3L8IA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
b'TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8iA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8iA02
3AJMA 3GM1A 4GEHB 3W8HB 1OW8A 1KNYA 3GM2A 1OW6A 4XEFA 3S9OA 3C8GA 1OW7A 3GM3A 1V4AA 1K04A 3B71A 2PBEA 2HSBA 2KK1A 2LK4A 1PV3A 2JX0A 2L6GA 3C18A 1WTYA 3U0CA 1ZZPA 1K05A 3L8JA 1WWPA 3C8GB 3C8GD 1KTMA 3BRJA 3MFNA 3O10A 4R32A 3TULA 1K40A 3W8IB 2L6FA 3K7DA 4XEVA 1WOLA 1O3UA 2Q00A 1QVXA 2L6HA 2YWAA 5F28E 4XEKA 3L8IA 4EBKA 3JZ0A 3RQFA 3RQEA 3RQGA 3JYYA 1JOGA 2JPUA 4EBJA 3U3FA 4NQFA 1UFBA
chains in the Genus database with same CATH superfamily
4E17A 5KYUA 2Q3TA 4KI2A 3AQCA 3KYIA 4O7GA 2E87A 1KU2A 3K1HA 2R7QA 1DCIA 2GTRA 4WABA 4CBEA 3L8IA 4ELXA 4XPXA 2F22A 2XSEA 1JOGA 2JPUA 2XLDA 3H2VA 1SZIA 2PFDA 3HNJA 4JTCB 1PV3A 1ZU5A 3H65A 1EF9A 1QVXA 4NY3A 4MVOA 4ULWA 1YARO 3GORA 2PP4A 1RJ9B 3CEXA 2P0NA 4AK9A 5A6BA 2LD6A 4M63A 2Y3BA 1FTSA 3MFNA 4XPYA 4YT4A 4MVRA 1ZHXA 4WJ0A 1VLTA 2TMVP 2AWYA 2Y39A 3B0PA 2IEXA 2O9XA 3DJUB 3TLFA 3QW1A 4MVUA 3A4MA 5DQZA 3AG4C 4FWVA 5F28E 4JIOA 3ZSUA 1BR4A 3C8ZA 3MYFA 4QIIA 3CSKA 1UX4A 5E33A 1KNYA 4CS8A 3LEOA 4F47A 1E86A 3C8GD 3I5QA 4ER9A 1L3PA 4KNPA 1SMYF 2HJMA 1U0BB 5CIVA 3HKKA 3TRRA 1OR3A 4DBQA 1ZHZA 4U5DE 3JRTA 3V7OA 4H4KC 4HE8D 3DZAA 1KTMA 4OLQA 4JC7A 1N1CA 3EPVA 3DI5A 2IBFA 3U2MA 3W8HA 3DAFA 2HV7A 3O55A 1D1CA 2J9BA 1QSPA 3QMKA 3E70C 4EUKB 3V5ZA 5TJ5E 4QI0A 4JTDB 2LFFA 2EPLX 3IQTA 3ASNC 3EFOA 3IQ6A 4U1AA 3N2ZB 3LS1A 2XS1A 4RDAA 1V4AA 3Q0GA 1E83A 2XLVA 4U5FE 2R7SA 2PPYA 4EBBA 1M56C 1YLMA 2AWCA 1Y4CA 2NUTB 2CYDA 4E0HA 1J8MF 2J7PD 2WZGA 1EKYA 3EHMA 3I5PA 3T6BA 4E18A 3DKAA 3OA1A 2R7RA 1IW7F 2LQGA 1JR8A 3RQGA 2YEVA 3EGDB 4BEJA 4MTFA 3SZRA 1ZVZA 1WZ8A 2KQ9A 2KC3A 1VB5A 3FXHA 4NCQA 1LE4A 3V5YA 1RJ9A 1G4US 1WATA 4BPMA 3US6A 5BQHA 4C3BA 3W4YA 4AX2A 4IAOA 2Q00A 2QUPA 3RQFA 2ICWG 5A69A 4IB4A 4ANJA 4DBRA 2GWWA 2IXOA 4BEMJ 1LE2A 3VYWA 4CIPA 1OKKD 4LLEA 3SXZA 3EH1A 3NYMA 4PR9A 5L3QA 2C03A 3ASOC 5DS6A 4YL1A 3JYHA 4L6RA 5KYWB 5AC5A 2D4UA 2OOCA 3W2WA 1ZZPA 3C8GB 2EPMX 3A9CA 4O79A 3C7JA 2W4MA 3DM9B 2Y3GA 1A41A 2NSGA 3FVYA 2IYLD 2Q7RA 5B3IA 1M6TA 5FCLA 4MVSA 4LLCA 2Z15A 2YQYA 3K66A 3CAXA 3QVYA 4MW3A 4U5GA 2HJ3A 4NEKA 1WN0A 3B29A 4MTOA 4I44A 1OCZC 3N24A 2XL6A 4EMLA 4I42A 1WWPA 4JOTA 1SR2A 2DI3A 5EHHA 3G50A 3FOPA 4W8KA 1QLEC 3GM3A 3S84A 3RH3A 5COMA 2KK1A 3WHNA 1MMNA 4BJ5A 2I8BA 2R02A 1OR2A 4JRZA 2L6FA 1C03A 3R9TA 1H7IA 3EJNA 2OU6A 3M79A 3AGUA 5KYXB 4O6NA 4U5EE 4IAQA 4ULVA 5BQIA 1U89A 3GM2A 4D4NA 2KJGA 3U2LA 3L8JA 4OD4A 2D5RB 2UZFA 3AGTA 2EINC 1RKCA 3EGDA 3POVA 3IQCA 4DRIB 1H9TA 4J7TA 2P1AA 4P9FA 5AGFA 1VMAA 1TR2A 2ZXWC 4JWVA 4I1OB 1CPQA 3KQFA 1NU7D 3A4LA 1M57C 4IZBA 3ZVRA 5JP7A 4JCHA 4HFKB 4CS9C 1NFNA 4U19A 4LDKA 1F1MA 2R25A 1FR0A 3L0IA 5L0FA 1LVKA 3CZ6A 3QXIA 1M2OA 1MMGA 5COGA 1EA8A 2DUBA 1Q0KA 3KL4A 1SF8A 3Q7LA 5C9GA 1O87A 4I1MA 4MNDA 1O3UA 4LERA 2Q9BA 4N06A 2VCCA 1GS9A 1T6QA 3E9VA 1QKRA 5KYWA 4GYTA 3F46A 1JMWA 3C8GA 2P6VA 5DLJA 4MOUA 5JSLA 5D92A 4AE4B 4LACB 1E2XA 3K1IA 2BC5A 3QXZA 3H2UA 3AG2C 3JZ0A 5L0JA 3LJBA 4EKWA 1MNDA 2L81A 1VLSA 4K0DA 3TK0A 3GWLA 2JX0A 4B6IA 2R7TA 3M15A 5JBXA 2A6HF 1PD1A 2AVKA 2Y3DA 1ORYA 3T89A 2HS5A 5JT4A 3GODA 3A4NA 4YT5A 2A0BA 3KMIA 3X2QC 2GAQA 3O4XE 4LDRA 3U9JA 3LLIA 2VCAA 2GA0A 3HNLA 1YYJA 1V74B 1FMWA 3RVYA 1BDJB 2HV6A 2BE5F 4W8PA 4BJTA 4XEFA 4E7SA 3M4CA 3S28A 3R2PA 1WOLA 2XXAB 1RJMA 4HEAJ 3JSEO 4X0RA 4G78A 1RMVA 5KYXA 2IXPA 4JJFA 2HFIA 4CJGA 3C63A 3GANA 3G64A 4PJNA 4C7OB 4I52A 2G3KA 3I47A 3B0UX 3VF0A 2RD9A 1YA9A 3KPHA 4ZLCA 3ZTMA 1LKXA 3HNKA 2AU5A 1Q0MA 3EHNA 3TD7A 1B68A 2X0CA 2PBEA 1NFOA 2L6GA 2KNHA 4R32A 1RKEB 4EWCA 3V5XA 4XLPF 4PK4A 3Q7GA 3Q1TA 2W4BA 3C62A 1HE9A 1A7EA 3U8VA 1UFBA 1G8XA 2ETSA 2NG1A 4K7BA 1WASA 3PHF2 3GEEA 4YWQA 3MYBA 4JTAB 1QPUA 3X1OA 1K40A 3EG9B 4DXWA 1H9GA 3NKEA 1OCCC 2R7OA 1Q0GA 1UG7A 1T6UA 1OKKA 1W2WA 1YJGA 3KKBA 4OIRF 3ABKC 1T01A 2Q9CA 2OG2A 3K33A 4BJ6C 1ZW2A 4MW8A 3HTKC 5HV9A 3HRXA 4AE4A 3OC7A 2R7VA 2H8AA 1Z3IX 2EPKX 2OEXA 4JCSA 5IY5C 4CSAC 1PCXA 4JZAA 1AVOB 4YL3A 4JE9A 3U0CA 3B0VC 3C18A 3S90A 2YZSA 4PJLA 2CCYA 3ZQVA 1TFKB 2HMZA 3RIPA 1Q0FA 3ZIBA 2KW3C 2R03A 4Z9JA 1NZEA 1D0ZA 3FDUA 1NU9C 4FAPB 3PZKA 4U5HA 5JLIA 5FZTA 3U8PA 3UMKA 1HY5A 2J9VA 2W45A 3W8IB 2V26A 4JCZA 2MYSA 4A4AA 1DUBA 1T5OA 1HMDA 3AG1C 2P7VA 4G7HF 2GFHA 3ZQYA 3CQZA 4C3DA 4UDVA 1K04A 4G0HA 2XS8A 3NDBB 3L1MA 2XXAA 2OCCC 4CDVA 3K7DA 1ZHTA 1BBHA 2J45A 4FJWD 4Q4ZF 3SXMA 4C7OA 4GEHB 1UX5A 5E3AA 3TJ5A 3S9OA 2LP4A 3H81A 2LK4A 2QY9A 2H7VC 3SXKA 5B3SC 3LAYA 1V54C 1ORJA 3FDQA 1ZW3A 3IHUA 3PMRA 5GPGB 2DYRC 4JEAA 1OXKA 3RF3A 2QNLA 1PD0A 2HKVA 4MQ9F 3TQOA 4YT8A 1RKEA 3NYLA 1WTYA 3VM6A 3RW0A 2LSEA 2M4EA 4GQHA 3QTHA 4EBJA 3UMIA 1R5ID 3RFYA 4DVYP 4Z9HA 3UR3C 1E84A 4NNQA 5EGYA 2RSEB 2QTVA 4U5CE 3ZC4A 3EG9A 4EHPA 3ZTZA 4KBLA 1CGOA 1XZQA 5DS5A 3J06A 4IRUA 2YL3A 3HNIA 1JPJA 1LS1A 3NYJA 3NMKA 4IARA 1G5ZA 2B0JA 4P9TA 4CDYA 1HZDA 1MNEA 2YRFA 5T3WA 1EY3A 3AQBA 2A69F 4JJGA 1NZYB 2UUIA 3ABLC 2DGJA 5K0IA 4FX5A 1A7VA 3SXYA 2VCBA 4FZWC 2CNWD 2Q9AA 3GEIA 3K6BA 3S29A 3Q6NA 2OJED 3RSIA 4NQFA 2V3CC 3F47A 3ADDA 5CI8A 3EH2A 4U9DA 4OIPF 4YJWA 5KYYB 1VYKA 1AUEA 4N4WA 1T6IA 3T9OA 3TOMA 3EGXB 4Q7CA 2A1DD 1U6HA 4MVQA 3JCUQ 1OXBA 3UGPA 3W8IA 2H7OA 2J46A 1EI7A 5A6KA 2J8WA 1JXZA 2UUHA 4JURI 3SWXA 2J9WA 3H02A 2F6QA 4YT2A 3U3FA 3SP1A 3RYLA 1Z5ZA 4WGYA 4CX9A 2HSQA 3R0OA 3WODF 2G62A 1HE1A 3SLLA 3SYNA 3M4BA 2VASA 5L0CA 3U5SA 4XTKA 4GEHA 1FFTC 1A7DA 3LNRA 3ZDLA 4HFFB 2ZXPA 2HW5A 4YL0A 3MX3A 3O10A 1TFOB 2H7BA 3Q0JA 4XEVA 4XLNF 3O6XA 4IGGA 2IM8A 2QE9A 3Q6MA 2ZQRA 2DB4A 2FW2A 4BG0A 1HMOA 1FNTc 2XLHA 1C02A 3GWNA 3U9MA 3KH2A 4OD5A 1K05A 5DS4A 3AOUA 1D0XA 5JRAA 3LNMB 3R7CA 2PNOA 2W9YA 4NTBA 2XM0A 3FOOA 1CGME 4EIYA 3DD7A 5F5HA 4AL1A 5F5FA 4C3EA 4CS8C 4IJJA 1EQ1A 5BUOA 3P5MA 3PCVA 3AM1A 4K3WA 4J7YA 2M64A 3PDMP 4MVZA 1IZMA 3ADCA 3A11A 1BR2A 3ADBA 1FAPB 5A6JA 2DYSC 3R9SA 4JW1A 2OQMA 2YLGA 1NZYA 4JFCA 3RVZA 3JSZA 3QW0A 3JTLO 2HMQA 3RQEA 1TQGA 5JVEA 3IPMO 4N6HA 4KC9A 4CS9A 1BZ4A 3GM1A 3FHDA 4LDQA 1I4ZA 4OIOF 2JD3A 2XRHA 4OINF 4JKVA 1Q52A 2KGOA 2IXNA 4Z9IA 3EQLF 2J7PA 1CPRA 1NSGB 3ZWIA 1TWGA 1EF8A 3B71A 2J0WA 5KYYA 5L0GA 2EILC 1I4YA 4DRHB 3FAJA 3MBGA 1S05A 2XL4A 3EGXA 3NG1A 2YVKA 4G7ZF 1OCRC 4A2NB 3I4UA 1UIYA 1Y64B 3DM5A 2NSFA 2WVQA 5COFA 2WVNA 1Z6AA 2YLDA 4OIQF 1LIHA 4ZLDA 3T8AA 3LLKA 4MVMA 3RKOF 4IZCA 1GGQA 1YDIA 2EJ5A 4MTGA 2G3VA 4NC3A 1LPEA 3ZG1A 1Z63A 2IXMA 3MOYA 1YA7O 1FFHA 3KYJA 1ZU4A 2VH3A 3O39A 1G4WR 2OJQA 1Q0DA 4F4BA 3T6GB 2EPNA 2R05A 2HUJA 3FMSA 3ATPA 2KSFA 2XLMA 3LUTB 5L0HA 4NTAA 3DXJF 1VOMA 1NLXA 1DOVA 2ZXRA 3GEHA 4WGZA 1C17M 3UMHA 1JPNA 2ZXOA 4K2NA 2YHSA 1Z23A 3HINA 1AEPA 2VB6A 3DE8A 3S27A 2A68F 5B1BC 4CIHA 4DOZA 1O5HA 1Y6DA 5JUAA 1OCOC 4PJMA 1V55C 2R7XA 4ZU2A 1TWCA 4PACA 4JEBA 2ZPAA 1M2VB 2XLEA 3VRCA 3NMIA 3WG7C 1TWAA 5AC4A 1LI7A 5A6BD 3EZIA 3FAPB 3ITFA 1APCA 2LFDA 1ZHWA 4IWBA 4WCZA 2XLOA 4P6IC 4K1OA 1GM5A 4XQ1A 2PX0A 4QIJA 2WB7A 2OEVA 2YL0A 3DWWA 2WZFA 3JT1A 2FGYA 4J32B 1OW8A 1RCPA 4YN0B 2VX2A 3T6JA 4RBNA 2FFHA 2PF4E 3T88A 1DOWA 2NPUA 2X51A 1ORSC 4KNWA 3BEHA 2C04A 2YKZA 1H6GA 2MHRA 2Y3HA 1TKNA 2YLIA 2P61A 4DVZA 4JYLA 5DVWA 2CNWA 3DE9A 3DMDA 3HLZA 3IEEA 2A6EF 1TWHA 2VC9A 1YVIA 1OQCA 5KJPA 2YL7A 4FESA 3JYYA 3IRBA 3UGOA 3SNHA 2L9JA 3N0TA 4AL0A 2ZD9A 4YK5A 3W2VA 5DQTA 4D4XA 1NBBA 2FBMA 5EK0A 1MMDA 4BJ5C 4MS2A 4IZDA 5JBWA 3ECSA 4BJ6A 2EPOA 4U9EA 2HZ8A 4I3MA 2B0HA 5E2QA 2XL8A 1YYXA 2NUPB 2XLWA 1D0YA 2EIKC 2WVOA 3L34A 4PFOA 1JAFA 1CGNA 1LI5A 2GDCA 2A0UA 3QK8A 3WAQA 2BL2A 2R7UA 3UNGC 4CSAA 3EZHA 2WZLA 1HW1A 4XPWA 4N6CA 3SEOA 2CW0F 1OW7A 4NTFA 3DJNB 1GQAA 1R4TA 1E85A 1LM3B 3G4ZA 256BA 2VREA 4ONSA 2J9UA 2CGEA 3AJMA 1J8YF 3TOLA 1OW6A 4O6YA 5KYUB 5E3CA 1YZCA 3DAGA 4KNVA 1Z7Qc 1BR1A 1VYIA 2L6HA 2KYHA 2WL8A 5D91A 1YZAA 5T1DB 5KYNA 3NRHA 2I15A 1VK5A 1XWJA 4MI2A 5CI9A 4PFPA 4CDAA 1M2VA 2EIMC 1ZHYA 1NG1A 2PX3A 5A6AA 1WGWA 3MLGA 5L3VA 4OG1A 1D1AA 3T4RA 2NUTA 2LCHA 3JRMO 4DRJB 3QVZA 2J0XA 5BQGA 3K1IC 3B9QA 5L0DA 1MJ3A 2L7AA 2ZQQA 2R7WA 3LS0A 2HSBA 3TULA 1RJNA 4J30B 5L0IA 2YWAA 1VTMP 4XEKA 4EBKA 4U18A 3ABMC 3S0XA 5B1AC 2EIJC 1L7CA 4E7ZA 4H54A 1RXQA 3IQ5A 3NMJA 4DJ9A 1JRAA 1SYQA 3LESA 4RD9A 3TJ6A 2AP3A 2YL1A 4ELWA 3VAYA 3QZCA 3M1CB 1XZPA 2OKUA 2QQ3A 2LIGA 1FMVA 4E0IA 1A0BA 1HW2A 4I4ZA 3BRJA 3OEOA 3G4XA 1YAUO 1I5NA 1D1BA 4JVSA 3MYIA 2XM4A 2NUPA 4U5BE 3W8HB 2IOQA 1T9KA 2P63A 3AG3C 1S7ZA 4ELSA 1LS4A 4BJ1A 2MWQA 3NKDA 2R9RB 4FZWA 3LEVA 1Q51A 4CS7A 5T3TA 3OWTA 1ZYRF 2CDQA 3EFOB 4PJJA 4G7OF 1QZXA 3HJCA 1MMAA 4QDLA 2FAPB 1MQVA 5HSWA 2Y69C 4XWJA 3U3BA 2PBPA 1ST6A 2QLAA 2Q4FA 4O6MA 4Q5SF 5JS5A 1QQ3A 4CJOA 2ASRA 4QI2A
chains in the Genus database with same CATH topology
3AJMA 3GM1A 4GEHB 1UX5A 1KNYA 3GM2A 1OW6A 3S9OA 3C8GA 2LK4A 1ZZPA 3C8GB 3L8JA 3C8GD 3O10A 4XEVA 2L6HA 3L8IA 3JZ0A 3RQGA 3JYYA 1JOGA 2JPUA 3IRBA 4NQFA 3ADDA 3B71A 2PBEA 1PV3A 2JX0A 2L6GA 3C18A 1WTYA 3U0CA 1KTMA 1K05A 3BRJA 4R32A 1QVXA 3A4LA 4EBJA 3A4NA 1UFBA 3W8HB 2P63A 1Y64B 4NNQA 3O4XE 1WWPA 3MFNA 1K40A 3W8IB 2Q00A 3RQFA 3AM1A 3U3FA 1OW8A 3ADCA 4XEFA 1OW7A 3GM3A 1V4AA 3ADBA 1K04A 2HSBA 2KK1A 3TULA 3A4MA 2L6FA 3K7DA 1WOLA 1O3UA 2YWAA 1RJMA 5F28E 4XEKA 4EBKA 3RQEA 1UX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  3GM1 A;  4GEH B;  3W8H B;  1OW8 A;  1KNY A;  3GM2 A;  1OW6 A;  4XEF A;  3S9O A;  3C8G A;  1OW7 A;  3GM3 A;  1V4A A;  1K04 A;  3B71 A;  2PBE A;  2HSB A;  2KK1 A;  2LK4 A;  1PV3 A;  2JX0 A;  2L6G A;  3C18 A;  1WTY A;  3U0C A;  1ZZP A;  1K05 A;  3L8J A;  1WWP A;  3C8G B;  3C8G D;  1KTM A;  3BRJ A;  3MFN A;  3O10 A;  4R32 A;  3TUL A;  1K40 A;  3W8I B;  2L6F A;  3K7D A;  4XEV A;  1WOL A;  1O3U A;  2Q00 A;  1QVX A;  2L6H A;  2YWA A;  5F28 E;  4XEK A;  3L8I A;  4EBK A;  3JZ0 A;  3RQF A;  3RQE A;  3RQG A;  3JYY A;  1JOG A;  2JPU A;  4EBJ A;  3U3F A;  4NQF A;  1UFB A; 
#chains in the Genus database with same CATH topology
 4E17 A;  5KYU A;  2Q3T A;  4KI2 A;  3AQC A;  3KYI A;  4O7G A;  2E87 A;  1KU2 A;  3K1H A;  2R7Q A;  1DCI A;  2GTR A;  4WAB A;  4CBE A;  3L8I A;  4ELX A;  4XPX A;  2F22 A;  2XSE A;  1JOG A;  2JPU A;  2XLD A;  3H2V A;  1SZI A;  2PFD A;  3HNJ A;  4JTC B;  1PV3 A;  1ZU5 A;  3H65 A;  1EF9 A;  1QVX A;  4NY3 A;  4MVO A;  4ULW A;  1YAR O;  3GOR A;  2PP4 A;  1RJ9 B;  3CEX A;  2P0N A;  4AK9 A;  5A6B A;  2LD6 A;  4M63 A;  2Y3B A;  1FTS A;  3MFN A;  4XPY A;  4YT4 A;  4MVR A;  1ZHX A;  4WJ0 A;  1VLT A;  2TMV P;  2AWY A;  2Y39 A;  3B0P A;  2IEX A;  2O9X A;  3DJU B;  3TLF A;  3QW1 A;  4MVU A;  3A4M A;  5DQZ A;  3AG4 C;  4FWV A;  5F28 E;  4JIO A;  3ZSU A;  1BR4 A;  3C8Z A;  3MYF A;  4QII A;  3CSK A;  1UX4 A;  5E33 A;  1KNY A;  4CS8 A;  3LEO A;  4F47 A;  1E86 A;  3C8G D;  3I5Q A;  4ER9 A;  1L3P A;  4KNP A;  1SMY F;  2HJM A;  1U0B B;  5CIV A;  3HKK A;  3TRR A;  1OR3 A;  4DBQ A;  1ZHZ A;  4U5D E;  3JRT A;  3V7O A;  4H4K C;  4HE8 D;  3DZA A;  1KTM A;  4OLQ A;  4JC7 A;  1N1C A;  3EPV A;  3DI5 A;  2IBF A;  3U2M A;  3W8H A;  3DAF A;  2HV7 A;  3O55 A;  1D1C A;  2J9B A;  1QSP A;  3QMK A;  3E70 C;  4EUK B;  3V5Z A;  5TJ5 E;  4QI0 A;  4JTD B;  2LFF A;  2EPL X;  3IQT A;  3ASN C;  3EFO A;  3IQ6 A;  4U1A A;  3N2Z B;  3LS1 A;  2XS1 A;  4RDA A;  1V4A A;  3Q0G A;  1E83 A;  2XLV A;  4U5F E;  2R7S A;  2PPY A;  4EBB A;  1M56 C;  1YLM A;  2AWC A;  1Y4C A;  2NUT B;  2CYD A;  4E0H A;  1J8M F;  2J7P D;  2WZG A;  1EKY A;  3EHM A;  3I5P A;  3T6B A;  4E18 A;  3DKA A;  3OA1 A;  2R7R A;  1IW7 F;  2LQG A;  1JR8 A;  3RQG A;  2YEV A;  3EGD B;  4BEJ A;  4MTF A;  3SZR A;  1ZVZ A;  1WZ8 A;  2KQ9 A;  2KC3 A;  1VB5 A;  3FXH A;  4NCQ A;  1LE4 A;  3V5Y A;  1RJ9 A;  1G4U S;  1WAT A;  4BPM A;  3US6 A;  5BQH A;  4C3B A;  3W4Y A;  4AX2 A;  4IAO A;  2Q00 A;  2QUP A;  3RQF A;  2ICW G;  5A69 A;  4IB4 A;  4ANJ A;  4DBR A;  2GWW A;  2IXO A;  4BEM J;  1LE2 A;  3VYW A;  4CIP A;  1OKK D;  4LLE A;  3SXZ A;  3EH1 A;  3NYM A;  4PR9 A;  5L3Q A;  2C03 A;  3ASO C;  5DS6 A;  4YL1 A;  3JYH A;  4L6R A;  5KYW B;  5AC5 A;  2D4U A;  2OOC A;  3W2W A;  1ZZP A;  3C8G B;  2EPM X;  3A9C A;  4O79 A;  3C7J A;  2W4M A;  3DM9 B;  2Y3G A;  1A41 A;  2NSG A;  3FVY A;  2IYL D;  2Q7R A;  5B3I A;  1M6T A;  5FCL A;  4MVS A;  4LLC A;  2Z15 A;  2YQY A;  3K66 A;  3CAX A;  3QVY A;  4MW3 A;  4U5G A;  2HJ3 A;  4NEK A;  1WN0 A;  3B29 A;  4MTO A;  4I44 A;  1OCZ C;  3N24 A;  2XL6 A;  4EML A;  4I42 A;  1WWP A;  4JOT A;  1SR2 A;  2DI3 A;  5EHH A;  3G50 A;  3FOP A;  4W8K A;  1QLE C;  3GM3 A;  3S84 A;  3RH3 A;  5COM A;  2KK1 A;  3WHN A;  1MMN A;  4BJ5 A;  2I8B A;  2R02 A;  1OR2 A;  4JRZ A;  2L6F A;  1C03 A;  3R9T A;  1H7I A;  3EJN A;  2OU6 A;  3M79 A;  3AGU A;  5KYX B;  4O6N A;  4U5E E;  4IAQ A;  4ULV A;  5BQI A;  1U89 A;  3GM2 A;  4D4N A;  2KJG A;  3U2L A;  3L8J A;  4OD4 A;  2D5R B;  2UZF A;  3AGT A;  2EIN C;  1RKC A;  3EGD A;  3POV A;  3IQC A;  4DRI B;  1H9T A;  4J7T A;  2P1A A;  4P9F A;  5AGF A;  1VMA A;  1TR2 A;  2ZXW C;  4JWV A;  4I1O B;  1CPQ A;  3KQF A;  1NU7 D;  3A4L A;  1M57 C;  4IZB A;  3ZVR A;  5JP7 A;  4JCH A;  4HFK B;  4CS9 C;  1NFN A;  4U19 A;  4LDK A;  1F1M A;  2R25 A;  1FR0 A;  3L0I A;  5L0F A;  1LVK A;  3CZ6 A;  3QXI A;  1M2O A;  1MMG A;  5COG A;  1EA8 A;  2DUB A;  1Q0K A;  3KL4 A;  1SF8 A;  3Q7L A;  5C9G A;  1O87 A;  4I1M A;  4MND A;  1O3U A;  4LER A;  2Q9B A;  4N06 A;  2VCC A;  1GS9 A;  1T6Q A;  3E9V A;  1QKR A;  5KYW A;  4GYT A;  3F46 A;  1JMW A;  3C8G A;  2P6V A;  5DLJ A;  4MOU A;  5JSL A;  5D92 A;  4AE4 B;  4LAC B;  1E2X A;  3K1I A;  2BC5 A;  3QXZ A;  3H2U A;  3AG2 C;  3JZ0 A;  5L0J A;  3LJB A;  4EKW A;  1MND A;  2L81 A;  1VLS A;  4K0D A;  3TK0 A;  3GWL A;  2JX0 A;  4B6I A;  2R7T A;  3M15 A;  5JBX A;  2A6H F;  1PD1 A;  2AVK A;  2Y3D A;  1ORY A;  3T89 A;  2HS5 A;  5JT4 A;  3GOD A;  3A4N A;  4YT5 A;  2A0B A;  3KMI A;  3X2Q C;  2GAQ A;  3O4X E;  4LDR A;  3U9J A;  3LLI A;  2VCA A;  2GA0 A;  3HNL A;  1YYJ A;  1V74 B;  1FMW A;  3RVY A;  1BDJ B;  2HV6 A;  2BE5 F;  4W8P A;  4BJT A;  4XEF A;  4E7S A;  3M4C A;  3S28 A;  3R2P A;  1WOL A;  2XXA B;  1RJM A;  4HEA J;  3JSE O;  4X0R A;  4G78 A;  1RMV A;  5KYX A;  2IXP A;  4JJF A;  2HFI A;  4CJG A;  3C63 A;  3GAN A;  3G64 A;  4PJN A;  4C7O B;  4I52 A;  2G3K A;  3I47 A;  3B0U X;  3VF0 A;  2RD9 A;  1YA9 A;  3KPH A;  4ZLC A;  3ZTM A;  1LKX A;  3HNK A;  2AU5 A;  1Q0M A;  3EHN A;  3TD7 A;  1B68 A;  2X0C A;  2PBE A;  1NFO A;  2L6G A;  2KNH A;  4R32 A;  1RKE B;  4EWC A;  3V5X A;  4XLP F;  4PK4 A;  3Q7G A;  3Q1T A;  2W4B A;  3C62 A;  1HE9 A;  1A7E A;  3U8V A;  1UFB A;  1G8X A;  2ETS A;  2NG1 A;  4K7B A;  1WAS A;  3PHF 2;  3GEE A;  4YWQ A;  3MYB A;  4JTA B;  1QPU A;  3X1O A;  1K40 A;  3EG9 B;  4DXW A;  1H9G A;  3NKE A;  1OCC C;  2R7O A;  1Q0G A;  1UG7 A;  1T6U A;  1OKK A;  1W2W A;  1YJG A;  3KKB A;  4OIR F;  3ABK C;  1T01 A;  2Q9C A;  2OG2 A;  3K33 A;  4BJ6 C;  1ZW2 A;  4MW8 A;  3HTK C;  5HV9 A;  3HRX A;  4AE4 A;  3OC7 A;  2R7V A;  2H8A A;  1Z3I X;  2EPK X;  2OEX A;  4JCS A;  5IY5 C;  4CSA C;  1PCX A;  4JZA A;  1AVO B;  4YL3 A;  4JE9 A;  3U0C A;  3B0V C;  3C18 A;  3S90 A;  2YZS A;  4PJL A;  2CCY A;  3ZQV A;  1TFK B;  2HMZ A;  3RIP A;  1Q0F A;  3ZIB A;  2KW3 C;  2R03 A;  4Z9J A;  1NZE A;  1D0Z A;  3FDU A;  1NU9 C;  4FAP B;  3PZK A;  4U5H A;  5JLI A;  5FZT A;  3U8P A;  3UMK A;  1HY5 A;  2J9V A;  2W45 A;  3W8I B;  2V26 A;  4JCZ A;  2MYS A;  4A4A A;  1DUB A;  1T5O A;  1HMD A;  3AG1 C;  2P7V A;  4G7H F;  2GFH A;  3ZQY A;  3CQZ A;  4C3D A;  4UDV A;  1K04 A;  4G0H A;  2XS8 A;  3NDB B;  3L1M A;  2XXA A;  2OCC C;  4CDV A;  3K7D A;  1ZHT A;  1BBH A;  2J45 A;  4FJW D;  4Q4Z F;  3SXM A;  4C7O A;  4GEH B;  1UX5 A;  5E3A A;  3TJ5 A;  3S9O A;  2LP4 A;  3H81 A;  2LK4 A;  2QY9 A;  2H7V C;  3SXK A;  5B3S C;  3LAY A;  1V54 C;  1ORJ A;  3FDQ A;  1ZW3 A;  3IHU A;  3PMR A;  5GPG B;  2DYR C;  4JEA A;  1OXK A;  3RF3 A;  2QNL A;  1PD0 A;  2HKV A;  4MQ9 F;  3TQO A;  4YT8 A;  1RKE A;  3NYL A;  1WTY A;  3VM6 A;  3RW0 A;  2LSE A;  2M4E A;  4GQH A;  3QTH A;  4EBJ A;  3UMI A;  1R5I D;  3RFY A;  4DVY P;  4Z9H A;  3UR3 C;  1E84 A;  4NNQ A;  5EGY A;  2RSE B;  2QTV A;  4U5C E;  3ZC4 A;  3EG9 A;  4EHP A;  3ZTZ A;  4KBL A;  1CGO A;  1XZQ A;  5DS5 A;  3J06 A;  4IRU A;  2YL3 A;  3HNI A;  1JPJ A;  1LS1 A;  3NYJ A;  3NMK A;  4IAR A;  1G5Z A;  2B0J A;  4P9T A;  4CDY A;  1HZD A;  1MNE A;  2YRF A;  5T3W A;  1EY3 A;  3AQB A;  2A69 F;  4JJG A;  1NZY B;  2UUI A;  3ABL C;  2DGJ A;  5K0I A;  4FX5 A;  1A7V A;  3SXY A;  2VCB A;  4FZW C;  2CNW D;  2Q9A A;  3GEI A;  3K6B A;  3S29 A;  3Q6N A;  2OJE D;  3RSI A;  4NQF A;  2V3C C;  3F47 A;  3ADD A;  5CI8 A;  3EH2 A;  4U9D A;  4OIP F;  4YJW A;  5KYY B;  1VYK A;  1AUE A;  4N4W A;  1T6I A;  3T9O A;  3TOM A;  3EGX B;  4Q7C A;  2A1D D;  1U6H A;  4MVQ A;  3JCU Q;  1OXB A;  3UGP A;  3W8I A;  2H7O A;  2J46 A;  1EI7 A;  5A6K A;  2J8W A;  1JXZ A;  2UUH A;  4JUR I;  3SWX A;  2J9W A;  3H02 A;  2F6Q A;  4YT2 A;  3U3F A;  3SP1 A;  3RYL A;  1Z5Z A;  4WGY A;  4CX9 A;  2HSQ A;  3R0O A;  3WOD F;  2G62 A;  1HE1 A;  3SLL A;  3SYN A;  3M4B A;  2VAS A;  5L0C A;  3U5S A;  4XTK A;  4GEH A;  1FFT C;  1A7D A;  3LNR A;  3ZDL A;  4HFF B;  2ZXP A;  2HW5 A;  4YL0 A;  3MX3 A;  3O10 A;  1TFO B;  2H7B A;  3Q0J A;  4XEV A;  4XLN F;  3O6X A;  4IGG A;  2IM8 A;  2QE9 A;  3Q6M A;  2ZQR A;  2DB4 A;  2FW2 A;  4BG0 A;  1HMO A;  1FNT c;  2XLH A;  1C02 A;  3GWN A;  3U9M A;  3KH2 A;  4OD5 A;  1K05 A;  5DS4 A;  3AOU A;  1D0X A;  5JRA A;  3LNM B;  3R7C A;  2PNO A;  2W9Y A;  4NTB A;  2XM0 A;  3FOO A;  1CGM E;  4EIY A;  3DD7 A;  5F5H A;  4AL1 A;  5F5F A;  4C3E A;  4CS8 C;  4IJJ A;  1EQ1 A;  5BUO A;  3P5M A;  3PCV A;  3AM1 A;  4K3W A;  4J7Y A;  2M64 A;  3PDM P;  4MVZ A;  1IZM A;  3ADC A;  3A11 A;  1BR2 A;  3ADB A;  1FAP B;  5A6J A;  2DYS C;  3R9S A;  4JW1 A;  2OQM A;  2YLG A;  1NZY A;  4JFC A;  3RVZ A;  3JSZ A;  3QW0 A;  3JTL O;  2HMQ A;  3RQE A;  1TQG A;  5JVE A;  3IPM O;  4N6H A;  4KC9 A;  4CS9 A;  1BZ4 A;  3GM1 A;  3FHD A;  4LDQ A;  1I4Z A;  4OIO F;  2JD3 A;  2XRH A;  4OIN F;  4JKV A;  1Q52 A;  2KGO A;  2IXN A;  4Z9I A;  3EQL F;  2J7P A;  1CPR A;  1NSG B;  3ZWI A;  1TWG A;  1EF8 A;  3B71 A;  2J0W A;  5KYY A;  5L0G A;  2EIL C;  1I4Y A;  4DRH B;  3FAJ A;  3MBG A;  1S05 A;  2XL4 A;  3EGX A;  3NG1 A;  2YVK A;  4G7Z F;  1OCR C;  4A2N B;  3I4U A;  1UIY A;  1Y64 B;  3DM5 A;  2NSF A;  2WVQ A;  5COF A;  2WVN A;  1Z6A A;  2YLD A;  4OIQ F;  1LIH A;  4ZLD A;  3T8A A;  3LLK A;  4MVM A;  3RKO F;  4IZC A;  1GGQ A;  1YDI A;  2EJ5 A;  4MTG A;  2G3V A;  4NC3 A;  1LPE A;  3ZG1 A;  1Z63 A;  2IXM A;  3MOY A;  1YA7 O;  1FFH A;  3KYJ A;  1ZU4 A;  2VH3 A;  3O39 A;  1G4W R;  2OJQ A;  1Q0D A;  4F4B A;  3T6G B;  2EPN A;  2R05 A;  2HUJ A;  3FMS A;  3ATP A;  2KSF A;  2XLM A;  3LUT B;  5L0H A;  4NTA A;  3DXJ F;  1VOM A;  1NLX A;  1DOV A;  2ZXR A;  3GEH A;  4WGZ A;  1C17 M;  3UMH A;  1JPN A;  2ZXO A;  4K2N A;  2YHS A;  1Z23 A;  3HIN A;  1AEP A;  2VB6 A;  3DE8 A;  3S27 A;  2A68 F;  5B1B C;  4CIH A;  4DOZ A;  1O5H A;  1Y6D A;  5JUA A;  1OCO C;  4PJM A;  1V55 C;  2R7X A;  4ZU2 A;  1TWC A;  4PAC A;  4JEB A;  2ZPA A;  1M2V B;  2XLE A;  3VRC A;  3NMI A;  3WG7 C;  1TWA A;  5AC4 A;  1LI7 A;  5A6B D;  3EZI A;  3FAP B;  3ITF A;  1APC A;  2LFD A;  1ZHW A;  4IWB A;  4WCZ A;  2XLO A;  4P6I C;  4K1O A;  1GM5 A;  4XQ1 A;  2PX0 A;  4QIJ A;  2WB7 A;  2OEV A;  2YL0 A;  3DWW A;  2WZF A;  3JT1 A;  2FGY A;  4J32 B;  1OW8 A;  1RCP A;  4YN0 B;  2VX2 A;  3T6J A;  4RBN A;  2FFH A;  2PF4 E;  3T88 A;  1DOW A;  2NPU A;  2X51 A;  1ORS C;  4KNW A;  3BEH A;  2C04 A;  2YKZ A;  1H6G A;  2MHR A;  2Y3H A;  1TKN A;  2YLI A;  2P61 A;  4DVZ A;  4JYL A;  5DVW A;  2CNW A;  3DE9 A;  3DMD A;  3HLZ A;  3IEE A;  2A6E F;  1TWH A;  2VC9 A;  1YVI A;  1OQC A;  5KJP A;  2YL7 A;  4FES A;  3JYY A;  3IRB A;  3UGO A;  3SNH A;  2L9J A;  3N0T A;  4AL0 A;  2ZD9 A;  4YK5 A;  3W2V A;  5DQT A;  4D4X A;  1NBB A;  2FBM A;  5EK0 A;  1MMD A;  4BJ5 C;  4MS2 A;  4IZD A;  5JBW A;  3ECS A;  4BJ6 A;  2EPO A;  4U9E A;  2HZ8 A;  4I3M A;  2B0H A;  5E2Q A;  2XL8 A;  1YYX A;  2NUP B;  2XLW A;  1D0Y A;  2EIK C;  2WVO A;  3L34 A;  4PFO A;  1JAF A;  1CGN A;  1LI5 A;  2GDC A;  2A0U A;  3QK8 A;  3WAQ A;  2BL2 A;  2R7U A;  3UNG C;  4CSA A;  3EZH A;  2WZL A;  1HW1 A;  4XPW A;  4N6C A;  3SEO A;  2CW0 F;  1OW7 A;  4NTF A;  3DJN B;  1GQA A;  1R4T A;  1E85 A;  1LM3 B;  3G4Z A;  256B A;  2VRE A;  4ONS A;  2J9U A;  2CGE A;  3AJM A;  1J8Y F;  3TOL A;  1OW6 A;  4O6Y A;  5KYU B;  5E3C A;  1YZC A;  3DAG A;  4KNV A;  1Z7Q c;  1BR1 A;  1VYI A;  2L6H A;  2KYH A;  2WL8 A;  5D91 A;  1YZA A;  5T1D B;  5KYN A;  3NRH A;  2I15 A;  1VK5 A;  1XWJ A;  4MI2 A;  5CI9 A;  4PFP A;  4CDA A;  1M2V A;  2EIM C;  1ZHY A;  1NG1 A;  2PX3 A;  5A6A A;  1WGW A;  3MLG A;  5L3V A;  4OG1 A;  1D1A A;  3T4R A;  2NUT A;  2LCH A;  3JRM O;  4DRJ B;  3QVZ A;  2J0X A;  5BQG A;  3K1I C;  3B9Q A;  5L0D A;  1MJ3 A;  2L7A A;  2ZQQ A;  2R7W A;  3LS0 A;  2HSB A;  3TUL A;  1RJN A;  4J30 B;  5L0I A;  2YWA A;  1VTM P;  4XEK A;  4EBK A;  4U18 A;  3ABM C;  3S0X A;  5B1A C;  2EIJ C;  1L7C A;  4E7Z A;  4H54 A;  1RXQ A;  3IQ5 A;  3NMJ A;  4DJ9 A;  1JRA A;  1SYQ A;  3LES A;  4RD9 A;  3TJ6 A;  2AP3 A;  2YL1 A;  4ELW A;  3VAY A;  3QZC A;  3M1C B;  1XZP A;  2OKU A;  2QQ3 A;  2LIG A;  1FMV A;  4E0I A;  1A0B A;  1HW2 A;  4I4Z A;  3BRJ A;  3OEO A;  3G4X A;  1YAU O;  1I5N A;  1D1B A;  4JVS A;  3MYI A;  2XM4 A;  2NUP A;  4U5B E;  3W8H B;  2IOQ A;  1T9K A;  2P63 A;  3AG3 C;  1S7Z A;  4ELS A;  1LS4 A;  4BJ1 A;  2MWQ A;  3NKD A;  2R9R B;  4FZW A;  3LEV A;  1Q51 A;  4CS7 A;  5T3T A;  3OWT A;  1ZYR F;  2CDQ A;  3EFO B;  4PJJ A;  4G7O F;  1QZX A;  3HJC A;  1MMA A;  4QDL A;  2FAP B;  1MQV A;  5HSW A;  2Y69 C;  4XWJ A;  3U3B A;  2PBP A;  1ST6 A;  2QLA A;  2Q4F A;  4O6M A;  4Q5S F;  5JS5 A;  1QQ3 A;  4CJO A;  2ASR A;  4QI2 A; 
#chains in the Genus database with same CATH homology
 3AJM A;  3GM1 A;  4GEH B;  1UX5 A;  1KNY A;  3GM2 A;  1OW6 A;  3S9O A;  3C8G A;  2LK4 A;  1ZZP A;  3C8G B;  3L8J A;  3C8G D;  3O10 A;  4XEV A;  2L6H A;  3L8I A;  3JZ0 A;  3RQG A;  3JYY A;  1JOG A;  2JPU A;  3IRB A;  4NQF A;  3ADD A;  3B71 A;  2PBE A;  1PV3 A;  2JX0 A;  2L6G A;  3C18 A;  1WTY A;  3U0C A;  1KTM A;  1K05 A;  3BRJ A;  4R32 A;  1QVX A;  3A4L A;  4EBJ A;  3A4N A;  1UFB A;  3W8H B;  2P63 A;  1Y64 B;  4NNQ A;  3O4X E;  1WWP A;  3MFN A;  1K40 A;  3W8I B;  2Q00 A;  3RQF A;  3AM1 A;  3U3F A;  1OW8 A;  3ADC A;  4XEF A;  1OW7 A;  3GM3 A;  1V4A A;  3ADB A;  1K04 A;  2HSB A;  2KK1 A;  3TUL A;  3A4M A;  2L6F A;  3K7D A;  1WOL A;  1O3U A;  2YWA A;  1RJM A;  5F28 E;  4XEK A;  4EBK A;  3RQE A;  1UX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...