3L8IA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8iA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8iA02
3AJMA 2JPUA 3U3FA 2L6GA 1O3UA 3W8IB 3O10A 3TULA 1K05A 2Q00A 2YWAA 3L8IA 1QVXA 1OW6A 1UFBA 1WOLA 3JZ0A 1KTMA 3W8HB 2PBEA 3C8GA 1WTYA 4XEVA 1PV3A 1K40A 4EBJA 1V4AA 2JX0A 1K04A 2L6HA 3BRJA 4NQFA 1OW7A 2L6FA 5F28E 3B71A 3RQFA 3C8GD 4GEHB 2HSBA 4R32A 2KK1A 3GM1A 4EBKA 3C8GB 3C18A 1KNYA 1OW8A 1WWPA 3K7DA 3L8JA 3S9OA 3JYYA 3RQEA 4XEKA 1ZZPA 2LK4A 3GM2A 3RQGA 3MFNA 4XEFA 3U0CA 1JOGA 3GM3A
chains in the Genus database with same CATH superfamily
3AJMA 4JTDB 3C63A 2L6GA 4AX2A 1TFKB 2YQYA 4N06A 3SWXA 2YWAA 2HV6A 3KPHA 1YDIA 4ULVA 2QE9A 4PK4A 2L9JA 1ORSC 4IARA 3S27A 3SZRA 2NG1A 4HFKB 2A6HF 3LEOA 1HMOA 2EJ5A 2VREA 3ADDA 1TWAA 3A4LA 2R25A 4N4WA 4OD5A 4RDAA 3FDQA 3T88A 2E87A 1NFOA 2YRFA 4Z9IA 2OU6A 1H9GA 4Q5SF 3CEXA 3EG9B 4U5EE 1D1BA 3I47A 2VASA 3HNLA 3L34A 2OJQA 3M4CA 2I15A 1XZQA 4JEBA 3S0XA 1NZYA 4JFCA 2R7RA 4O6MA 3EFOB 5JT4A 2LD6A 2LK4A 2WVNA 3C62A 3GM2A 3L0IA 3QZCA 1T6QA 1I5NA 2YLDA 4IAQA 4QIJA 4OD4A 2EPLX 1GQAA 1XWJA 2ZXOA 1WASA 1O3UA 1Q0DA 2F22A 3L1MA 1LPEA 1VK5A 3MLGA 3TK0A 5DS5A 4KNVA 2W9YA 4DRIB 3NKDA 4AL0A 2B0HA 3QW0A 4CBEA 2H8AA 1TWGA 4U5FE 2XLHA 2EPKX 3AG4C 4AK9A 2R7WA 2YL0A 3W8HB 1D0ZA 1VMAA 4MQ9F 2EILC 3MOYA 3EJNA 5BQGA 5T1DB 3H81A 4I3MA 2BC5A 1ZHWA 2L7AA 5KYWB 3VYWA 1KTMA 1NU7D 3SP1A 2IM8A 1SF8A 4EBJA 3S84A 2DI3A 2XXAB 3FXHA 1K04A 1LM3B 4NTAA 4J30B 4QI0A 4JYLA 1Q52A 2CGEA 1M56C 3M1CB 1U0BB 3U9JA 4GEHB 2NUTA 4JW1A 4CS7A 1A0BA 4YJWA 4RD9A 3K7DA 4OIQF 3NMKA 4MI2A 4RBNA 1OXKA 4W8KA 3V7OA 1RJ9B 2O9XA 3VM6A 4CJGA 3Q7GA 1EI7A 5E3CA 1NFNA 2XL6A 1V54C 2HS5A 4MVZA 2FGYA 1D1AA 2RSEB 1OCOC 3EHNA 5E3AA 4ONSA 2J45A 1I4YA 3R7CA 4XQ1A 2XLMA 4P9FA 4LACB 3S90A 3DZAA 1G8XA 3S29A 5E2QA 1HW2A 5A6JA 2YVKA 3G50A 3NYMA 2NSFA 4KI2A 2Y39A 3T89A 1E84A 4PFPA 2J0WA 4EKWA 2GDCA 2A0BA 2P61A 2PFDA 3E9VA 4NCQA 5E33A 4QIIA 3UGPA 4U5BE 1A7EA 5GPGB 2WL8A 3ECSA 4ZLDA 3U5SA 2QUPA 1NSGB 4K3WA 2HSQA 4BPMA 4CS8A 3R2PA 5L3QA 4B6IA 1EF8A 1GM5A 1Q0KA 2P1AA 1ZW2A 4MVUA 2R05A 3ZC4A 3KQFA 1BR4A 1T6UA 5L0FA 3I5QA 2IYLD 5A6KA 2YL1A 1LI5A 4U18A 3U9MA 4HEAJ 4NNQA 5K0IA 2OEXA 3IQCA 2Y3HA 3ZTMA 3A4MA 3MBGA 4PJMA 2QTVA 2R7SA 5EHHA 4U5HA 3QMKA 2XLVA 1MMDA 3RYLA 3ZQYA 4EMLA 1C02A 3LNMB 1FMWA 2Y69C 1YYJA 4EWCA 5KYXB 2C03A 2QY9A 1EF9A 1Q0MA 5JBWA 4MVSA 1Q0FA 1YVIA 3DM9B 5D91A 3ZSUA 1EKYA 1PD0A 2QNLA 2Y3BA 4YT4A 1SZIA 1RJNA 2EIKC 3G4ZA 3K1HA 3B9QA 3K6BA 3LUTB 4JJFA 4KNWA 4YN0B 3X1OA 4E7ZA 3U0CA 2WVOA 3NG1A 1EQ1A 1ZU4A 4NEKA 2WZGA 2FW2A 3JSZA 4U9DA 4IZCA 4XPYA 3SXMA 5B3SC 2D4UA 1OCCC 3O6XA 3VAYA 3ZWIA 3GEIA 3FDUA 3ABKC 4K1OA 4FX5A 4WABA 3MYIA 2R9RB 3POVA 1APCA 2FFHA 5B1BC 1H7IA 1LS1A 2VC9A 3NKEA 2PX0A 3W2VA 3EZHA 4FJWD 2C04A 2MWQA 4HFFB 1OQCA 3U8VA 5KYYA 5JS5A 1FMVA 1GS9A 1VB5A 4GYTA 2XS1A 3WODF 3AM1A 1YARO 3MYBA 3HNIA 5JUAA 2DUBA 3EPVA 3LAYA 4JE9A 3K66A 4KBLA 3W8IA 4YWQA 1YAUO 1A41A 2W4BA 3JYHA 3OWTA 1M2OA 2AWYA 2HKVA 2YEVA 1OR3A 3C8GB 1WWPA 4HE8D 4JEAA 3EHMA 3T6JA 5L0CA 3OA1A 4CSAC 4U1AA 3C8GA 3E70C 4DVZA 2AU5A 2A68F 5D92A 1G5ZA 4JCHA 5FCLA 3RKOF 3QTHA 3P5MA 4FWVA 1YYXA 2M64A 4MVRA 1GGQA 3JRMO 3FAPB 3Q6MA 2F6QA 1CPRA 1VLTA 4NTFA 2PBEA 1HMDA 3V5ZA 1NLXA 2KC3A 4BG0A 2ZXPA 1LE4A 2BL2A 4XEVA 1CGME 3PZKA 1LKXA 3EH2A 1E85A 3UMHA 3HKKA 2LFFA 2LSEA 2XLWA 4N6HA 3ITFA 4P6IC 1RMVA 1BR1A 5BUOA 2L6HA 4QDLA 2R7XA 3IHUA 4BJ5C 4WJ0A 5COFA 5DS4A 4JCSA 1WN0A 5L0GA 2LQGA 2GFHA 2IXOA 3QVYA 2EPOA 1H9TA 2PP4A 2IOQA 3QVZA 4Z9HA 3S28A 3UMIA 4Q4ZF 3EFOA 3F46A 1T9KA 4U19A 3L8JA 2NSGA 3FAJA 3HJCA 3IPMO 3SEOA 4BEMJ 3C8ZA 2WZLA 2BE5F 1H6GA 4JKVA 4NY3A 1V55C 3GEEA 2Q3TA 4CSAA 4JIOA 1NU9C 3FOPA 4ZU2A 2OOCA 1D1CA 1NBBA 2UUHA 1UFBA 3H2UA 1JXZA 2YLGA 3ADBA 2PX3A 4KNPA 5DQTA 2EINC 3SYNA 4C7OA 3DM5A 4FAPB 4I44A 1WATA 3DAFA 4C7OB 3EGXA 1RXQA 3KYIA 1L3PA 4NQFA 5HSWA 3LS0A 3LS1A 1ZYRF 4JCZA 3OC7A 1M57C 3A11A 3QK8A 2IEXA 5A6AA 2XM0A 2VH3A 1IZMA 1C17M 4EIYA 5CIVA 2NUPA 4WCZA 2HMQA 2J7PA 1AEPA 2VCCA 1DOVA 1A7DA 3F47A 4CDAA 4E17A 2HJ3A 4KC9A 4DVYP 3RVYA 5DLJA 1QPUA 2QLAA 3O4XE 2MYSA 3AG3C 5DS6A 2CNWA 4NTBA 4YT5A 2G62A 3I4UA 5KYXA 2ZQRA 3KYJA 3R9TA 4I1MA 2VX2A 4OIRF 2R7OA 4H54A 4ULWA 4X0RA 3US6A 4DRJB 4XPWA 4E18A 4I42A 3JTLO 2Y3GA 3DWWA 2R7UA 1T6IA 1UG7A 3K33A 1V74B 1J8MF 2IXNA 3NYJA 3AQBA 1Z5ZA 2HV7A 2UUIA 1HE1A 3KKBA 3AGTA 2J9VA 3QXZA 1WGWA 1RCPA 1QLEC 2CW0F 1QSPA 2GA0A 3ASNC 2PNOA 3GM1A 4YL3A 3LLIA 4CS9A 3EGDB 2XL4A 3JYYA 3ATPA 1TR2A 3T8AA 1KU2A 3Q0GA 3ASOC 3DJUB 2KGOA 3EG9A 3M4BA 2JPUA 1D0XA 2CYDA 2J9UA 2YKZA 3QXIA 1F1MA 1BBHA 2CCYA 5C9GA 3ABLC 3LNRA 4PJLA 4OIPF 4MW8A 3U3BA 2VB6A 4U9EA 3B0UX 4CX9A 3JCUQ 5T3WA 4OLQA 5EGYA 1ORYA 4Z9JA 3RSIA 3T6GB 3CQZA 1D0YA 1DCIA 2P7VA 2G3KA 2RD9A 2JX0A 3CZ6A 1L7CA 3BRJA 1NG1A 3DJNB 4WGZA 1RKEA 3H65A 5F28E 3ZIBA 1LVKA 1TWCA 3DMDA 4BJ6C 4C3EA 4J7TA 1RKEB 1U6HA 3B29A 4GQHA 3DE9A 4K0DA 4J7YA 4K7BA 4YK5A 2XXAA 1AUEA 3S9OA 4ANJA 1QQ3A 4G78A 3M15A 4H4KC 4DXWA 4OIOF 2B0JA 3MFNA 2CDQA 5KYUB 1Z7Qc 4JRZA 3HINA 4C3BA 3Q6NA 4MVMA 4U5CE 2XM4A 4BJ6A 1OCZC 5IY5C 2NUTB 4GEHA 2X51A 3IEEA 3T9OA 3SXKA 1O87A 2DYSC 3HNJA 4YL1A 3HNKA 3TJ6A 2Q9BA 4JWVA 4YT2A 1RJ9A 1FAPB 1G4US 4IB4A 3UR3C 1MMAA 2YZSA 3VF0A 2GTRA 4DBRA 2ZPAA 3U2LA 3DD7A 4F47A 2IXMA 1BZ4A 3GANA 4IRUA 2VCAA 1PCXA 1NZYB 2XL8A 3TOMA 3ZVRA 4I4ZA 2GAQA 5L0HA 1XZPA 1BDJB 2H7BA 3EQLF 1CGOA 2A1DD 2ICWG 5JLIA 1MNDA 5FZTA 5L3VA 4BJ5A 1OKKD 1YLMA 3DAGA 3EH1A 3K1IA 4YT8A 1HY5A 1FFTC 3G64A 4PFOA 4E7SA 4AL1A 2L81A 5A6BD 4DOZA 2KYHA 3O55A 4F4BA 3C18A 3GODA 5EK0A 1S7ZA 4I1OB 4XEKA 1ZZPA 3AOUA 5JRAA 1Y6DA 3UNGC 3HTKC 1IW7F 1C03A 2J8WA 2LP4A 3K1IC 3LESA 1VTMP 3ZQVA 1QZXA 5JP7A 1EA8A 3FOOA 3EGXB 3SLLA 4J32B 1FTSA 1OW6A 1LI7A 3QW1A 3PCVA 2YL3A 1QKRA 1TFOB 3ABMC 3PHF2 2D5RB 2P63A 2AP3A 2FAPB 3FHDA 1E83A 1ST6A 3W2WA 5L0JA 1MNEA 2ASRA 1FNTc 5F5FA 4PJJA 3OEOA 4MVOA 4MTGA 3UGOA 3FMSA 3SNHA 3RFYA 4ER9A 5KJPA 3DXJF 2KNHA 4PR9A 4A2NB 3B71A 2CNWD 3ZTZA 2XLEA 2AVKA 4JVSA 2GWWA 2I8BA 2KW3C 3JSEO 4R32A 2KQ9A 2YL7A 1UX4A 2PPYA 1VLSA 4P9TA 5CI9A 1OW8A 4BEJA 3RIPA 1EY3A 3N2ZB 4YL0A 3RQGA 3NYLA 3A9CA 5AGFA 5TJ5E 2EIJC 2J46A 3KH2A 4EHPA 3J06A 1M6TA 4D4NA 3AG1C 2ZXRA 4CIPA 4IZBA 2Q00A 2W45A 3KL4A 4XPXA 3G4XA 1FR0A 2TMVP 1Y4CA 2UZFA 3CAXA 1OCRC 2EIMC 2OKUA 4QI2A 1T5OA 1MMNA 2JD3A 1ZHTA 4IJJA 1WTYA 2J9WA 4JZAA 3LEVA 5B3IA 2G3VA 5T3TA 1PV3A 4C3DA 3CSKA 2XSEA 3M79A 1Q51A 1A7VA 4MVQA 5AC5A 4EUKB 4DRHB 2X0CA 4O7GA 2OJED 1JR8A 5COMA 1HW1A 5A69A 5CI8A 2XLDA 4LDKA 4JURI 3C8GD 3UMKA 4UDVA 4XTKA 2V3CC 1VOMA 4ZLCA 4MW3A 5KYYB 3DKAA 2A0UA 4N6CA 4E0IA 4M63A 2OEVA 4CS9C 1JPJA 2HUJA 1OXBA 3DE8A 3WG7C 5JSLA 1W2WA 3TD7A 4JTAB 3IQTA 3NRHA 3W8IB 4D4XA 4E0HA 4WGYA 4LLCA 4JOTA 3HRXA 5BQIA 1WOLA 1Z3IX 4NC3A 1UX5A 1E86A 3TLFA 2J7PD 3AQCA 2VCBA 3NDBB 2WVQA 4MS2A 3B0PA 1VYKA 5KYWA 4L6RA 2HJMA 3N0TA 4MTOA 3RH3A 1LS4A 1MQVA 3MX3A 1FFHA 1HZDA 1Z23A 3SXZA 4AE4B 256BA 2A69F 4G7ZF 1RJMA 1ZVZA 1VYIA 1NZEA 4AE4A 4G7HF 5JBXA 5KYUA 3RQFA 4IWBA 3NMJA 2XS8A 5F5HA 3VRCA 1TKNA 3WHNA 2KJGA 3GWNA 1MMGA 2Q7RA 3RF3A 4CS8C 3RQEA 4ELWA 2DGJA 2EPMX 2IBFA 1M2VB 1JRAA 3AG2C 1R4TA 4PJNA 2H7VC 4CJOA 1M2VA 1K05A 2HZ8A 3B0VC 4BJTA 4K2NA 3R0OA 1DUBA 3ADCA 2AWCA 3RVZA 3R9SA 3V5YA 1S05A 2PF4E 1PD1A 4JTCB 4JJGA 3EZIA 4U5GA 3N24A 4O6YA 2MHRA 2J9BA 1OKKA 3Q1TA 4FZWA 4G7OF 4CIHA 1HE9A 1Q0GA 3W8HA 1B68A 4O6NA 1E2XA 3DI5A 2Q4FA 4EBBA 1MJ3A 4LDRA 2DYRC 1ZHXA 3LJBA 4O79A 4BJ1A 1Z6AA 3IQ6A 3GWLA 1YZCA 4EBKA 5HV9A 1DOWA 1KNYA 2Q9AA 2R7VA 1YJGA 3I5PA 2V26A 4JC7A 4DJ9A 3H2VA 3TRRA 1O5HA 2LFDA 4MTFA 4CDVA 4ELXA 4IGGA 3SXYA 3V5XA 5JVEA 3AGUA 2DB4A 4FESA 1BR2A 1ZHYA 2PBPA 3JZ0A 2HFIA 2H7OA 3BEHA 2NUPB 4W8PA 5B1AC 2XLOA 2OQMA 4Q7CA 3FVYA 3GORA 4OINF 1CGNA 4I52A 2ZD9A 3X2QC 5L0DA 2XRHA 2P6VA 3A4NA 1JAFA 1K40A 3GEHA 3MYFA 3U8PA 5DQZA 2EPNA 1JMWA 1U89A 2J0XA 5COGA 4XLNF 3W4YA 1LIHA 1N1CA 2HMZA 2R02A 1YZAA 2YHSA 4LLEA 2OCCC 4XLPF 1YA9A 3PMRA 2HSBA 2KK1A 2ETSA 4CDYA 3U2MA 3PDMP 2QQ3A 1ZU5A 1R5ID 1ZHZA 1RKCA 1Y64B 4ELSA 2R7QA 3NMIA 2HW5A 3GM3A 2A6EF 3U3FA 4XWJA 1SR2A 3O39A 2R7TA 1LE2A 3O10A 2M4EA 3TULA 2OG2A 2P0NA 3LLKA 1YA7O 1ORJA 4MOUA 2NPUA 1OR2A 4LERA 3H02A 1T01A 2WZFA 3L8IA 1QVXA 2LIGA 3T4RA 2Q9CA 3KMIA 3T6BA 4IZDA 3EGDA 4IAOA 3ZG1A 4DBQA 5BQHA 2W4MA 1SYQA 1TQGA 2R03A 3RW0A 5AC4A 3TOLA 4A4AA 5KYNA 1ZW3A 1SMYF 4OG1A 2Z15A 3Q7LA 2KSFA 1J8YF 3Q0JA 4MNDA 4U5DE 5A6BA 1V4AA 3HLZA 1JPNA 3ZDLA 1OW7A 2L6FA 1UIYA 2FBMA 4G0HA 1WZ8A 1CPQA 1G4WR 2LCHA 3C7JA 3JRTA 4PACA 2WB7A 3TQOA 3WAQA 5L0IA 1Z63A 1TWHA 3JT1A 3IRBA 1I4ZA 3TJ5A 2YLIA 2ZQQA 3IQ5A 4FZWC 4LDQA 5DVWA 2Y3DA 2IXPA 1AVOB 2ZXWC 4XEFA 1JOGA
chains in the Genus database with same CATH topology
3AJMA 2JPUA 3U3FA 2L6GA 1O3UA 3W8IB 3O10A 3TULA 1K05A 2Q00A 3O4XE 2YWAA 4NNQA 3L8IA 1QVXA 1OW6A 1UFBA 1UX5A 1WOLA 3ADCA 3ADBA 3A4MA 3JZ0A 1KTMA 3W8HB 2PBEA 2P63A 3C8GA 1WTYA 4XEVA 1PV3A 3ADDA 3A4LA 3A4NA 1K40A 1V4AA 3MFNA 4EBJA 2JX0A 1K04A 2L6HA 3BRJA 4NQFA 1RJMA 1OW7A 2L6FA 5F28E 3AM1A 3B71A 3RQFA 3C8GD 4GEHB 2HSBA 4R32A 3IRBA 2KK1A 1UX4A 3GM1A 4EBKA 3C8GB 3C18A 1KNYA 1OW8A 1WWPA 3K7DA 3L8JA 3S9OA 3JYYA 3RQEA 4XEKA 1Y64B 1ZZPA 2LK4A 3RQGA 3GM2A 4XEFA 3U0CA 1JOGA 3GM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  2JPU A;  3U3F A;  2L6G A;  1O3U A;  3W8I B;  3O10 A;  3TUL A;  1K05 A;  2Q00 A;  2YWA A;  3L8I A;  1QVX A;  1OW6 A;  1UFB A;  1WOL A;  3JZ0 A;  1KTM A;  3W8H B;  2PBE A;  3C8G A;  1WTY A;  4XEV A;  1PV3 A;  1K40 A;  4EBJ A;  1V4A A;  2JX0 A;  1K04 A;  2L6H A;  3BRJ A;  4NQF A;  1OW7 A;  2L6F A;  5F28 E;  3B71 A;  3RQF A;  3C8G D;  4GEH B;  2HSB A;  4R32 A;  2KK1 A;  3GM1 A;  4EBK A;  3C8G B;  3C18 A;  1KNY A;  1OW8 A;  1WWP A;  3K7D A;  3L8J A;  3S9O A;  3JYY A;  3RQE A;  4XEK A;  1ZZP A;  2LK4 A;  3GM2 A;  3RQG A;  3MFN A;  4XEF A;  3U0C A;  1JOG A;  3GM3 A; 
#chains in the Genus database with same CATH topology
 3AJM A;  4JTD B;  3C63 A;  2L6G A;  4AX2 A;  1TFK B;  2YQY A;  4N06 A;  3SWX A;  2YWA A;  2HV6 A;  3KPH A;  1YDI A;  4ULV A;  2QE9 A;  4PK4 A;  2L9J A;  1ORS C;  4IAR A;  3S27 A;  3SZR A;  2NG1 A;  4HFK B;  2A6H F;  3LEO A;  1HMO A;  2EJ5 A;  2VRE A;  3ADD A;  1TWA A;  3A4L A;  2R25 A;  4N4W A;  4OD5 A;  4RDA A;  3FDQ A;  3T88 A;  2E87 A;  1NFO A;  2YRF A;  4Z9I A;  2OU6 A;  1H9G A;  4Q5S F;  3CEX A;  3EG9 B;  4U5E E;  1D1B A;  3I47 A;  2VAS A;  3HNL A;  3L34 A;  2OJQ A;  3M4C A;  2I15 A;  1XZQ A;  4JEB A;  3S0X A;  1NZY A;  4JFC A;  2R7R A;  4O6M A;  3EFO B;  5JT4 A;  2LD6 A;  2LK4 A;  2WVN A;  3C62 A;  3GM2 A;  3L0I A;  3QZC A;  1T6Q A;  1I5N A;  2YLD A;  4IAQ A;  4QIJ A;  4OD4 A;  2EPL X;  1GQA A;  1XWJ A;  2ZXO A;  1WAS A;  1O3U A;  1Q0D A;  2F22 A;  3L1M A;  1LPE A;  1VK5 A;  3MLG A;  3TK0 A;  5DS5 A;  4KNV A;  2W9Y A;  4DRI B;  3NKD A;  4AL0 A;  2B0H A;  3QW0 A;  4CBE A;  2H8A A;  1TWG A;  4U5F E;  2XLH A;  2EPK X;  3AG4 C;  4AK9 A;  2R7W A;  2YL0 A;  3W8H B;  1D0Z A;  1VMA A;  4MQ9 F;  2EIL C;  3MOY A;  3EJN A;  5BQG A;  5T1D B;  3H81 A;  4I3M A;  2BC5 A;  1ZHW A;  2L7A A;  5KYW B;  3VYW A;  1KTM A;  1NU7 D;  3SP1 A;  2IM8 A;  1SF8 A;  4EBJ A;  3S84 A;  2DI3 A;  2XXA B;  3FXH A;  1K04 A;  1LM3 B;  4NTA A;  4J30 B;  4QI0 A;  4JYL A;  1Q52 A;  2CGE A;  1M56 C;  3M1C B;  1U0B B;  3U9J A;  4GEH B;  2NUT A;  4JW1 A;  4CS7 A;  1A0B A;  4YJW A;  4RD9 A;  3K7D A;  4OIQ F;  3NMK A;  4MI2 A;  4RBN A;  1OXK A;  4W8K A;  3V7O A;  1RJ9 B;  2O9X A;  3VM6 A;  4CJG A;  3Q7G A;  1EI7 A;  5E3C A;  1NFN A;  2XL6 A;  1V54 C;  2HS5 A;  4MVZ A;  2FGY A;  1D1A A;  2RSE B;  1OCO C;  3EHN A;  5E3A A;  4ONS A;  2J45 A;  1I4Y A;  3R7C A;  4XQ1 A;  2XLM A;  4P9F A;  4LAC B;  3S90 A;  3DZA A;  1G8X A;  3S29 A;  5E2Q A;  1HW2 A;  5A6J A;  2YVK A;  3G50 A;  3NYM A;  2NSF A;  4KI2 A;  2Y39 A;  3T89 A;  1E84 A;  4PFP A;  2J0W A;  4EKW A;  2GDC A;  2A0B A;  2P61 A;  2PFD A;  3E9V A;  4NCQ A;  5E33 A;  4QII A;  3UGP A;  4U5B E;  1A7E A;  5GPG B;  2WL8 A;  3ECS A;  4ZLD A;  3U5S A;  2QUP A;  1NSG B;  4K3W A;  2HSQ A;  4BPM A;  4CS8 A;  3R2P A;  5L3Q A;  4B6I A;  1EF8 A;  1GM5 A;  1Q0K A;  2P1A A;  1ZW2 A;  4MVU A;  2R05 A;  3ZC4 A;  3KQF A;  1BR4 A;  1T6U A;  5L0F A;  3I5Q A;  2IYL D;  5A6K A;  2YL1 A;  1LI5 A;  4U18 A;  3U9M A;  4HEA J;  4NNQ A;  5K0I A;  2OEX A;  3IQC A;  2Y3H A;  3ZTM A;  3A4M A;  3MBG A;  4PJM A;  2QTV A;  2R7S A;  5EHH A;  4U5H A;  3QMK A;  2XLV A;  1MMD A;  3RYL A;  3ZQY A;  4EML A;  1C02 A;  3LNM B;  1FMW A;  2Y69 C;  1YYJ A;  4EWC A;  5KYX B;  2C03 A;  2QY9 A;  1EF9 A;  1Q0M A;  5JBW A;  4MVS A;  1Q0F A;  1YVI A;  3DM9 B;  5D91 A;  3ZSU A;  1EKY A;  1PD0 A;  2QNL A;  2Y3B A;  4YT4 A;  1SZI A;  1RJN A;  2EIK C;  3G4Z A;  3K1H A;  3B9Q A;  3K6B A;  3LUT B;  4JJF A;  4KNW A;  4YN0 B;  3X1O A;  4E7Z A;  3U0C A;  2WVO A;  3NG1 A;  1EQ1 A;  1ZU4 A;  4NEK A;  2WZG A;  2FW2 A;  3JSZ A;  4U9D A;  4IZC A;  4XPY A;  3SXM A;  5B3S C;  2D4U A;  1OCC C;  3O6X A;  3VAY A;  3ZWI A;  3GEI A;  3FDU A;  3ABK C;  4K1O A;  4FX5 A;  4WAB A;  3MYI A;  2R9R B;  3POV A;  1APC A;  2FFH A;  5B1B C;  1H7I A;  1LS1 A;  2VC9 A;  3NKE A;  2PX0 A;  3W2V A;  3EZH A;  4FJW D;  2C04 A;  2MWQ A;  4HFF B;  1OQC A;  3U8V A;  5KYY A;  5JS5 A;  1FMV A;  1GS9 A;  1VB5 A;  4GYT A;  2XS1 A;  3WOD F;  3AM1 A;  1YAR O;  3MYB A;  3HNI A;  5JUA A;  2DUB A;  3EPV A;  3LAY A;  4JE9 A;  3K66 A;  4KBL A;  3W8I A;  4YWQ A;  1YAU O;  1A41 A;  2W4B A;  3JYH A;  3OWT A;  1M2O A;  2AWY A;  2HKV A;  2YEV A;  1OR3 A;  3C8G B;  1WWP A;  4HE8 D;  4JEA A;  3EHM A;  3T6J A;  5L0C A;  3OA1 A;  4CSA C;  4U1A A;  3C8G A;  3E70 C;  4DVZ A;  2AU5 A;  2A68 F;  5D92 A;  1G5Z A;  4JCH A;  5FCL A;  3RKO F;  3QTH A;  3P5M A;  4FWV A;  1YYX A;  2M64 A;  4MVR A;  1GGQ A;  3JRM O;  3FAP B;  3Q6M A;  2F6Q A;  1CPR A;  1VLT A;  4NTF A;  2PBE A;  1HMD A;  3V5Z A;  1NLX A;  2KC3 A;  4BG0 A;  2ZXP A;  1LE4 A;  2BL2 A;  4XEV A;  1CGM E;  3PZK A;  1LKX A;  3EH2 A;  1E85 A;  3UMH A;  3HKK A;  2LFF A;  2LSE A;  2XLW A;  4N6H A;  3ITF A;  4P6I C;  1RMV A;  1BR1 A;  5BUO A;  2L6H A;  4QDL A;  2R7X A;  3IHU A;  4BJ5 C;  4WJ0 A;  5COF A;  5DS4 A;  4JCS A;  1WN0 A;  5L0G A;  2LQG A;  2GFH A;  2IXO A;  3QVY A;  2EPO A;  1H9T A;  2PP4 A;  2IOQ A;  3QVZ A;  4Z9H A;  3S28 A;  3UMI A;  4Q4Z F;  3EFO A;  3F46 A;  1T9K A;  4U19 A;  3L8J A;  2NSG A;  3FAJ A;  3HJC A;  3IPM O;  3SEO A;  4BEM J;  3C8Z A;  2WZL A;  2BE5 F;  1H6G A;  4JKV A;  4NY3 A;  1V55 C;  3GEE A;  2Q3T A;  4CSA A;  4JIO A;  1NU9 C;  3FOP A;  4ZU2 A;  2OOC A;  1D1C A;  1NBB A;  2UUH A;  1UFB A;  3H2U A;  1JXZ A;  2YLG A;  3ADB A;  2PX3 A;  4KNP A;  5DQT A;  2EIN C;  3SYN A;  4C7O A;  3DM5 A;  4FAP B;  4I44 A;  1WAT A;  3DAF A;  4C7O B;  3EGX A;  1RXQ A;  3KYI A;  1L3P A;  4NQF A;  5HSW A;  3LS0 A;  3LS1 A;  1ZYR F;  4JCZ A;  3OC7 A;  1M57 C;  3A11 A;  3QK8 A;  2IEX A;  5A6A A;  2XM0 A;  2VH3 A;  1IZM A;  1C17 M;  4EIY A;  5CIV A;  2NUP A;  4WCZ A;  2HMQ A;  2J7P A;  1AEP A;  2VCC A;  1DOV A;  1A7D A;  3F47 A;  4CDA A;  4E17 A;  2HJ3 A;  4KC9 A;  4DVY P;  3RVY A;  5DLJ A;  1QPU A;  2QLA A;  3O4X E;  2MYS A;  3AG3 C;  5DS6 A;  2CNW A;  4NTB A;  4YT5 A;  2G62 A;  3I4U A;  5KYX A;  2ZQR A;  3KYJ A;  3R9T A;  4I1M A;  2VX2 A;  4OIR F;  2R7O A;  4H54 A;  4ULW A;  4X0R A;  3US6 A;  4DRJ B;  4XPW A;  4E18 A;  4I42 A;  3JTL O;  2Y3G A;  3DWW A;  2R7U A;  1T6I A;  1UG7 A;  3K33 A;  1V74 B;  1J8M F;  2IXN A;  3NYJ A;  3AQB A;  1Z5Z A;  2HV7 A;  2UUI A;  1HE1 A;  3KKB A;  3AGT A;  2J9V A;  3QXZ A;  1WGW A;  1RCP A;  1QLE C;  2CW0 F;  1QSP A;  2GA0 A;  3ASN C;  2PNO A;  3GM1 A;  4YL3 A;  3LLI A;  4CS9 A;  3EGD B;  2XL4 A;  3JYY A;  3ATP A;  1TR2 A;  3T8A A;  1KU2 A;  3Q0G A;  3ASO C;  3DJU B;  2KGO A;  3EG9 A;  3M4B A;  2JPU A;  1D0X A;  2CYD A;  2J9U A;  2YKZ A;  3QXI A;  1F1M A;  1BBH A;  2CCY A;  5C9G A;  3ABL C;  3LNR A;  4PJL A;  4OIP F;  4MW8 A;  3U3B A;  2VB6 A;  4U9E A;  3B0U X;  4CX9 A;  3JCU Q;  5T3W A;  4OLQ A;  5EGY A;  1ORY A;  4Z9J A;  3RSI A;  3T6G B;  3CQZ A;  1D0Y A;  1DCI A;  2P7V A;  2G3K A;  2RD9 A;  2JX0 A;  3CZ6 A;  1L7C A;  3BRJ A;  1NG1 A;  3DJN B;  4WGZ A;  1RKE A;  3H65 A;  5F28 E;  3ZIB A;  1LVK A;  1TWC A;  3DMD A;  4BJ6 C;  4C3E A;  4J7T A;  1RKE B;  1U6H A;  3B29 A;  4GQH A;  3DE9 A;  4K0D A;  4J7Y A;  4K7B A;  4YK5 A;  2XXA A;  1AUE A;  3S9O A;  4ANJ A;  1QQ3 A;  4G78 A;  3M15 A;  4H4K C;  4DXW A;  4OIO F;  2B0J A;  3MFN A;  2CDQ A;  5KYU B;  1Z7Q c;  4JRZ A;  3HIN A;  4C3B A;  3Q6N A;  4MVM A;  4U5C E;  2XM4 A;  4BJ6 A;  1OCZ C;  5IY5 C;  2NUT B;  4GEH A;  2X51 A;  3IEE A;  3T9O A;  3SXK A;  1O87 A;  2DYS C;  3HNJ A;  4YL1 A;  3HNK A;  3TJ6 A;  2Q9B A;  4JWV A;  4YT2 A;  1RJ9 A;  1FAP B;  1G4U S;  4IB4 A;  3UR3 C;  1MMA A;  2YZS A;  3VF0 A;  2GTR A;  4DBR A;  2ZPA A;  3U2L A;  3DD7 A;  4F47 A;  2IXM A;  1BZ4 A;  3GAN A;  4IRU A;  2VCA A;  1PCX A;  1NZY B;  2XL8 A;  3TOM A;  3ZVR A;  4I4Z A;  2GAQ A;  5L0H A;  1XZP A;  1BDJ B;  2H7B A;  3EQL F;  1CGO A;  2A1D D;  2ICW G;  5JLI A;  1MND A;  5FZT A;  5L3V A;  4BJ5 A;  1OKK D;  1YLM A;  3DAG A;  3EH1 A;  3K1I A;  4YT8 A;  1HY5 A;  1FFT C;  3G64 A;  4PFO A;  4E7S A;  4AL1 A;  2L81 A;  5A6B D;  4DOZ A;  2KYH A;  3O55 A;  4F4B A;  3C18 A;  3GOD A;  5EK0 A;  1S7Z A;  4I1O B;  4XEK A;  1ZZP A;  3AOU A;  5JRA A;  1Y6D A;  3UNG C;  3HTK C;  1IW7 F;  1C03 A;  2J8W A;  2LP4 A;  3K1I C;  3LES A;  1VTM P;  3ZQV A;  1QZX A;  5JP7 A;  1EA8 A;  3FOO A;  3EGX B;  3SLL A;  4J32 B;  1FTS A;  1OW6 A;  1LI7 A;  3QW1 A;  3PCV A;  2YL3 A;  1QKR A;  1TFO B;  3ABM C;  3PHF 2;  2D5R B;  2P63 A;  2AP3 A;  2FAP B;  3FHD A;  1E83 A;  1ST6 A;  3W2W A;  5L0J A;  1MNE A;  2ASR A;  1FNT c;  5F5F A;  4PJJ A;  3OEO A;  4MVO A;  4MTG A;  3UGO A;  3FMS A;  3SNH A;  3RFY A;  4ER9 A;  5KJP A;  3DXJ F;  2KNH A;  4PR9 A;  4A2N B;  3B71 A;  2CNW D;  3ZTZ A;  2XLE A;  2AVK A;  4JVS A;  2GWW A;  2I8B A;  2KW3 C;  3JSE O;  4R32 A;  2KQ9 A;  2YL7 A;  1UX4 A;  2PPY A;  1VLS A;  4P9T A;  5CI9 A;  1OW8 A;  4BEJ A;  3RIP A;  1EY3 A;  3N2Z B;  4YL0 A;  3RQG A;  3NYL A;  3A9C A;  5AGF A;  5TJ5 E;  2EIJ C;  2J46 A;  3KH2 A;  4EHP A;  3J06 A;  1M6T A;  4D4N A;  3AG1 C;  2ZXR A;  4CIP A;  4IZB A;  2Q00 A;  2W45 A;  3KL4 A;  4XPX A;  3G4X A;  1FR0 A;  2TMV P;  1Y4C A;  2UZF A;  3CAX A;  1OCR C;  2EIM C;  2OKU A;  4QI2 A;  1T5O A;  1MMN A;  2JD3 A;  1ZHT A;  4IJJ A;  1WTY A;  2J9W A;  4JZA A;  3LEV A;  5B3I A;  2G3V A;  5T3T A;  1PV3 A;  4C3D A;  3CSK A;  2XSE A;  3M79 A;  1Q51 A;  1A7V A;  4MVQ A;  5AC5 A;  4EUK B;  4DRH B;  2X0C A;  4O7G A;  2OJE D;  1JR8 A;  5COM A;  1HW1 A;  5A69 A;  5CI8 A;  2XLD A;  4LDK A;  4JUR I;  3C8G D;  3UMK A;  4UDV A;  4XTK A;  2V3C C;  1VOM A;  4ZLC A;  4MW3 A;  5KYY B;  3DKA A;  2A0U A;  4N6C A;  4E0I A;  4M63 A;  2OEV A;  4CS9 C;  1JPJ A;  2HUJ A;  1OXB A;  3DE8 A;  3WG7 C;  5JSL A;  1W2W A;  3TD7 A;  4JTA B;  3IQT A;  3NRH A;  3W8I B;  4D4X A;  4E0H A;  4WGY A;  4LLC A;  4JOT A;  3HRX A;  5BQI A;  1WOL A;  1Z3I X;  4NC3 A;  1UX5 A;  1E86 A;  3TLF A;  2J7P D;  3AQC A;  2VCB A;  3NDB B;  2WVQ A;  4MS2 A;  3B0P A;  1VYK A;  5KYW A;  4L6R A;  2HJM A;  3N0T A;  4MTO A;  3RH3 A;  1LS4 A;  1MQV A;  3MX3 A;  1FFH A;  1HZD A;  1Z23 A;  3SXZ A;  4AE4 B;  256B A;  2A69 F;  4G7Z F;  1RJM A;  1ZVZ A;  1VYI A;  1NZE A;  4AE4 A;  4G7H F;  5JBX A;  5KYU A;  3RQF A;  4IWB A;  3NMJ A;  2XS8 A;  5F5H A;  3VRC A;  1TKN A;  3WHN A;  2KJG A;  3GWN A;  1MMG A;  2Q7R A;  3RF3 A;  4CS8 C;  3RQE A;  4ELW A;  2DGJ A;  2EPM X;  2IBF A;  1M2V B;  1JRA A;  3AG2 C;  1R4T A;  4PJN A;  2H7V C;  4CJO A;  1M2V A;  1K05 A;  2HZ8 A;  3B0V C;  4BJT A;  4K2N A;  3R0O A;  1DUB A;  3ADC A;  2AWC A;  3RVZ A;  3R9S A;  3V5Y A;  1S05 A;  2PF4 E;  1PD1 A;  4JTC B;  4JJG A;  3EZI A;  4U5G A;  3N24 A;  4O6Y A;  2MHR A;  2J9B A;  1OKK A;  3Q1T A;  4FZW A;  4G7O F;  4CIH A;  1HE9 A;  1Q0G A;  3W8H A;  1B68 A;  4O6N A;  1E2X A;  3DI5 A;  2Q4F A;  4EBB A;  1MJ3 A;  4LDR A;  2DYR C;  1ZHX A;  3LJB A;  4O79 A;  4BJ1 A;  1Z6A A;  3IQ6 A;  3GWL A;  1YZC A;  4EBK A;  5HV9 A;  1DOW A;  1KNY A;  2Q9A A;  2R7V A;  1YJG A;  3I5P A;  2V26 A;  4JC7 A;  4DJ9 A;  3H2V A;  3TRR A;  1O5H A;  2LFD A;  4MTF A;  4CDV A;  4ELX A;  4IGG A;  3SXY A;  3V5X A;  5JVE A;  3AGU A;  2DB4 A;  4FES A;  1BR2 A;  1ZHY A;  2PBP A;  3JZ0 A;  2HFI A;  2H7O A;  3BEH A;  2NUP B;  4W8P A;  5B1A C;  2XLO A;  2OQM A;  4Q7C A;  3FVY A;  3GOR A;  4OIN F;  1CGN A;  4I52 A;  2ZD9 A;  3X2Q C;  5L0D A;  2XRH A;  2P6V A;  3A4N A;  1JAF A;  1K40 A;  3GEH A;  3MYF A;  3U8P A;  5DQZ A;  2EPN A;  1JMW A;  1U89 A;  2J0X A;  5COG A;  4XLN F;  3W4Y A;  1LIH A;  1N1C A;  2HMZ A;  2R02 A;  1YZA A;  2YHS A;  4LLE A;  2OCC C;  4XLP F;  1YA9 A;  3PMR A;  2HSB A;  2KK1 A;  2ETS A;  4CDY A;  3U2M A;  3PDM P;  2QQ3 A;  1ZU5 A;  1R5I D;  1ZHZ A;  1RKC A;  1Y64 B;  4ELS A;  2R7Q A;  3NMI A;  2HW5 A;  3GM3 A;  2A6E F;  3U3F A;  4XWJ A;  1SR2 A;  3O39 A;  2R7T A;  1LE2 A;  3O10 A;  2M4E A;  3TUL A;  2OG2 A;  2P0N A;  3LLK A;  1YA7 O;  1ORJ A;  4MOU A;  2NPU A;  1OR2 A;  4LER A;  3H02 A;  1T01 A;  2WZF A;  3L8I A;  1QVX A;  2LIG A;  3T4R A;  2Q9C A;  3KMI A;  3T6B A;  4IZD A;  3EGD A;  4IAO A;  3ZG1 A;  4DBQ A;  5BQH A;  2W4M A;  1SYQ A;  1TQG A;  2R03 A;  3RW0 A;  5AC4 A;  3TOL A;  4A4A A;  5KYN A;  1ZW3 A;  1SMY F;  4OG1 A;  2Z15 A;  3Q7L A;  2KSF A;  1J8Y F;  3Q0J A;  4MND A;  4U5D E;  5A6B A;  1V4A A;  3HLZ A;  1JPN A;  3ZDL A;  1OW7 A;  2L6F A;  1UIY A;  2FBM A;  4G0H A;  1WZ8 A;  1CPQ A;  1G4W R;  2LCH A;  3C7J A;  3JRT A;  4PAC A;  2WB7 A;  3TQO A;  3WAQ A;  5L0I A;  1Z63 A;  1TWH A;  3JT1 A;  3IRB A;  1I4Z A;  3TJ5 A;  2YLI A;  2ZQQ A;  3IQ5 A;  4FZW C;  4LDQ A;  5DVW A;  2Y3D A;  2IXP A;  1AVO B;  2ZXW C;  4XEF A;  1JOG A; 
#chains in the Genus database with same CATH homology
 3AJM A;  2JPU A;  3U3F A;  2L6G A;  1O3U A;  3W8I B;  3O10 A;  3TUL A;  1K05 A;  2Q00 A;  3O4X E;  2YWA A;  4NNQ A;  3L8I A;  1QVX A;  1OW6 A;  1UFB A;  1UX5 A;  1WOL A;  3ADC A;  3ADB A;  3A4M A;  3JZ0 A;  1KTM A;  3W8H B;  2PBE A;  2P63 A;  3C8G A;  1WTY A;  4XEV A;  1PV3 A;  3ADD A;  3A4L A;  3A4N A;  1K40 A;  1V4A A;  3MFN A;  4EBJ A;  2JX0 A;  1K04 A;  2L6H A;  3BRJ A;  4NQF A;  1RJM A;  1OW7 A;  2L6F A;  5F28 E;  3AM1 A;  3B71 A;  3RQF A;  3C8G D;  4GEH B;  2HSB A;  4R32 A;  3IRB A;  2KK1 A;  1UX4 A;  3GM1 A;  4EBK A;  3C8G B;  3C18 A;  1KNY A;  1OW8 A;  1WWP A;  3K7D A;  3L8J A;  3S9O A;  3JYY A;  3RQE A;  4XEK A;  1Y64 B;  1ZZP A;  2LK4 A;  3RQG A;  3GM2 A;  4XEF A;  3U0C A;  1JOG A;  3GM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...