3L8IA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8iA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8iA02
3JZ0A 1KTMA 3TULA 1WTYA 3C18A 1WWPA 3RQFA 1OW7A 3MFNA 3L8JA 1UFBA 1JOGA 3AJMA 4XEVA 4NQFA 3GM1A 3C8GA 4EBKA 5F28E 3JYYA 1PV3A 3W8IB 2LK4A 2L6FA 4XEFA 2HSBA 3U0CA 2YWAA 1V4AA 4EBJA 3BRJA 1WOLA 3GM2A 1KNYA 3L8IA 3W8HB 1OW8A 1K40A 1ZZPA 2Q00A 1QVXA 3B71A 3S9OA 3U3FA 1O3UA 2L6HA 1K04A 2JPUA 2JX0A 2KK1A 4XEKA 3RQEA 3C8GB 1OW6A 1K05A 2L6GA 2PBEA 3O10A 3K7DA 4R32A 4GEHB 3C8GD 3RQGA 3GM3A
chains in the Genus database with same CATH superfamily
3EFOA 3O39A 3B0VC 4LLEA 3T8AA 1QQ3A 2WL8A 2HSBA 1FFTC 3JCUQ 5TJ5E 3S9OA 3JRMO 3DE8A 1K04A 3FOPA 3EJNA 4JKVA 4XEKA 4F47A 3W8IA 4MTOA 3K7DA 3RKOF 1FR0A 5DQTA 1BDJB 3QW0A 3H65A 1ZHWA 3RIPA 3EPVA 3V5ZA 4EMLA 1ZW2A 3LS1A 3W2VA 4QIIA 3CQZA 1M2VA 2Y3BA 3DI5A 4E18A 2R9RB 1D1AA 2KC3A 1WASA 3ADDA 1CPRA 3DD7A 1HMDA 3GODA 3GM2A 1EA8A 2J45A 2LSEA 2R7UA 3RQGA 2PBPA 5COGA 5DQZA 3DXJF 2LFDA 3N0TA 1LE4A 5KYWB 4MW3A 3JTLO 1IW7F 4Z9HA 3U8VA 4CDVA 4QDLA 4EUKB 1M2OA 1KU2A 2LIGA 4MVQA 3AG1C 4FESA 1JPNA 1NU7D 4G78A 2PNOA 3EGXB 2H7VC 2H7OA 2FFHA 1ORSC 4N6CA 2NG1A 1C17M 2IXOA 2QY9A 1OCOC 4OIRF 4OD4A 3E9VA 3A4NA 3LLIA 2HMZA 3HINA 2DI3A 5L0FA 3A4LA 1LS4A 1FMWA 1U6HA 5JLIA 4CSAC 2EPMX 2YL0A 2GFHA 3RYLA 3TQOA 3F46A 4MVSA 4HFFB 3CSKA 4DVYP 2CDQA 3J06A 3K33A 3H02A 1ZYRF 3POVA 4NEKA 5L3QA 1AVOB 2CYDA 5FCLA 5KYUB 2D4UA 3Q6MA 2R7RA 4NTAA 2QQ3A 1MMNA 2KGOA 1PV3A 3B0UX 1HMOA 4CIPA 4I4ZA 4GEHA 3Q6NA 1Q0FA 1NG1A 2YL3A 3G64A 1HE9A 4UDVA 1M6TA 2X0CA 1CPQA 2UUIA 2CNWA 3GM3A 3MX3A 3U8PA 3L8JA 1L3PA 4U19A 2QUPA 1Y4CA 5JT4A 2LD6A 3EZIA 4JJFA 5BQHA 4R32A 4RBNA 3B0PA 2ZQRA 3TLFA 2B0HA 5CI8A 1KNYA 5JVEA 5C9GA 1GM5A 3V5YA 2IOQA 1NZEA 3QMKA 2R7SA 2L6GA 2B0JA 1NBBA 1VYIA 4D4NA 2XL4A 2R25A 4FWVA 4JOTA 2DYSC 1A7EA 3IQ5A 4YT8A 1MMDA 3C62A 1U89A 4YK5A 2NPUA 4IZCA 1CGNA 3UR3C 1QZXA 3PZKA 1OXKA 1WGWA 5B1AC 4XEFA 3AM1A 3T6BA 3OEOA 1V74B 5B1BC 2Q4FA 1L7CA 4MVUA 1YYJA 3KMIA 2BE5F 4IWBA 1APCA 3TOLA 2R05A 4KNVA 3R0OA 4JYLA 3MYBA 3BRJA 1LPEA 1GS9A 3U3BA 2VX2A 4MQ9F 1TWCA 1YDIA 4G7HF 5EK0A 3JSEO 3O6XA 1T6IA 2VB6A 3H2VA 4W8KA 3W8IB 3NKEA 4E7SA 4PR9A 4O79A 4HFKB 4AL0A 4A2NB 2NUTA 1LVKA 3B29A 4IAQA 5JBWA 2Y69C 3U5SA 3FOOA 1M2VB 2M4EA 4IRUA 4AL1A 1FMVA 2J46A 2YLIA 5K0IA 3FDQA 2IXMA 3GEEA 2Y3DA 4YJWA 4DJ9A 3LEOA 4HE8D 4K7BA 3GANA 3SXYA 1UG7A 4P6IC 4LERA 3NYJA 3T88A 2R03A 1UIYA 5L0DA 2QE9A 3S28A 1C03A 1LI7A 2IEXA 2KW3C 2BL2A 4U5BE 3EG9A 1RKEB 1WWPA 4I1OB 1NFNA 5DS5A 3WG7C 4BJ6A 3A4MA 3S90A 5EGYA 4P9TA 2C04A 4CJOA 4BJTA 2R7TA 1O3UA 4KNWA 4IB4A 3OA1A 3GORA 3DZAA 3RQFA 1VLSA 2X51A 3C8GA 4C7OB 4CS7A 2A6HF 3T9OA 4ULWA 3KKBA 4AK9A 4BJ6C 2Q7RA 2RSEB 2QLAA 3Q0JA 1OXBA 1EF8A 2HZ8A 3MFNA 2XL6A 5COFA 1O5HA 3EH1A 4XTKA 4X0RA 1EY3A 2EPOA 4ANJA 1QKRA 4IGGA 2QTVA 1TFOB 3RQEA 3IEEA 3QW1A 1M56C 1D1BA 1J8YF 5A6JA 1OR3A 4K3WA 2QNLA 3DJUB 5L3VA 1I4ZA 3AJMA 2AWCA 2AP3A 2F6QA 1Z63A 5JP7A 3VF0A 3M4BA 3L8IA 3IQTA 3B71A 1K40A 2XXAA 1C02A 1A41A 2ZPAA 3ATPA 4KI2A 1A0BA 2XLVA 5AC5A 3MYIA 4YL1A 3WHNA 4BG0A 1T9KA 4C3DA 4U5HA 3NMJA 4XQ1A 3GM1A 1OR2A 5KYYA 4LDRA 2R7OA 1OKKA 1E2XA 2YEVA 3US6A 4I44A 5DVWA 1S05A 2XSEA 3H2UA 2CGEA 4GYTA 4RD9A 4J7YA 3SEOA 3T89A 4K2NA 3TOMA 1F1MA 2ZXOA 3EHNA 5F5FA 3ZTZA 2DGJA 1JXZA 2Q00A 1NFOA 2KK1A 2KSFA 2VCCA 2XRHA 4I3MA 2OJED 5F5HA 3SNHA 4MW8A 2ICWG 2PP4A 3EGDA 1D0YA 2WZLA 3FXHA 4PJJA 3A9CA 4AE4B 2DUBA 1QVXA 2J7PA 4BJ5A 2ETSA 3S84A 2UZFA 1G5ZA 4JCHA 3RSIA 2BC5A 3C18A 4JTAB 1AEPA 2P61A 3KL4A 5D91A 4MVZA 1FAPB 2YLDA 3DM9B 2H7BA 2DYRC 5L0GA 1JRAA 3DE9A 3N24A 3HRXA 3M4CA 1YYXA 2D5RB 4DVZA 5HSWA 2HV6A 3HKKA 4O6YA 1FNTc 5L0JA 2YRFA 3ZWIA 2YHSA 1T5OA 1V54C 4ER9A 1VB5A 3HNKA 2CNWD 4MVMA 3RVYA 2EPKX 2UUHA 5JSLA 3VM6A 4E0IA 4Q4ZF 5BUOA 3GWNA 4JVSA 5KYNA 2KNHA 1BR1A 1D1CA 2VC9A 4U5GA 2OKUA 4MNDA 2YL7A 4JEAA 2NUPA 2A0BA 5D92A 4DBRA 3RVZA 3ASNC 4OD5A 4CS8A 4CBEA 1PD1A 3M15A 3Q0GA 3T6JA 2G62A 1GQAA 4DRHB 1BZ4A 1WZ8A 3DMDA 2HJ3A 3G50A 3M1CB 2KJGA 3B9QA 2GDCA 4QI2A 2Q9BA 2KQ9A 5COMA 1RJ9B 3S0XA 4XPYA 3SYNA 4CS8C 1EI7A 2NSFA 3LNRA 3KPHA 2YVKA 4I1MA 5KYXB 3ZIBA 1TFKB 4IJJA 1ORYA 5JUAA 3C8ZA 1XZPA 3SXMA 3QK8A 1HZDA 3LAYA 2OEXA 5A6BD 2WVOA 2EIJC 1Z23A 2HV7A 4DBQA 1PD0A 3S27A 1QSPA 3TJ5A 3A11A 4JC7A 1VTMP 2L9JA 1Q0KA 2LCHA 2J9WA 2OU6A 2VASA 4PACA 2PF4E 3JYHA 2J9BA 4NC3A 1QLEC 3FVYA 1IZMA 3I4UA 4O6NA 3ADCA 3ITFA 2R02A 3K66A 2OOCA 4J32B 2Y3GA 1NZYB 1TWGA 1NU9C 3R9TA 3LNMB 4EBJA 1YLMA 1ZHTA 4U5FE 3AGUA 1ZVZA 4E17A 2ASRA 4JEBA 2XXAB 5A6KA 3IQ6A 3H81A 1H6GA 2C03A 4G7OF 5KJPA 5KYYB 4CIHA 2GA0A 2Q9AA 3GWLA 4IZBA 4JCSA 3MBGA 4RDAA 5L0HA 3SLLA 3FDUA 4JE9A 5E3CA 3EFOB 2JPUA 4OIOF 5KYWA 4FX5A 2FGYA 1GGQA 2XS1A 1A7VA 3IPMO 3TULA 3GEIA 3ECSA 4EBKA 4LDKA 1VOMA 4NNQA 4O7GA 2HW5A 4U5CE 1HW2A 3U3FA 1Q0MA 4NTFA 1FFHA 3W4YA 1LM3B 3AQCA 3C8GD 3ZG1A 1WTYA 3Q7GA 3DM5A 4U9DA 3L0IA 4YL0A 1QPUA 3EGXA 2JD3A 4D4XA 3JSZA 1SMYF 5HV9A 1SZIA 3DKAA 3ZVRA 3U2MA 2XLWA 2WB7A 3W2WA 2HKVA 3ABLC 1R4TA 2OG2A 2IM8A 3G4ZA 3KH2A 2PPYA 2W4BA 3L1MA 1G4WR 1LKXA 3VRCA 5JS5A 2P63A 3EZHA 5E3AA 5L0IA 2L6HA 3SWXA 4MVOA 4ZLCA 2A6EF 1WATA 4G0HA 4NTBA 2IBFA 3R9SA 2I15A 4U5DE 1WOLA 1YA9A 4C3EA 1LS1A 1OCRC 2P6VA 3G4XA 4PJMA 1OW6A 3RFYA 1Y6DA 4OG1A 3CAXA 1T01A 1OKKD 3KQFA 2XM0A 1LIHA 3U9MA 3O55A 1T6QA 2EILC 2L6FA 2LQGA 1RKCA 1YARO 4YL3A 3V7OA 4KBLA 2G3KA 1JAFA 4MOUA 4A4AA 4ZLDA 3ZTMA 3O10A 2WVQA 5FZTA 4U1AA 1OW7A 1DOVA 2AVKA 2VCAA 3SXKA 2P1AA 4L6RA 3RW0A 4OIPF 1ZW3A 2L81A 5BQGA 2Z15A 4OLQA 2WZFA 1SYQA 1VYKA 4JJGA 5BQIA 5DLJA 1DOWA 2J7PD 3TJ6A 4XLNF 2HMQA 5L0CA 1E86A 1UX4A 1RXQA 3OC7A 2M64A 3K1IA 4GEHB 1MNDA 5AC4A 4Q7CA 4JTCB 4JFCA 5DS4A 4QI0A 2YQYA 3NYMA 2YLGA 3FMSA 2KYHA 2XS8A 2NSGA 2TMVP 3LESA 1H7IA 3K1IC 3MLGA 4K1OA 2WZGA 2LK4A 2ZXRA 4CJGA 2YWAA 3UNGC 1W2WA 1UX5A 4W8PA 4PFOA 1MMGA 3AGTA 2A69F 2Q3TA 2Y39A 3MOYA 2LFFA 3U9JA 3BEHA 4BPMA 5F28E 1VLTA 2HSQA 1V4AA 2F22A 1RJMA 2J0XA 3MYFA 2R7VA 4BEMJ 1HW1A 2L7AA 4PJNA 5JRAA 1OCZC 2CCYA 4BJ1A 3UGOA 2ZXPA 1E83A 1EF9A 2O9XA 4JZAA 3ZQYA 4IARA 4M63A 2ZQQA 1OW8A 3WODF 3S29A 2HUJA 2R7WA 1M57C 4KC9A 4YT4A 4BJ5C 3OWTA 1JMWA 1HY5A 4OINF 4ELSA 3AQBA 1ZU5A 3ABKC 2EPLX 3UMKA 1YJGA 1CGME 1TKNA 3P5MA 4WABA 3W8HA 3CZ6A 3HNLA 2XM4A 3CEXA 1Q0GA 1DUBA 3V5XA 3HLZA 1RKEA 2IXPA 2OQMA 3U0CA 3C7JA 3JRTA 3SXZA 3WAQA 4F4BA 3FAPB 1VK5A 1YVIA 5DS6A 3X1OA 1G4US 2MWQA 1MQVA 1JOGA 2NUTB 4ELWA 4CSAA 4JURI 3HNJA 5IY5C 1DCIA 3R2PA 2W9YA 4C7OA 4O6MA 4JIOA 5EHHA 1Q52A 1FTSA 2HS5A 2IYLD 4BEJA 4ELXA 1JPJA 3DAGA 3LLKA 2YKZA 4LLCA 3HNIA 4WJ0A 3AG2C 1YA7O 2XLOA 4JRZA 1EKYA 1U0BB 1TWAA 4G7ZF 4FZWA 2J9UA 4H54A 3EG9B 1BR4A 3QZCA 5CIVA 2P0NA 2DB4A 3K1HA 3AG4C 1CGOA 2A68F 3LUTB 4YT5A 4K0DA 3DAFA 1RCPA 3JZ0A 1E84A 3ADBA 4EIYA 2J0WA 1H9GA 2YL1A 3ZQVA 4FZWC 4CS9A 2V26A 1HE1A 3PHF2 3NMIA 2LP4A 3C8GB 3ASOC 2VH3A 3M79A 4N4WA 3AG3C 4QIJA 3VYWA 4MI2A 4JWVA 4P9FA 4DRIB 2XLEA 2PX3A 1H9TA 3F47A 3ZC4A 2GWWA 1MNEA 3TRRA 4CS9C 2H8AA 1SR2A 3AOUA 3KYJA 3QVZA 1K05A 3NMKA 1YZCA 5A6AA 2EIKC 2Y3HA 1Z7Qc 3QXZA 2EPNA 2W45A 3RF3A 3PDMP 1Z6AA 1B68A 4EKWA 1TQGA 3U2LA 2OJQA 2XLMA 1XWJA 1LI5A 4IAOA 4YN0B 2R7QA 1ST6A 4AE4A 3LS0A 2AWYA 3I47A 1UFBA 3ZSUA 4NQFA 1R5ID 2AU5A 2GAQA 3L34A 3N2ZB 2VCBA 4XPWA 4AX2A 2E87A 4MVRA 1ZU4A 1G8XA 4NY3A 4N6HA 3SZRA 1Y64B 1NSGB 4I42A 1VMAA 1A7DA 2PFDA 3FAJA 4LDQA 4XEVA 4C3BA 2GTRA 2MHRA 1Z3IX 4EHPA 3C63A 3TK0A 5A6BA 3T4RA 3IRBA 4J7TA 1V55C 4EWCA 5T3TA 4B6IA 2HJMA 3UMHA 1Q51A 4ONSA 2J8WA 2IXNA 1YZAA 3JYYA 2XLHA 4PJLA 2OCCC 1WN0A 4XPXA 1D0ZA 5GPGB 2A0UA 3EGDB 1BR2A 2PBEA 4DRJB 2I8BA 2XLDA 4JCZA 4PFPA 4YT2A 5E2QA 4I52A 4Q5SF 4WGYA 3IHUA 4XLPF 2FW2A 3TD7A 3GEHA 2G3VA 1XZQA 2JX0A 3EQLF 3LJBA 3NG1A 4HEAJ 1KTMA 4GQHA 1O87A 3JT1A 4WGZA 1LE2A 2ZD9A 3QXIA 3ABMC 3RH3A 1T6UA 1S7ZA 4CDYA 5JBXA 1BBHA 1TWHA 1ZHXA 2WVNA 3QTHA 1ORJA 4Z9IA 3EHMA 5E33A 3T6GB 1PCXA 2HFIA 4DOZA 3ZDLA 2W4MA 4U18A 1RMVA 1SF8A 1ZHZA 1I4YA 2J9VA 4XWJA 5CI9A 1MJ3A 4JTDB 1RJ9A 4ULVA 5T3WA 4YWQA 5KYUA 5AGFA 3I5QA 3W8HB 4IZDA 3O4XE 4CDAA 3R7CA 4U9EA 5KYXA 4JW1A 4E0HA 1AUEA 4H4KC 4MS2A 4J30B 3NYLA 3HJCA 2VREA 1OQCA 4PK4A 3UMIA 2PX0A 3Q7LA 1MMAA 3IQCA 3QVYA 1NLXA 5T1DB 256BA 2EIMC 5B3IA 3X2QC 4FJWD 2NUPB 1I5NA 4MTGA 3UGPA 1Z5ZA 2RD9A 4WCZA 3VAYA 3PCVA 2FBMA 2EJ5A 4ZU2A 4OIQF 3NKDA 3HTKC 2V3CC 4NCQA 3KYIA 2EINC 1ZHYA 4EBBA 4E7ZA 4Z9JA 3NDBB 3Q1TA 4KNPA 3DWWA 4FAPB 4LACB 4MTFA 4CX9A 3E70C 3SP1A 1NZYA 3PMRA 2A1DD 5B3SC 2ZXWC 2YZSA 1D0XA 1J8MF 2P7VA 2MYSA 2Q9CA 1TR2A 1YAUO 4U5EE 1Q0DA 1E85A 2CW0F 3DJNB 1N1CA 3FHDA 3LEVA 5A69A 1OCCC 3K6BA 1EQ1A 4DXWA 1RJNA 4N06A 2R7XA 3NRHA 3EH2A 1ZZPA 2FAPB 1JR8A 2XL8A 2OEVA 3I5PA
chains in the Genus database with same CATH topology
1WWPA 3L8JA 3GM1A 3A4MA 2HSBA 3BRJA 2P63A 1OW8A 3S9OA 1O3UA 2L6HA 1K04A 1UX4A 2JX0A 4XEKA 3K7DA 4R32A 4GEHB 1KTMA 3RQFA 1UFBA 3A4NA 4NQFA 3C8GA 3W8IB 3A4LA 1WOLA 1KNYA 2Q00A 2JPUA 2KK1A 1OW6A 2L6GA 3JZ0A 3TULA 1Y64B 3MFNA 3ADBA 4XEVA 3ADDA 4EBKA 4NNQA 2LK4A 2L6FA 3U0CA 2YWAA 3GM2A 3W8HB 3U3FA 1QVXA 1UX5A 3O4XE 3IRBA 3RQEA 3C8GB 3ADCA 3O10A 3C8GD 3RQGA 1WTYA 3C18A 1OW7A 1JOGA 3AJMA 5F28E 3JYYA 1PV3A 4XEFA 1V4AA 4EBJA 1RJMA 3AM1A 3L8IA 3B71A 1K40A 1ZZPA 1K05A 2PBEA 3GM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZ0 A;  1KTM A;  3TUL A;  1WTY A;  3C18 A;  1WWP A;  3RQF A;  1OW7 A;  3MFN A;  3L8J A;  1UFB A;  1JOG A;  3AJM A;  4XEV A;  4NQF A;  3GM1 A;  3C8G A;  4EBK A;  5F28 E;  3JYY A;  1PV3 A;  3W8I B;  2LK4 A;  2L6F A;  4XEF A;  2HSB A;  3U0C A;  2YWA A;  1V4A A;  4EBJ A;  3BRJ A;  1WOL A;  3GM2 A;  1KNY A;  3L8I A;  3W8H B;  1OW8 A;  1K40 A;  1ZZP A;  2Q00 A;  1QVX A;  3B71 A;  3S9O A;  3U3F A;  1O3U A;  2L6H A;  1K04 A;  2JPU A;  2JX0 A;  2KK1 A;  4XEK A;  3RQE A;  3C8G B;  1OW6 A;  1K05 A;  2L6G A;  2PBE A;  3O10 A;  3K7D A;  4R32 A;  4GEH B;  3C8G D;  3RQG A;  3GM3 A; 
#chains in the Genus database with same CATH topology
 3EFO A;  3O39 A;  3B0V C;  4LLE A;  3T8A A;  1QQ3 A;  2WL8 A;  2HSB A;  1FFT C;  3JCU Q;  5TJ5 E;  3S9O A;  3JRM O;  3DE8 A;  1K04 A;  3FOP A;  3EJN A;  4JKV A;  4XEK A;  4F47 A;  3W8I A;  4MTO A;  3K7D A;  3RKO F;  1FR0 A;  5DQT A;  1BDJ B;  3QW0 A;  3H65 A;  1ZHW A;  3RIP A;  3EPV A;  3V5Z A;  4EML A;  1ZW2 A;  3LS1 A;  3W2V A;  4QII A;  3CQZ A;  1M2V A;  2Y3B A;  3DI5 A;  4E18 A;  2R9R B;  1D1A A;  2KC3 A;  1WAS A;  3ADD A;  1CPR A;  3DD7 A;  1HMD A;  3GOD A;  3GM2 A;  1EA8 A;  2J45 A;  2LSE A;  2R7U A;  3RQG A;  2PBP A;  5COG A;  5DQZ A;  3DXJ F;  2LFD A;  3N0T A;  1LE4 A;  5KYW B;  4MW3 A;  3JTL O;  1IW7 F;  4Z9H A;  3U8V A;  4CDV A;  4QDL A;  4EUK B;  1M2O A;  1KU2 A;  2LIG A;  4MVQ A;  3AG1 C;  4FES A;  1JPN A;  1NU7 D;  4G78 A;  2PNO A;  3EGX B;  2H7V C;  2H7O A;  2FFH A;  1ORS C;  4N6C A;  2NG1 A;  1C17 M;  2IXO A;  2QY9 A;  1OCO C;  4OIR F;  4OD4 A;  3E9V A;  3A4N A;  3LLI A;  2HMZ A;  3HIN A;  2DI3 A;  5L0F A;  3A4L A;  1LS4 A;  1FMW A;  1U6H A;  5JLI A;  4CSA C;  2EPM X;  2YL0 A;  2GFH A;  3RYL A;  3TQO A;  3F46 A;  4MVS A;  4HFF B;  3CSK A;  4DVY P;  2CDQ A;  3J06 A;  3K33 A;  3H02 A;  1ZYR F;  3POV A;  4NEK A;  5L3Q A;  1AVO B;  2CYD A;  5FCL A;  5KYU B;  2D4U A;  3Q6M A;  2R7R A;  4NTA A;  2QQ3 A;  1MMN A;  2KGO A;  1PV3 A;  3B0U X;  1HMO A;  4CIP A;  4I4Z A;  4GEH A;  3Q6N A;  1Q0F A;  1NG1 A;  2YL3 A;  3G64 A;  1HE9 A;  4UDV A;  1M6T A;  2X0C A;  1CPQ A;  2UUI A;  2CNW A;  3GM3 A;  3MX3 A;  3U8P A;  3L8J A;  1L3P A;  4U19 A;  2QUP A;  1Y4C A;  5JT4 A;  2LD6 A;  3EZI A;  4JJF A;  5BQH A;  4R32 A;  4RBN A;  3B0P A;  2ZQR A;  3TLF A;  2B0H A;  5CI8 A;  1KNY A;  5JVE A;  5C9G A;  1GM5 A;  3V5Y A;  2IOQ A;  1NZE A;  3QMK A;  2R7S A;  2L6G A;  2B0J A;  1NBB A;  1VYI A;  4D4N A;  2XL4 A;  2R25 A;  4FWV A;  4JOT A;  2DYS C;  1A7E A;  3IQ5 A;  4YT8 A;  1MMD A;  3C62 A;  1U89 A;  4YK5 A;  2NPU A;  4IZC A;  1CGN A;  3UR3 C;  1QZX A;  3PZK A;  1OXK A;  1WGW A;  5B1A C;  4XEF A;  3AM1 A;  3T6B A;  3OEO A;  1V74 B;  5B1B C;  2Q4F A;  1L7C A;  4MVU A;  1YYJ A;  3KMI A;  2BE5 F;  4IWB A;  1APC A;  3TOL A;  2R05 A;  4KNV A;  3R0O A;  4JYL A;  3MYB A;  3BRJ A;  1LPE A;  1GS9 A;  3U3B A;  2VX2 A;  4MQ9 F;  1TWC A;  1YDI A;  4G7H F;  5EK0 A;  3JSE O;  3O6X A;  1T6I A;  2VB6 A;  3H2V A;  4W8K A;  3W8I B;  3NKE A;  4E7S A;  4PR9 A;  4O79 A;  4HFK B;  4AL0 A;  4A2N B;  2NUT A;  1LVK A;  3B29 A;  4IAQ A;  5JBW A;  2Y69 C;  3U5S A;  3FOO A;  1M2V B;  2M4E A;  4IRU A;  4AL1 A;  1FMV A;  2J46 A;  2YLI A;  5K0I A;  3FDQ A;  2IXM A;  3GEE A;  2Y3D A;  4YJW A;  4DJ9 A;  3LEO A;  4HE8 D;  4K7B A;  3GAN A;  3SXY A;  1UG7 A;  4P6I C;  4LER A;  3NYJ A;  3T88 A;  2R03 A;  1UIY A;  5L0D A;  2QE9 A;  3S28 A;  1C03 A;  1LI7 A;  2IEX A;  2KW3 C;  2BL2 A;  4U5B E;  3EG9 A;  1RKE B;  1WWP A;  4I1O B;  1NFN A;  5DS5 A;  3WG7 C;  4BJ6 A;  3A4M A;  3S90 A;  5EGY A;  4P9T A;  2C04 A;  4CJO A;  4BJT A;  2R7T A;  1O3U A;  4KNW A;  4IB4 A;  3OA1 A;  3GOR A;  3DZA A;  3RQF A;  1VLS A;  2X51 A;  3C8G A;  4C7O B;  4CS7 A;  2A6H F;  3T9O A;  4ULW A;  3KKB A;  4AK9 A;  4BJ6 C;  2Q7R A;  2RSE B;  2QLA A;  3Q0J A;  1OXB A;  1EF8 A;  2HZ8 A;  3MFN A;  2XL6 A;  5COF A;  1O5H A;  3EH1 A;  4XTK A;  4X0R A;  1EY3 A;  2EPO A;  4ANJ A;  1QKR A;  4IGG A;  2QTV A;  1TFO B;  3RQE A;  3IEE A;  3QW1 A;  1M56 C;  1D1B A;  1J8Y F;  5A6J A;  1OR3 A;  4K3W A;  2QNL A;  3DJU B;  5L3V A;  1I4Z A;  3AJM A;  2AWC A;  2AP3 A;  2F6Q A;  1Z63 A;  5JP7 A;  3VF0 A;  3M4B A;  3L8I A;  3IQT A;  3B71 A;  1K40 A;  2XXA A;  1C02 A;  1A41 A;  2ZPA A;  3ATP A;  4KI2 A;  1A0B A;  2XLV A;  5AC5 A;  3MYI A;  4YL1 A;  3WHN A;  4BG0 A;  1T9K A;  4C3D A;  4U5H A;  3NMJ A;  4XQ1 A;  3GM1 A;  1OR2 A;  5KYY A;  4LDR A;  2R7O A;  1OKK A;  1E2X A;  2YEV A;  3US6 A;  4I44 A;  5DVW A;  1S05 A;  2XSE A;  3H2U A;  2CGE A;  4GYT A;  4RD9 A;  4J7Y A;  3SEO A;  3T89 A;  4K2N A;  3TOM A;  1F1M A;  2ZXO A;  3EHN A;  5F5F A;  3ZTZ A;  2DGJ A;  1JXZ A;  2Q00 A;  1NFO A;  2KK1 A;  2KSF A;  2VCC A;  2XRH A;  4I3M A;  2OJE D;  5F5H A;  3SNH A;  4MW8 A;  2ICW G;  2PP4 A;  3EGD A;  1D0Y A;  2WZL A;  3FXH A;  4PJJ A;  3A9C A;  4AE4 B;  2DUB A;  1QVX A;  2J7P A;  4BJ5 A;  2ETS A;  3S84 A;  2UZF A;  1G5Z A;  4JCH A;  3RSI A;  2BC5 A;  3C18 A;  4JTA B;  1AEP A;  2P61 A;  3KL4 A;  5D91 A;  4MVZ A;  1FAP B;  2YLD A;  3DM9 B;  2H7B A;  2DYR C;  5L0G A;  1JRA A;  3DE9 A;  3N24 A;  3HRX A;  3M4C A;  1YYX A;  2D5R B;  4DVZ A;  5HSW A;  2HV6 A;  3HKK A;  4O6Y A;  1FNT c;  5L0J A;  2YRF A;  3ZWI A;  2YHS A;  1T5O A;  1V54 C;  4ER9 A;  1VB5 A;  3HNK A;  2CNW D;  4MVM A;  3RVY A;  2EPK X;  2UUH A;  5JSL A;  3VM6 A;  4E0I A;  4Q4Z F;  5BUO A;  3GWN A;  4JVS A;  5KYN A;  2KNH A;  1BR1 A;  1D1C A;  2VC9 A;  4U5G A;  2OKU A;  4MND A;  2YL7 A;  4JEA A;  2NUP A;  2A0B A;  5D92 A;  4DBR A;  3RVZ A;  3ASN C;  4OD5 A;  4CS8 A;  4CBE A;  1PD1 A;  3M15 A;  3Q0G A;  3T6J A;  2G62 A;  1GQA A;  4DRH B;  1BZ4 A;  1WZ8 A;  3DMD A;  2HJ3 A;  3G50 A;  3M1C B;  2KJG A;  3B9Q A;  2GDC A;  4QI2 A;  2Q9B A;  2KQ9 A;  5COM A;  1RJ9 B;  3S0X A;  4XPY A;  3SYN A;  4CS8 C;  1EI7 A;  2NSF A;  3LNR A;  3KPH A;  2YVK A;  4I1M A;  5KYX B;  3ZIB A;  1TFK B;  4IJJ A;  1ORY A;  5JUA A;  3C8Z A;  1XZP A;  3SXM A;  3QK8 A;  1HZD A;  3LAY A;  2OEX A;  5A6B D;  2WVO A;  2EIJ C;  1Z23 A;  2HV7 A;  4DBQ A;  1PD0 A;  3S27 A;  1QSP A;  3TJ5 A;  3A11 A;  4JC7 A;  1VTM P;  2L9J A;  1Q0K A;  2LCH A;  2J9W A;  2OU6 A;  2VAS A;  4PAC A;  2PF4 E;  3JYH A;  2J9B A;  4NC3 A;  1QLE C;  3FVY A;  1IZM A;  3I4U A;  4O6N A;  3ADC A;  3ITF A;  2R02 A;  3K66 A;  2OOC A;  4J32 B;  2Y3G A;  1NZY B;  1TWG A;  1NU9 C;  3R9T A;  3LNM B;  4EBJ A;  1YLM A;  1ZHT A;  4U5F E;  3AGU A;  1ZVZ A;  4E17 A;  2ASR A;  4JEB A;  2XXA B;  5A6K A;  3IQ6 A;  3H81 A;  1H6G A;  2C03 A;  4G7O F;  5KJP A;  5KYY B;  4CIH A;  2GA0 A;  2Q9A A;  3GWL A;  4IZB A;  4JCS A;  3MBG A;  4RDA A;  5L0H A;  3SLL A;  3FDU A;  4JE9 A;  5E3C A;  3EFO B;  2JPU A;  4OIO F;  5KYW A;  4FX5 A;  2FGY A;  1GGQ A;  2XS1 A;  1A7V A;  3IPM O;  3TUL A;  3GEI A;  3ECS A;  4EBK A;  4LDK A;  1VOM A;  4NNQ A;  4O7G A;  2HW5 A;  4U5C E;  1HW2 A;  3U3F A;  1Q0M A;  4NTF A;  1FFH A;  3W4Y A;  1LM3 B;  3AQC A;  3C8G D;  3ZG1 A;  1WTY A;  3Q7G A;  3DM5 A;  4U9D A;  3L0I A;  4YL0 A;  1QPU A;  3EGX A;  2JD3 A;  4D4X A;  3JSZ A;  1SMY F;  5HV9 A;  1SZI A;  3DKA A;  3ZVR A;  3U2M A;  2XLW A;  2WB7 A;  3W2W A;  2HKV A;  3ABL C;  1R4T A;  2OG2 A;  2IM8 A;  3G4Z A;  3KH2 A;  2PPY A;  2W4B A;  3L1M A;  1G4W R;  1LKX A;  3VRC A;  5JS5 A;  2P63 A;  3EZH A;  5E3A A;  5L0I A;  2L6H A;  3SWX A;  4MVO A;  4ZLC A;  2A6E F;  1WAT A;  4G0H A;  4NTB A;  2IBF A;  3R9S A;  2I15 A;  4U5D E;  1WOL A;  1YA9 A;  4C3E A;  1LS1 A;  1OCR C;  2P6V A;  3G4X A;  4PJM A;  1OW6 A;  3RFY A;  1Y6D A;  4OG1 A;  3CAX A;  1T01 A;  1OKK D;  3KQF A;  2XM0 A;  1LIH A;  3U9M A;  3O55 A;  1T6Q A;  2EIL C;  2L6F A;  2LQG A;  1RKC A;  1YAR O;  4YL3 A;  3V7O A;  4KBL A;  2G3K A;  1JAF A;  4MOU A;  4A4A A;  4ZLD A;  3ZTM A;  3O10 A;  2WVQ A;  5FZT A;  4U1A A;  1OW7 A;  1DOV A;  2AVK A;  2VCA A;  3SXK A;  2P1A A;  4L6R A;  3RW0 A;  4OIP F;  1ZW3 A;  2L81 A;  5BQG A;  2Z15 A;  4OLQ A;  2WZF A;  1SYQ A;  1VYK A;  4JJG A;  5BQI A;  5DLJ A;  1DOW A;  2J7P D;  3TJ6 A;  4XLN F;  2HMQ A;  5L0C A;  1E86 A;  1UX4 A;  1RXQ A;  3OC7 A;  2M64 A;  3K1I A;  4GEH B;  1MND A;  5AC4 A;  4Q7C A;  4JTC B;  4JFC A;  5DS4 A;  4QI0 A;  2YQY A;  3NYM A;  2YLG A;  3FMS A;  2KYH A;  2XS8 A;  2NSG A;  2TMV P;  3LES A;  1H7I A;  3K1I C;  3MLG A;  4K1O A;  2WZG A;  2LK4 A;  2ZXR A;  4CJG A;  2YWA A;  3UNG C;  1W2W A;  1UX5 A;  4W8P A;  4PFO A;  1MMG A;  3AGT A;  2A69 F;  2Q3T A;  2Y39 A;  3MOY A;  2LFF A;  3U9J A;  3BEH A;  4BPM A;  5F28 E;  1VLT A;  2HSQ A;  1V4A A;  2F22 A;  1RJM A;  2J0X A;  3MYF A;  2R7V A;  4BEM J;  1HW1 A;  2L7A A;  4PJN A;  5JRA A;  1OCZ C;  2CCY A;  4BJ1 A;  3UGO A;  2ZXP A;  1E83 A;  1EF9 A;  2O9X A;  4JZA A;  3ZQY A;  4IAR A;  4M63 A;  2ZQQ A;  1OW8 A;  3WOD F;  3S29 A;  2HUJ A;  2R7W A;  1M57 C;  4KC9 A;  4YT4 A;  4BJ5 C;  3OWT A;  1JMW A;  1HY5 A;  4OIN F;  4ELS A;  3AQB A;  1ZU5 A;  3ABK C;  2EPL X;  3UMK A;  1YJG A;  1CGM E;  1TKN A;  3P5M A;  4WAB A;  3W8H A;  3CZ6 A;  3HNL A;  2XM4 A;  3CEX A;  1Q0G A;  1DUB A;  3V5X A;  3HLZ A;  1RKE A;  2IXP A;  2OQM A;  3U0C A;  3C7J A;  3JRT A;  3SXZ A;  3WAQ A;  4F4B A;  3FAP B;  1VK5 A;  1YVI A;  5DS6 A;  3X1O A;  1G4U S;  2MWQ A;  1MQV A;  1JOG A;  2NUT B;  4ELW A;  4CSA A;  4JUR I;  3HNJ A;  5IY5 C;  1DCI A;  3R2P A;  2W9Y A;  4C7O A;  4O6M A;  4JIO A;  5EHH A;  1Q52 A;  1FTS A;  2HS5 A;  2IYL D;  4BEJ A;  4ELX A;  1JPJ A;  3DAG A;  3LLK A;  2YKZ A;  4LLC A;  3HNI A;  4WJ0 A;  3AG2 C;  1YA7 O;  2XLO A;  4JRZ A;  1EKY A;  1U0B B;  1TWA A;  4G7Z F;  4FZW A;  2J9U A;  4H54 A;  3EG9 B;  1BR4 A;  3QZC A;  5CIV A;  2P0N A;  2DB4 A;  3K1H A;  3AG4 C;  1CGO A;  2A68 F;  3LUT B;  4YT5 A;  4K0D A;  3DAF A;  1RCP A;  3JZ0 A;  1E84 A;  3ADB A;  4EIY A;  2J0W A;  1H9G A;  2YL1 A;  3ZQV A;  4FZW C;  4CS9 A;  2V26 A;  1HE1 A;  3PHF 2;  3NMI A;  2LP4 A;  3C8G B;  3ASO C;  2VH3 A;  3M79 A;  4N4W A;  3AG3 C;  4QIJ A;  3VYW A;  4MI2 A;  4JWV A;  4P9F A;  4DRI B;  2XLE A;  2PX3 A;  1H9T A;  3F47 A;  3ZC4 A;  2GWW A;  1MNE A;  3TRR A;  4CS9 C;  2H8A A;  1SR2 A;  3AOU A;  3KYJ A;  3QVZ A;  1K05 A;  3NMK A;  1YZC A;  5A6A A;  2EIK C;  2Y3H A;  1Z7Q c;  3QXZ A;  2EPN A;  2W45 A;  3RF3 A;  3PDM P;  1Z6A A;  1B68 A;  4EKW A;  1TQG A;  3U2L A;  2OJQ A;  2XLM A;  1XWJ A;  1LI5 A;  4IAO A;  4YN0 B;  2R7Q A;  1ST6 A;  4AE4 A;  3LS0 A;  2AWY A;  3I47 A;  1UFB A;  3ZSU A;  4NQF A;  1R5I D;  2AU5 A;  2GAQ A;  3L34 A;  3N2Z B;  2VCB A;  4XPW A;  4AX2 A;  2E87 A;  4MVR A;  1ZU4 A;  1G8X A;  4NY3 A;  4N6H A;  3SZR A;  1Y64 B;  1NSG B;  4I42 A;  1VMA A;  1A7D A;  2PFD A;  3FAJ A;  4LDQ A;  4XEV A;  4C3B A;  2GTR A;  2MHR A;  1Z3I X;  4EHP A;  3C63 A;  3TK0 A;  5A6B A;  3T4R A;  3IRB A;  4J7T A;  1V55 C;  4EWC A;  5T3T A;  4B6I A;  2HJM A;  3UMH A;  1Q51 A;  4ONS A;  2J8W A;  2IXN A;  1YZA A;  3JYY A;  2XLH A;  4PJL A;  2OCC C;  1WN0 A;  4XPX A;  1D0Z A;  5GPG B;  2A0U A;  3EGD B;  1BR2 A;  2PBE A;  4DRJ B;  2I8B A;  2XLD A;  4JCZ A;  4PFP A;  4YT2 A;  5E2Q A;  4I52 A;  4Q5S F;  4WGY A;  3IHU A;  4XLP F;  2FW2 A;  3TD7 A;  3GEH A;  2G3V A;  1XZQ A;  2JX0 A;  3EQL F;  3LJB A;  3NG1 A;  4HEA J;  1KTM A;  4GQH A;  1O87 A;  3JT1 A;  4WGZ A;  1LE2 A;  2ZD9 A;  3QXI A;  3ABM C;  3RH3 A;  1T6U A;  1S7Z A;  4CDY A;  5JBX A;  1BBH A;  1TWH A;  1ZHX A;  2WVN A;  3QTH A;  1ORJ A;  4Z9I A;  3EHM A;  5E33 A;  3T6G B;  1PCX A;  2HFI A;  4DOZ A;  3ZDL A;  2W4M A;  4U18 A;  1RMV A;  1SF8 A;  1ZHZ A;  1I4Y A;  2J9V A;  4XWJ A;  5CI9 A;  1MJ3 A;  4JTD B;  1RJ9 A;  4ULV A;  5T3W A;  4YWQ A;  5KYU A;  5AGF A;  3I5Q A;  3W8H B;  4IZD A;  3O4X E;  4CDA A;  3R7C A;  4U9E A;  5KYX A;  4JW1 A;  4E0H A;  1AUE A;  4H4K C;  4MS2 A;  4J30 B;  3NYL A;  3HJC A;  2VRE A;  1OQC A;  4PK4 A;  3UMI A;  2PX0 A;  3Q7L A;  1MMA A;  3IQC A;  3QVY A;  1NLX A;  5T1D B;  256B A;  2EIM C;  5B3I A;  3X2Q C;  4FJW D;  2NUP B;  1I5N A;  4MTG A;  3UGP A;  1Z5Z A;  2RD9 A;  4WCZ A;  3VAY A;  3PCV A;  2FBM A;  2EJ5 A;  4ZU2 A;  4OIQ F;  3NKD A;  3HTK C;  2V3C C;  4NCQ A;  3KYI A;  2EIN C;  1ZHY A;  4EBB A;  4E7Z A;  4Z9J A;  3NDB B;  3Q1T A;  4KNP A;  3DWW A;  4FAP B;  4LAC B;  4MTF A;  4CX9 A;  3E70 C;  3SP1 A;  1NZY A;  3PMR A;  2A1D D;  5B3S C;  2ZXW C;  2YZS A;  1D0X A;  1J8M F;  2P7V A;  2MYS A;  2Q9C A;  1TR2 A;  1YAU O;  4U5E E;  1Q0D A;  1E85 A;  2CW0 F;  3DJN B;  1N1C A;  3FHD A;  3LEV A;  5A69 A;  1OCC C;  3K6B A;  1EQ1 A;  4DXW A;  1RJN A;  4N06 A;  2R7X A;  3NRH A;  3EH2 A;  1ZZP A;  2FAP B;  1JR8 A;  2XL8 A;  2OEV A;  3I5P A; 
#chains in the Genus database with same CATH homology
 1WWP A;  3L8J A;  3GM1 A;  3A4M A;  2HSB A;  3BRJ A;  2P63 A;  1OW8 A;  3S9O A;  1O3U A;  2L6H A;  1K04 A;  1UX4 A;  2JX0 A;  4XEK A;  3K7D A;  4R32 A;  4GEH B;  1KTM A;  3RQF A;  1UFB A;  3A4N A;  4NQF A;  3C8G A;  3W8I B;  3A4L A;  1WOL A;  1KNY A;  2Q00 A;  2JPU A;  2KK1 A;  1OW6 A;  2L6G A;  3JZ0 A;  3TUL A;  1Y64 B;  3MFN A;  3ADB A;  4XEV A;  3ADD A;  4EBK A;  4NNQ A;  2LK4 A;  2L6F A;  3U0C A;  2YWA A;  3GM2 A;  3W8H B;  3U3F A;  1QVX A;  1UX5 A;  3O4X E;  3IRB A;  3RQE A;  3C8G B;  3ADC A;  3O10 A;  3C8G D;  3RQG A;  1WTY A;  3C18 A;  1OW7 A;  1JOG A;  3AJM A;  5F28 E;  3JYY A;  1PV3 A;  4XEF A;  1V4A A;  4EBJ A;  1RJM A;  3AM1 A;  3L8I A;  3B71 A;  1K40 A;  1ZZP A;  1K05 A;  2PBE A;  3GM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...