLJA 2A0BA 1R4TA 4JURI 4K0DA 3O6XA 2ZQQA 1E84A 3EPVA 3OEOA 1C17M 4PJNA 1OXBA 2G3VA 4BJTA 3GWNA 4JW1A 4PJMA 2R9RB 3C62A 2JD3A 1YYJA 3DJUB 4PR9A 4E18A 5B3IA 3O39A 2TMVP 4CIHA 5KYNA 5F28E 4AX2A 1HE1A 4A2NB 3IRBA 3N24A 3JZ0A 4XTKA 5COGA 4HFFB 2FFHA 4ER9A 1E86A 4JTCB 3EQLF 4O6NA 1CPQA
chains in the Genus database with same CATH topology
1RJMA 1OW6A 1OW7A 3RQFA 4GEHB 3BRJA 2P63A 3U0CA 1OW8A 4XEVA 1Y64B 1UFBA 3U3FA 1KTMA 3L8IA 4NNQA 4R32A 3MFNA 1K40A 3C8GD 1K05A 3O4XE 4EBKA 3AM1A 2PBEA 2LK4A 3B71A 2L6HA 1KNYA 3GM2A 1PV3A 4XEFA 4XEKA 3C18A 3ADDA 3GM3A 4NQFA 2L6GA 1UX4A 3S9OA 3ADCA 3GM1A 2YWAA 3RQGA 1K04A 3A4LA 2KK1A 1O3UA 1QVXA 3JYYA 3ADBA 1WWPA 3K7DA 3A4NA 1V4AA 1UX5A 3TULA 3A4MA 3RQEA 1WTYA 2JX0A 1WOLA 1ZZPA 3C8GA 3AJMA 4EBJA 5F28E 3O10A 2Q00A 3IRBA 1JOGA 3JZ0A 3C8GB 3W8HB 3L8JA 2L6FA 2HSBA 2JPUA 3W8IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G D;  1OW6 A;  1K05 A;  3GM1 A;  3TUL A;  3RQE A;  1WTY A;  2JX0 A;  1WOL A;  1ZZP A;  4EBK A;  1OW7 A;  3C8G A;  2PBE A;  2LK4 A;  3AJM A;  2YWA A;  4EBJ A;  3RQF A;  2L6H A;  3B71 A;  4GEH B;  3RQG A;  5F28 E;  3O10 A;  2Q00 A;  1K04 A;  1KNY A;  1JOG A;  1PV3 A;  3GM2 A;  2KK1 A;  4XEF A;  3JZ0 A;  3BRJ A;  4XEK A;  1O3U A;  3U0C A;  3C18 A;  3C8G B;  3W8H B;  1OW8 A;  1QVX A;  4XEV A;  3GM3 A;  3JYY A;  4NQF A;  1UFB A;  3U3F A;  1KTM A;  3L8I A;  4R32 A;  3MFN A;  3L8J A;  2L6G A;  2L6F A;  2HSB A;  2JPU A;  1WWP A;  3K7D A;  1V4A A;  3S9O A;  3W8I B;  1K40 A; 
#chains in the Genus database with same CATH topology
 4KNW A;  5COF A;  2Z15 A;  4LDR A;  4AE4 B;  2LCH A;  2R25 A;  5A6B D;  4YT5 A;  2IOQ A;  2EPK X;  2AWY A;  4I3M A;  2YLI A;  1OW8 A;  5JBW A;  4DOZ A;  1AUE A;  3L8I A;  3LEV A;  1YAR O;  2YZS A;  1FAP B;  1LPE A;  2C04 A;  3V5Y A;  1B68 A;  4XQ1 A;  5COM A;  4ZLD A;  4CDY A;  2R7U A;  2Q9B A;  3NMJ A;  1S05 A;  5FCL A;  4XLP F;  3VAY A;  3N0T A;  3NKE A;  3T89 A;  4JCS A;  1T5O A;  1NG1 A;  5FZT A;  3QK8 A;  1NFO A;  2VCC A;  3SWX A;  2NSG A;  2KC3 A;  1O3U A;  2ZXW C;  3ADB A;  2VCA A;  4CJG A;  3FAJ A;  1E85 A;  1G5Z A;  3A4N A;  3DJN B;  4GQH A;  3Q6N A;  4MVU A;  4PJL A;  3EG9 B;  3A11 A;  3W2W A;  1RXQ A;  1RMV A;  3SXK A;  2GWW A;  3NKD A;  2L9J A;  2DYS C;  3C8G B;  1LVK A;  3ITF A;  2AU5 A;  3L8J A;  2H7B A;  3ZIB A;  3U2L A;  1VLT A;  4FZW C;  2VCB A;  5K0I A;  1NU9 C;  3Q6M A;  1RCP A;  3U3F A;  2L7A A;  2ICW G;  2X51 A;  3QXZ A;  3AG1 C;  2ZXO A;  1FTS A;  4JC7 A;  3M15 A;  4N6H A;  3AM1 A;  4KBL A;  2BC5 A;  1R5I D;  2MWQ A;  4FZW A;  1U89 A;  3R9S A;  4IAO A;  1YA7 O;  1GS9 A;  3LS1 A;  1NZY B;  5EHH A;  3GM1 A;  5KJP A;  2W4M A;  4CS9 C;  2HFI A;  3TRR A;  2KJG A;  5AC4 A;  1CGM E;  2WL8 A;  5DS6 A;  1TWC A;  2NUP A;  4C3D A;  4MVZ A;  2P6V A;  2XL6 A;  5DS5 A;  4YT8 A;  3TQO A;  4OIR F;  2JX0 A;  3MX3 A;  4O6M A;  3J06 A;  2D4U A;  1FFH A;  2R03 A;  4LLE A;  3MYF A;  1NZE A;  2Q00 A;  4HFK B;  2IXN A;  1Q0D A;  4CS9 A;  3PHF 2;  3JSE O;  4EIY A;  2NSF A;  3U5S A;  2BL2 A;  4QDL A;  3M4B A;  4Q7C A;  5C9G A;  2HZ8 A;  4JTA B;  4U5D E;  2FAP B;  1Z63 A;  4DBR A;  3DI5 A;  2A0U A;  3BRJ A;  1EF8 A;  3U0C A;  3DXJ F;  3B0V C;  1KTM A;  3DE9 A;  3EZH A;  5D91 A;  2YHS A;  5A6A A;  2XRH A;  3DAF A;  3RVY A;  1FMW A;  1NSG B;  2B0H A;  1EI7 A;  2EPM X;  3RVZ A;  1G8X A;  1VOM A;  5E2Q A;  3SYN A;  2QQ3 A;  1QSP A;  1QLE C;  4OIQ F;  3ADD A;  3AG3 C;  2YQY A;  5F5H A;  2VRE A;  1HW2 A;  1U0B B;  3QVZ A;  4WGZ A;  2M4E A;  4I42 A;  1MQV A;  4OIP F;  3W8H A;  4Z9J A;  2V3C C;  1K04 A;  1QKR A;  3CEX A;  5L0D A;  2WVQ A;  1RKE A;  5EK0 A;  1C03 A;  5B1B C;  3T9O A;  3FAP B;  4RBN A;  4P6I C;  3U3B A;  3HNK A;  3JRM O;  4E7S A;  1LE4 A;  2MHR A;  2R02 A;  4XLN F;  3O10 A;  5L3Q A;  1LI7 A;  3KYI A;  2OG2 A;  1ZHZ A;  2A69 F;  2LSE A;  4B6I A;  2PPY A;  4U5E E;  2EIL C;  1H6G A;  4AE4 A;  4OLQ A;  1BR1 A;  3POV A;  2IXP A;  1Z7Q c;  4Q5S F;  3R7C A;  5AC5 A;  5E33 A;  1YVI A;  1LS1 A;  5F5F A;  3TJ6 A;  4LAC B;  3OC7 A;  4I1M A;  5JLI A;  4G0H A;  1I5N A;  1WAT A;  4WCZ A;  4XEV A;  4CSA C;  2ETS A;  1Y64 B;  2KW3 C;  5BQH A;  4CDA A;  2QNL A;  1YJG A;  4JZA A;  1JXZ A;  1VB5 A;  1L7C A;  3SXZ A;  4KC9 A;  3DE8 A;  4F47 A;  1M2O A;  3HNJ A;  1EY3 A;  3UMI A;  1PCX A;  2P61 A;  3I5Q A;  1H7I A;  3PCV A;  3S27 A;  3EHM A;  4IGG A;  4PFP A;  256B A;  1ORJ A;  4CSA A;  2ZPA A;  3SXM A;  2YWA A;  4JFC A;  4JYL A;  4BG0 A;  4FJW D;  5E3A A;  2ZXP A;  3ZTZ A;  3ZG1 A;  4U5B E;  1YA9 A;  2EIN C;  3S28 A;  3RQE A;  2J9W A;  3QTH A;  2Y3D A;  1T6Q A;  4NC3 A;  4U18 A;  4G7Z F;  3AOU A;  3C8G A;  3CAX A;  1ZYR F;  3S90 A;  3RF3 A;  1JPJ A;  3VF0 A;  2YLD A;  3V5X A;  3ABK C;  2Q9A A;  2L81 A;  3KH2 A;  4KNP A;  3IEE A;  2NUP B;  3HNI A;  4JCZ A;  2LP4 A;  4MQ9 F;  4G78 A;  3HLZ A;  1TFK B;  1BZ4 A;  2V26 A;  1TWH A;  4Q4Z F;  4NTB A;  2CNW A;  3EGX A;  2HW5 A;  3FDU A;  1YYX A;  2Q4F A;  4U5F E;  2HV6 A;  3HIN A;  2M64 A;  2VC9 A;  1UFB A;  4U5C E;  4R32 A;  2R7R A;  1HY5 A;  4CDV A;  1XZQ A;  1ZHW A;  3RYL A;  2XM0 A;  2GFH A;  2OJQ A;  1OCZ C;  4GYT A;  4DBQ A;  4YN0 B;  4K1O A;  3JCU Q;  1MMN A;  5D92 A;  4M63 A;  3S0X A;  2L6G A;  3MYB A;  3VM6 A;  4I52 A;  2R7Q A;  2J45 A;  1HE9 A;  2XLV A;  2OQM A;  3M1C B;  3H02 A;  3A4L A;  3KQF A;  4U1A A;  4K3W A;  5A6B A;  5A6K A;  2IXO A;  4WGY A;  4XPY A;  1AVO B;  3Q0G A;  2GDC A;  2CNW D;  1WTY A;  2I8B A;  2IEX A;  3ZVR A;  1EF9 A;  4EBJ A;  3RIP A;  3W2V A;  1IZM A;  2OJE D;  4XPW A;  1A7V A;  3W8H B;  4AL0 A;  1BR4 A;  4JOT A;  1Q0K A;  3T8A A;  4PJJ A;  1EQ1 A;  5EGY A;  1RKE B;  1PD1 A;  2J7P D;  2HV7 A;  1A0B A;  3IHU A;  3ZWI A;  5B1A C;  1T9K A;  4MVS A;  4N6C A;  1ZHX A;  4N4W A;  3LAY A;  3S29 A;  3IQ5 A;  1OQC A;  4E7Z A;  4ULW A;  3CZ6 A;  4EBK A;  3B71 A;  4DRH B;  1MND A;  4XEF A;  2XLO A;  1NLX A;  5BQG A;  3HRX A;  4J7Y A;  2DB4 A;  5CIV A;  3TOL A;  4BJ1 A;  5JBX A;  3ADC A;  1UG7 A;  2LFD A;  2WB7 A;  1HZD A;  4XWJ A;  1ST6 A;  4NTF A;  4E0I A;  2HMZ A;  3FDQ A;  1S7Z A;  1WZ8 A;  2YL7 A;  3BEH A;  2R05 A;  2PX3 A;  1D1C A;  1NFN A;  3C63 A;  1SF8 A;  5HV9 A;  2YL3 A;  1ZZP A;  4C3E A;  2YRF A;  4LER A;  3R9T A;  3UGP A;  1LE2 A;  5HSW A;  5JVE A;  3GOR A;  3SNH A;  3L34 A;  2J9B A;  3G4X A;  2H7V C;  2UUI A;  2J9V A;  3RFY A;  2PF4 E;  1OW6 A;  2PBP A;  2ZXR A;  1D0Y A;  1ZW3 A;  2CDQ A;  2DYR C;  4MS2 A;  4J30 B;  4OIN F;  1VTM P;  4DVZ A;  1FFT C;  2QTV A;  2AP3 A;  4EHP A;  3KL4 A;  3VYW A;  4EWC A;  3EGX B;  3L1M A;  1DOV A;  2HMQ A;  3S9O A;  1DUB A;  4JEB A;  2GAQ A;  5B3S C;  2YEV A;  2O9X A;  4LDK A;  3K7D A;  2I15 A;  3A4M A;  2HS5 A;  2WVN A;  4ELS A;  3ASO C;  2R7O A;  2CGE A;  4BPM A;  2R7V A;  4IAR A;  3OWT A;  2OKU A;  2H8A A;  2HSQ A;  3WOD F;  4FWV A;  2DGJ A;  2HSB A;  2P0N A;  2HUJ A;  2OCC C;  4JJF A;  2B0J A;  1Z23 A;  4HEA J;  2AVK A;  1YDI A;  4IB4 A;  1M56 C;  2C03 A;  2XS8 A;  1Q52 A;  2J0X A;  3G64 A;  3IQ6 A;  1A41 A;  3B29 A;  3P5M A;  1I4Y A;  3GEE A;  4YJW A;  2XS1 A;  1LI5 A;  3PZK A;  3MOY A;  2KNH A;  3AQB A;  1M57 C;  3GEI A;  3L0I A;  1N1C A;  4YWQ A;  3DKA A;  2LQG A;  3EZI A;  2EJ5 A;  2DUB A;  5A69 A;  4C3B A;  2Q3T A;  1ZHY A;  1RJN A;  3R0O A;  4IJJ A;  2KK1 A;  3TOM A;  2AWC A;  3M79 A;  1GM5 A;  4JE9 A;  2ZQR A;  3DMD A;  2VB6 A;  3LS0 A;  4JJG A;  4CIP A;  2XL4 A;  1H9G A;  3ABL C;  1DOW A;  1QPU A;  4OG1 A;  4N06 A;  3ASN C;  4W8P A;  3DD7 A;  4AL1 A;  2PX0 A;  1JR8 A;  2Y3G A;  3TK0 A;  4ONS A;  4MTF A;  1LS4 A;  2E87 A;  2YL0 A;  3ZQV A;  3E9V A;  2Y3H A;  3MFN A;  1QQ3 A;  4H54 A;  1K40 A;  3FOO A;  1V55 C;  2J9U A;  3AGU A;  4LLC A;  4E17 A;  4QI0 A;  2XLW A;  3GM2 A;  4F4B A;  2MYS A;  4XEK A;  4U5G A;  1XZP A;  3C18 A;  2XLM A;  3ECS A;  4ZU2 A;  1G4U S;  5L0I A;  4BJ5 C;  3KKB A;  4U9E A;  4JEA A;  4EUK B;  2FBM A;  1EKY A;  3LNR A;  1OXK A;  2P7V A;  2XXA A;  4HE8 D;  1V74 B;  4K2N A;  3QW1 A;  3W4Y A;  3NYM A;  1TWG A;  3JYY A;  3K33 A;  3CSK A;  1CGN A;  2XLE A;  5E3C A;  2UUH A;  4Z9H A;  4BJ5 A;  5KYU A;  2W4B A;  3G50 A;  5DS4 A;  3I5P A;  4H4K C;  5BUO A;  4WJ0 A;  2ASR A;  4OD4 A;  2GTR A;  3KMI A;  1LKX A;  2WZG A;  4MND A;  4YL3 A;  3EGD A;  3HJC A;  4ULV A;  3T6G B;  1VLS A;  1OW7 A;  1OCC C;  2LD6 A;  2KGO A;  3TLF A;  3K1H A;  4ELX A;  2CW0 F;  3DM9 B;  3LNM B;  3NMK A;  3F47 A;  1IW7 F;  4IZB A;  5JT4 A;  5A6J A;  1J8Y F;  3NRH A;  3T4R A;  3FHD A;  4W8K A;  4NTA A;  1OR3 A;  2RD9 A;  1KNY A;  4BEJ A;  1JMW A;  4JWV A;  3G4Z A;  2OU6 A;  2F22 A;  3JRT A;  3UR3 C;  5L0C A;  2A6E F;  4X0R A;  3SZR A;  4PFO A;  4YL1 A;  2J7P A;  2A6H F;  1Z5Z A;  3KYJ A;  3GOD A;  3RQG A;  1BBH A;  5GPG B;  4KNV A;  3W8I A;  4K7B A;  4D4X A;  5KYY B;  4MVQ A;  4FX5 A;  5JP7 A;  2HKV A;  1ZVZ A;  4YT2 A;  3EH2 A;  1OKK D;  4QII A;  2Q7R A;  3I47 A;  4MVO A;  4U19 A;  3DM5 A;  2QE9 A;  2EIM C;  2KQ9 A;  2DI3 A;  1MMG A;  2L6F A;  2JPU A;  2ZD9 A;  1J8M F;  4JCH A;  5L0H A;  4MW3 A;  2YKZ A;  3EJN A;  3MLG A;  1RJ9 A;  2J8W A;  1E2X A;  1BDJ B;  3B0U X;  1ZHT A;  3T88 A;  4QI2 A;  2PFD A;  1Q0F A;  3I4U A;  4MTG A;  2YLG A;  3JYH A;  2LFF A;  1D0X A;  3H2U A;  1T01 A;  5JUA A;  3V5Z A;  4MOU A;  1FMV A;  4EKW A;  3AGT A;  1MNE A;  3T6J A;  3FOP A;  3NMI A;  4DRI B;  3UNG C;  3SP1 A;  4MI2 A;  1E83 A;  4NCQ A;  4O6Y A;  1Q0G A;  4PK4 A;  3EHN A;  3DWW A;  4O79 A;  3U9J A;  2RSE B;  3IQC A;  4P9F A;  3LLK A;  4DXW A;  1H9T A;  1LIH A;  1AEP A;  3HNL A;  2IYL D;  3LJB A;  3UMK A;  1WWP A;  1PD0 A;  1V4A A;  4MTO A;  4AK9 A;  1Q51 A;  3SXY A;  1L3P A;  2G3K A;  4O7G A;  3T6B A;  4CJO A;  3EH1 A;  2R7T A;  5JSL A;  2H7O A;  2NPU A;  3X1O A;  3AJM A;  1M2V A;  5JS5 A;  1JOG A;  5KYW A;  4CS7 A;  2Y3B A;  1D1A A;  4IAQ A;  3M4C A;  2Y69 C;  3JSZ A;  1DCI A;  4YK5 A;  1C02 A;  2IBF A;  2XXA B;  1WGW A;  5T3W A;  1GQA A;  4A4A A;  4CX9 A;  1D0Z A;  5IY5 C;  2VX2 A;  1EA8 A;  5T3T A;  1VMA A;  4EML A;  4E0H A;  5KYU B;  4NNQ A;  1ORY A;  4C7O A;  3NG1 A;  3KPH A;  4YL0 A;  2R7W A;  2OEX A;  2G62 A;  3U8P A;  2W45 A;  1K05 A;  3EFO A;  1XWJ A;  2OEV A;  3ZSU A;  2PBE A;  3A9C A;  1YZA A;  3LLI A;  2L6H A;  2FGY A;  4WAB A;  3EGD B;  4P9T A;  4YT4 A;  1G4W R;  1PV3 A;  1T6U A;  2EPO A;  2XM4 A;  2PNO A;  5CI9 A;  1Z6A A;  1LM3 B;  3JT1 A;  3GWL A;  3TJ5 A;  1MMA A;  4IZD A;  3ZQY A;  1UIY A;  2A68 F;  2OOC A;  2D5R B;  4DRJ B;  4KI2 A;  4MVM A;  1JRA A;  3HKK A;  4JTD B;  4I1O B;  4XPX A;  2EIK C;  2NUT B;  3ABM C;  2J46 A;  4CBE A;  1QZX A;  3U9M A;  3NDB B;  2X0C A;  3UMH A;  5AGF A;  3B9Q A;  4IRU A;  2QY9 A;  3Q7L A;  3TD7 A;  4Z9I A;  3W8I B;  5KYX A;  3PDM P;  1OR2 A;  2GA0 A;  4I4Z A;  2LIG A;  3ZDL A;  3QVY A;  1Q0M A;  2UZF A;  3U8V A;  2R7S A;  4DVY P;  3WAQ A;  2Q9C A;  3AG4 C;  4BJ6 C;  3RH3 A;  4RDA A;  4DJ9 A;  4L6R A;  3O4X E;  3C7J A;  3Q7G A;  3NYL A;  2WZF A;  4FAP B;  2P1A A;  3HTK C;  3GM3 A;  2YVK A;  3AQC A;  2CYD A;  4RD9 A;  2F6Q A;  2QUP A;  4G7H F;  1UX4 A;  3OA1 A;  1RJ9 B;  1Y4C A;  3US6 A;  4BJ6 A;  1TKN A;  5KYY A;  3B0P A;  3DAG A;  4FES A;  5L0F A;  4JIO A;  2QLA A;  3H2V A;  4GEH A;  3U2M A;  2HJM A;  5DQT A;  1UX5 A;  3LEO A;  3ZTM A;  3N2Z B;  3E70 C;  5CI8 A;  3FXH A;  3MBG A;  4U9D A;  3V7O A;  3IQT A;  3IPM O;  3F46 A;  1O5H A;  3RQF A;  5L0G A;  5BQI A;  1YAU O;  1VK5 A;  3VRC A;  3LUT B;  1M2V B;  1ZW2 A;  2CCY A;  1VYK A;  5KYW B;  5TJ5 E;  1SMY F;  1W2W A;  1TFO B;  2FW2 A;  2LK4 A;  3SEO A;  3AG2 C;  3WHN A;  4ZLC A;  1Y6D A;  1APC A;  4NQF A;  3K1I C;  3ATP A;  2XLH A;  2EPN A;  3RKO F;  1JAF A;  3QMK A;  1NU7 D;  3X2Q C;  4G7O F;  4C7O B;  1SZI A;  1TR2 A;  1T6I A;  1HMO A;  3JTL O;  3EFO B;  2VAS A;  4EBB A;  1Z3I X;  1F1M A;  1QVX A;  1FNT c;  2WZL A;  4BEM J;  3RW0 A;  3H65 A;  1HMD A;  2KYH A;  2PP4 A;  3TUL A;  3K1I A;  3K6B A;  3C8Z A;  2IM8 A;  3DZA A;  2VH3 A;  1YZC A;  1FR0 A;  1BR2 A;  1NBB A;  1MMD A;  1SYQ A;  2XLD A;  1OCO C;  2XL8 A;  3CQZ A;  1OCR C;  1KU2 A;  4NY3 A;  1D1B A;  2NG1 A;  1CPR A;  2BE5 F;  3S84 A;  2EIJ C;  2HJ3 A;  1A7E A;  2WVO A;  3H81 A;  4U5H A;  2R7X A;  1JPN A;  1HW1 A;  1U6H A;  3QZC A;  5JRA A;  4OD5 A;  1VYI A;  5KYX B;  1OKK A;  3K66 A;  4JRZ A;  3QW0 A;  5DVW A;  3NYJ A;  4D4N A;  3EG9 A;  3QXI A;  4J32 B;  4IZC A;  1M6T A;  4UDV A;  1MJ3 A;  4MW8 A;  2EPL X;  4JVS A;  3MYI A;  3O55 A;  5T1D B;  4QIJ A;  4IWB A;  3RSI A;  1WAS A;  3FMS A;  4ANJ A;  3GAN A;  4PAC A;  4OIO F;  2NUT A;  1I4Z A;  5L0J A;  1A7D A;  1TWA A;  3SLL A;  2W9Y A;  4CS8 C;  4I44 A;  1WOL A;  3LES A;  1SR2 A;  2IXM A;  1RKC A;  3GEH A;  3WG7 C;  3FVY A;  4MVR A;  4JKV A;  3Q1T A;  5DQZ A;  2A1D D;  1O87 A;  1RJM A;  1TQG A;  2J0W A;  2YL1 A;  4GEH B;  1V54 C;  1ZU4 A;  3Q0J A;  1CGO A;  2Y39 A;  3ZC4 A;  4CS8 A;  1ZU5 A;  2P63 A;  1NZY A;  4LDQ A;  2XSE A;  1ORS C;  4ELW A;  3PMR A;  5L3V A;  1GGQ A;  3UGO A;  1WN0 A;  4J7T A;  3R2P A;  3C8G D;  2KSF A;  1YLM A;  4NEK A;  5DLJ A;  2A0B A;  1R4T A;  4JUR I;  4K0D A;  3O6X A;  2ZQQ A;  1E84 A;  3EPV A;  3OEO A;  1C17 M;  4PJN A;  1OXB A;  2G3V A;  4BJT A;  3GWN A;  4JW1 A;  4PJM A;  2R9R B;  3C62 A;  2JD3 A;  1YYJ A;  3DJU B;  4PR9 A;  4E18 A;  5B3I A;  3O39 A;  2TMV P;  4CIH A;  5KYN A;  5F28 E;  4AX2 A;  1HE1 A;  4A2N B;  3IRB A;  3N24 A;  3JZ0 A;  4XTK A;  5COG A;  4HFF B;  2FFH A;  4ER9 A;  1E86 A;  4JTC B;  3EQL F;  4O6N A;  1CPQ A; 
#chains in the Genus database with same CATH homology
 1RJM A;  1OW6 A;  1OW7 A;  3RQF A;  4GEH B;  3BRJ A;  2P63 A;  3U0C A;  1OW8 A;  4XEV A;  1Y64 B;  1UFB A;  3U3F A;  1KTM A;  3L8I A;  4NNQ A;  4R32 A;  3MFN A;  1K40 A;  3C8G D;  1K05 A;  3O4X E;  4EBK A;  3AM1 A;  2PBE A;  2LK4 A;  3B71 A;  2L6H A;  1KNY A;  3GM2 A;  1PV3 A;  4XEF A;  4XEK A;  3C18 A;  3ADD A;  3GM3 A;  4NQF A;  2L6G A;  1UX4 A;  3S9O A;  3ADC A;  3GM1 A;  2YWA A;  3RQG A;  1K04 A;  3A4L A;  2KK1 A;  1O3U A;  1QVX A;  3JYY A;  3ADB A;  1WWP A;  3K7D A;  3A4N A;  1V4A A;  1UX5 A;  3TUL A;  3A4M A;  3RQE A;  1WTY A;  2JX0 A;  1WOL A;  1ZZP A;  3C8G A;  3AJM A;  4EBJ A;  5F28 E;  3O10 A;  2Q00 A;  3IRB A;  1JOG A;  3JZ0 A;  3C8G B;  3W8H B;  3L8J A;  2L6F A;  2HSB A;  2JPU A;  3W8I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...