3L8IA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 74
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8iA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8iA02
3U0CA 1WTYA 1QVXA 3GM1A 4XEFA 1K04A 3W8HB 1OW7A 1OW6A 2HSBA 5F28E 4XEVA 4R32A 4EBJA 2L6GA 2LK4A 2YWAA 1K05A 4EBKA 3C8GB 3RQGA 3RQFA 1PV3A 3GM2A 1KNYA 4XEKA 1WWPA 3K7DA 3TULA 1WOLA 3JZ0A 1OW8A 2JX0A 3C8GA 3AJMA 3MFNA 1ZZPA 3BRJA 4NQFA 3O10A 3S9OA 2PBEA 3L8JA 3JYYA 3RQEA 3L8IA 3W8IB 1O3UA 2KK1A 3C8GD 1KTMA 2Q00A 4GEHB 3GM3A 3B71A 3U3FA 3C18A 1K40A 2L6FA 2L6HA 1V4AA 1JOGA 2JPUA 1UFBA
chains in the Genus database with same CATH superfamily
2Y3GA 4IGGA 2KYHA 3C8ZA 4QIIA 3W2VA 2A69F 3I5QA 3JT1A 5BUOA 3EH1A 1ZU5A 2LD6A 2LQGA 1YJGA 3LLKA 1Y6DA 4Q4ZF 2XXAB 2VCBA 4J7YA 2KJGA 4JEAA 4XPYA 3EHNA 1CPQA 1QKRA 2IXNA 5C9GA 3QZCA 2TMVP 4I4ZA 4OLQA 1LE4A 4NC3A 2A6EF 1YYXA 1Q0MA 2AWCA 4NTFA 4YWQA 1UIYA 1BBHA 3MYFA 4DRJB 4PR9A 1D0ZA 1PCXA 1LS1A 1A7VA 2EIKC 3IPMO 5E2QA 3IHUA 5B3IA 3S29A 1H7IA 2GWWA 3AG2C 3DM5A 3DE9A 3HRXA 1NG1A 3G50A 3GM3A 3TOLA 1N1CA 2YL7A 2I15A 3DMDA 4A2NB 4NTBA 1E86A 3MBGA 1APCA 4U5EE 1Q51A 2DGJA 4KBLA 4Z9IA 3A9CA 1Z5ZA 2LFDA 3ECSA 3U8PA 4CIPA 5K0IA 2R7RA 1Y4CA 1A41A 1OW6A 5D92A 4AE4B 3LEVA 4DBRA 5KYXA 4F4BA 2QUPA 4JE9A 4D4XA 1J8MF 1BZ4A 3H02A 1M56C 1BDJB 2QY9A 1WWPA 2R7OA 4MTOA 2H7OA 2J7PD 2OQMA 4N4WA 4E7ZA 1TWCA 2OG2A 2YL0A 4JTAB 4MTGA 2NUTA 3OEOA 3PMRA 5CIVA 2PBEA 4FWVA 3KQFA 2BE5F 4P9TA 2XLVA 5L0CA 2Q4FA 5KYWB 5L0DA 1EQ1A 3SXKA 3KPHA 3V5ZA 3Q1TA 3T6JA 3S90A 4I3MA 2WZFA 3FXHA 3ZIBA 3LESA 2KC3A 1G4WR 2WVQA 3H2VA 3L1MA 2R9RB 2CNWA 3FOPA 4H54A 4KNVA 3RH3A 2XM0A 4PACA 4DVYP 3U0CA 3HKKA 2OCCC 2YL1A 2ZD9A 3O4XE 1VOMA 1G8XA 1RJ9A 3MYIA 3TQOA 5KYWA 4XWJA 1DOWA 3MX3A 1HW1A 4JRZA 1Q0DA 4EBJA 4Q5SF 1LM3B 4IB4A 2QE9A 1RMVA 2PFDA 2HV6A 2GTRA 1MMNA 1ORYA 4PK4A 4NNQA 5AGFA 1YZAA 3RVYA 4U5CE 2PPYA 3N0TA 3ZC4A 2YZSA 4IARA 3EZHA 3ZDLA 4I52A 4UDVA 5L0GA 3K1HA 3X1OA 3U2LA 3X2QC 4YT2A 2J7PA 4OIPF 3NYLA 1YLMA 1Z7Qc 1OQCA 3TOMA 2V26A 4YT4A 3GANA 5KYUA 2R02A 2L7AA 4DVZA 3L0IA 4BJ5C 4K3WA 3T8AA 1MQVA 1JOGA 2JD3A 2OJED 1UX4A 3AG4C 3GEHA 1EF9A 2BC5A 2J45A 2P7VA 4H4KC 2PF4E 5A6BD 4ELXA 1R4TA 3JSEO 4DBQA 3WAQA 1TKNA 3NRHA 2DI3A 3C62A 4XLPF 5JVEA 3C8GB 5FCLA 4OG1A 3HNKA 4IAOA 3EFOA 2FGYA 1CGOA 2IOQA 2IYLD 4OIQF 4JCZA 1A0BA 2R03A 2QNLA 3LEOA 1TWHA 3PDMP 4XLNF 2NG1A 3EH2A 3G4XA 4HFFB 3S84A 1RJ9B 1TWGA 2CYDA 1TFOB 3QK8A 2H7BA 3R0OA 2LP4A 4IZBA 4GYTA 4YK5A 1LKXA 2OOCA 2F22A 3DXJF 4K2NA 1IZMA 3V7OA 4LDKA 5A6JA 2CNWD 1O3UA 4DRHB 1RKCA 2PP4A 1DCIA 1Q0FA 4MVQA 3LNRA 3AM1A 3NYJA 1C02A 4BG0A 3ADCA 3FDUA 3KYIA 4WCZA 2R7QA 3DKAA 4BPMA 3FDQA 4ZLDA 3EGDA 2XLOA 3SP1A 3MLGA 3RKOF 3POVA 4OD5A 3DE8A 1ZU4A 4XEVA 1Q52A 1EY3A 1VMAA 2LK4A 2Y3DA 3CSKA 3SXZA 3WHNA 2XS1A 1J8YF 4DXWA 2P6VA 3ZQYA 2W4BA 3K7DA 5KYXB 3QW0A 4ULVA 1E2XA 2YLIA 1QQ3A 3AG1C 2DYRC 3U5SA 5B3SC 1E84A 5DS5A 4ANJA 5KYYA 1QZXA 3U3BA 1M57C 3W8IB 4I1MA 2XL4A 4JKVA 4U5FE 3T6BA 4EKWA 1VTMP 3C8GD 3ZTZA 2F6QA 3JCUQ 4E17A 2Q00A 1V74B 4U9DA 2LSEA 3R7CA 4MQ9F 2YRFA 1LI7A 2OJQA 4MOUA 2Y39A 1D0XA 1VB5A 2CGEA 3S27A 1Z3IX 2NSFA 3GM1A 1ZYRF 4W8KA 3TK0A 1RJMA 1OKKA 2B0HA 2MHRA 3W8HB 2AVKA 3T6GB 3S0XA 3Q6MA 1ZHXA 1Z63A 2HJMA 3NKDA 2EJ5A 4LLCA 2B0JA 1LPEA 3HNIA 1EKYA 2FAPB 3P5MA 3BEHA 3RVZA 4CDYA 4O7GA 1D0YA 3TLFA 5FZTA 3GWNA 2OEXA 3DAFA 2XLDA 4QDLA 5DQTA 1HMDA 4OINF 2IBFA 5TJ5E 3EZIA 1JPNA 4HEAJ 5DS6A 4YT8A 4P9FA 3R9SA 4U9EA 3NKEA 2IXPA 5E3AA 4U1AA 2HV7A 1KTMA 1V55C 2EIJC 1NSGB 3F46A 4E0HA 2L6FA 3M4CA 4YL3A 4EMLA 2UZFA 1I4YA 4PJMA 5F5HA 5L0JA 2JPUA 2GFHA 1M2VB 2PX3A 4MW8A 4MVRA 3QVZA 3TJ5A 1OCRC 3H2UA 1H6GA 3ZG1A 5A6BA 3UGPA 3US6A 5A6AA 2ZXPA 3A11A 5L3VA 3SZRA 2PX0A 3HLZA 1PV3A 1KU2A 2XM4A 2XL8A 2YHSA 3CEXA 3EGXA 3QXZA 1CGNA 3KMIA 4X0RA 2V3CC 4BJTA 4EWCA 1SYQA 1YVIA 3GEIA 2QLAA 3MFNA 4NQFA 5CI9A 4FZWA 2UUHA 5DQZA 4PJJA 2A1DD 5AC5A 5HV9A 4G7ZF 3A4NA 2W4MA 2C04A 2ZXOA 1ORJA 2WZLA 3IQ6A 4PJNA 4OIRF 4U5DE 3ABLC 1DUBA 2HS5A 3HINA 2M64A 2OEVA 3HTKC 2AU5A 3J06A 3N2ZB 1OCOC 3FVYA 3AG3C 3U3FA 1WZ8A 3QMKA 5JT4A 3QTHA 3SNHA 1MJ3A 1GS9A 2J0XA 4O79A 2R25A 2XLWA 3VYWA 1QVXA 2AWYA 2EPLX 1S7ZA 3IQCA 1NZYB 4GQHA 1T6QA 5JBWA 4U19A 3E70C 4JTDB 5GPGB 2G62A 5B1AC 2A0UA 3HNLA 1MNEA 2EINC 4N6HA 4AE4A 5DLJA 3B0VC 2Q9CA 3RFYA 3UMHA 4BEMJ 1ZHWA 2NSGA 4AX2A 1CPRA 1L3PA 1OW8A 2JX0A 3LAYA 2PBPA 2FW2A 3LNMB 3DD7A 4C7OA 1M2VA 1BR1A 3L8JA 3U2MA 2ZQRA 3Q0GA 1T01A 2O9XA 3PCVA 1LI5A 3ABKC 4J32B 2FBMA 2IM8A 2XSEA 1E83A 1R5ID 2KW3C 1VYKA 3K1IA 3VM6A 4BJ5A 1I5NA 5JUAA 2WZGA 1OR3A 4CSAC 3IQTA 3K1IC 2Q7RA 2J0WA 1ZHZA 2VB6A 3ZVRA 4CDVA 5L0IA 1FNTc 1SMYF 1QSPA 4MVOA 2YVKA 1U89A 3CAXA 3F47A 3NMIA 4ELSA 1HE9A 2HFIA 2I8BA 5JLIA 1DOVA 3RQGA 3EPVA 3DWWA 1D1BA 1GQAA 1KNYA 1HMOA 2YEVA 4XEKA 3QW1A 4N06A 4NCQA 2NUPA 1XZQA 2Q9BA 2LCHA 4BJ6C 3B0UX 5DS4A 2HZ8A 4AL1A 1EF8A 3RQEA 2IXOA 2DUBA 1BR2A 4WJ0A 3GODA 2YLGA 2VH3A 4ONSA 1VLTA 2FFHA 3GWLA 4C3EA 2J46A 4MS2A 2CCYA 4O6NA 1OXBA 1V54C 5DVWA 3M79A 5EK0A 5AC4A 3I4UA 2VCAA 3B9QA 3LLIA 5KYUB 5KYYB 3QXIA 3O39A 3RIPA 5A6KA 1MMDA 2P0NA 3DM9B 1W2WA 2VX2A 1OW7A 4Z9JA 3T88A 2ZXRA 4IJJA 2Q9AA 2L6GA 1ZW2A 1FFTC 3CQZA 4QI0A 2YLDA 1CGME 3RQFA 3TRRA 2H8AA 2VC9A 3GM2A 3AOUA 3UMIA 3HNJA 1YA7O 2A0BA 2QTVA 2XLEA 1NBBA 3K6BA 4LLEA 3SEOA 1WOLA 1SR2A 2XXAA 3CZ6A 2G3VA 4K1OA 4BJ1A 1Q0KA 1PD0A 1SF8A 3T4RA 1UX5A 2VREA 2EPMX 1ZW3A 2WL8A 2XLHA 4MI2A 3JYYA 4JW1A 1RKEA 4DRIB 4CIHA 1XWJA 2EIMC 4ZU2A 2XS8A 1U0BB 1E85A 2R7XA 1FAPB 4KNWA 1O87A 1OCCC 1ZHTA 4M63A 3T9OA 4CS7A 3TJ6A 1U6HA 4ER9A 2UUIA 1LVKA 2AP3A 1RJNA 2DYSC 5L3QA 2J9UA 1XZPA 2EPOA 4IAQA 2QQ3A 1WTYA 5COFA 1T6UA 2M4EA 4K7BA 1K04A 3AGUA 1YYJA 2J9VA 3NMKA 4XEFA 4WGZA 4FX5A 3IEEA 2HSBA 2VCCA 3EJNA 3FHDA 3GORA 3M1CB 4J7TA 4Z9HA 1JMWA 4YL1A 3SYNA 2YWAA 2J9WA 3KL4A 4PJLA 2Q3TA 5KJPA 3Q7GA 1WATA 2HJ3A 2W9YA 2IEXA 3AQBA 4PFOA 3DZAA 1FFHA 4AK9A 1WASA 2R7SA 1JRAA 3IRBA 3M4BA 5T3WA 1YAUO 5COMA 4O6YA 4FAPB 1LS4A 1D1AA 1FMVA 3Q7LA 2RD9A 5L0HA 4NY3A 3W8HA 2H7VC 5BQGA 2D4UA 2KK1A 4O6MA 1PD1A 1Q0GA 2J8WA 4F47A 1BR4A 1C17M 2W45A 3WG7C 2HUJA 1T5OA 2R7UA 3QVYA 2Y69C 4GEHA 3FOOA 4CBEA 2IXMA 3EG9A 3MYBA 1FMWA 4MVMA 4KNPA 1T6IA 2VASA 4MW3A 1H9TA 2P61A 3DI5A 3K33A 4RBNA 3M15A 4C3DA 4K0DA 2WB7A 4OIOF 2HMZA 3JTLO 2ZXWC 2YQYA 4XQ1A 3W4YA 3T89A 2X51A 4EHPA 2GDCA 3ATPA 1QPUA 3AJMA 1LIHA 1ORSC 3S9OA 5IY5C 4MVZA 4U5GA 3TD7A 4FESA 4KI2A 5T1DB 2HKVA 3G4ZA 4RD9A 3UNGC 2Y3BA 4IWBA 3L8IA 4E18A 4E7SA 5JS5A 2L81A 3JYHA 3RF3A 2Z15A 4G7HF 2BL2A 4JYLA 3V5XA 3B71A 3DAGA 1ZHYA 2L6HA 4JC7A 3JRTA 1RKEB 4XPXA 4EBBA 2J9BA 5E33A 3U9JA 1GM5A 2E87A 4CS8A 4JJFA 2A68F 3JRMO 4Q7CA 1AUEA 1JPJA 2P1AA 2NUTB 1MNDA 1A7DA 1VK5A 1WN0A 4YN0B 3ADDA 5F28E 2L9JA 4JVSA 4CS9C 2ICWG 3ZSUA 1AEPA 3LS1A 2C03A 4JWVA 2OU6A 2X0CA 1AVOB 2MYSA 3U8VA 1TR2A 3NG1A 1H9GA 4AL0A 3EFOB 3NDBB 3C8GA 3ITFA 3RYLA 1YARO 3BRJA 3PZKA 4CDAA 3K66A 3H81A 1NFOA 1RCPA 1VLSA 3OWTA 4KC9A 1NZYA 2XL6A 5BQHA 2KGOA 2NPUA 3R9TA 4CSAA 3EG9B 2Y3HA 1I4ZA 1TWAA 3AGTA 2CW0F 4GEHB 1UG7A 3W2WA 1NZEA 3C18A 4I1OB 5B1BC 4G78A 1JXZA 1L7CA 2XLMA 1NLXA 1YDIA 5E3CA 1GGQA 2WVNA 4JZAA 1IW7F 4IRUA 3ZQVA 4JTCB 2HW5A 4C3BA 3I5PA 1S05A 1YA9A 3N24A 4BJ6A 3A4LA 3FMSA 3KYJA 3I47A 4YT5A 3VAYA 5JBXA 3ABMC 4EUKB 1OXKA 4WABA 5EHHA 1K05A 1F1MA 4EBKA 4BEJA 5L0FA 2ETSA 2MWQA 1G5ZA 4ULWA 4RDAA 4ZLCA 1ST6A 4NEKA 4NTAA 1D1CA 3PHF2 3TULA 3DJNB 4MTFA 3SWXA 2ZPAA 2LIGA 4W8PA 1ZZPA 3EGDB 1G4US 2CDQA 4LACB 3S28A 2P63A 5A69A 5F5FA 3MOYA 1C03A 4A4AA 4ELWA 1ZVZA 5JRAA 3ASNC 3O55A 4I44A 1O5HA 1OR2A 1WGWA 3ASOC 1HZDA 1NU7D 3SXMA 3FAPB 3NMJA 3OA1A 3KKBA 4P6IC 1V4AA 3ZTMA 3VF0A 3Q0JA 1QLEC 1MMGA 1Z23A 3ZWIA 4IZDA 4N6CA 3AQCA 3V5YA 4MVSA 1SZIA 4YJWA 4B6IA 3UR3C 3JSZA 4WGYA 1FTSA 1EI7A 4U5BE 4CX9A 3B0PA 4CS8C 5KYNA 5CI8A 1FR0A 3DJUB 5JSLA 4JFCA 2HMQA 3E9VA 1Y64B 1LE2A 3JZ0A 1HW2A 4QI2A 3H65A 4CS9A 3LJBA 4G7OF 5HSWA 4D4NA 256BA 3O10A 2R05A 3NYMA 4JJGA 4U5HA 4YL0A 5COGA 5JP7A 1Z6AA 1JR8A 3B29A 4IZCA 1TQGA 3VRCA 4JIOA 1EA8A 1M6TA 3EHMA 4MVUA 2A6HF 1RXQA 4CJOA 2GA0A 2ASRA 3HJCA 4JOTA 2WVOA 2HSQA 3FAJA 1NFNA 3OC7A 1OCZC 4LERA 4XTKA 1VYIA 5BQIA 3LUTB 3UGOA 4U18A 2KNHA 1UFBA 2YL3A 4LDRA 2R7TA 4XPWA 1OKKD 1A7EA 3GEEA 4JCSA 4LDQA 2R7VA 4JCHA 1T9KA 4FJWD 4MNDA 4FZWC 1HE1A 2RSEB 3L34A 3UMKA 3W8IA 3IQ5A 4OD4A 4R32A 1B68A 2DB4A 3EGXB 4JEBA 2OKUA 1M2OA 2NUPB 3LS0A 1NU9C 3A4MA 2EILC 1HY5A 3O6XA 2XRHA 3WODF 1MMAA 3Q6NA 4E0IA 2ZQQA 3KH2A 4JURI 4C7OB 4G0HA 3SLLA 4EIYA 4I42A 4CJGA 3R2PA 5D91A 4DOZA 4QIJA 3C7JA 1TFKB 2YKZA 4HE8D 2GAQA 3U9MA 2G3KA 3RSIA 3SXYA 2R7WA 3EQLF 1YZCA 3G64A 2KQ9A 3C63A 3RW0A 4DJ9A 3ADBA 2D5RB 2EPNA 4HFKB 5T3TA 1K40A 2KSFA 2LFFA 4L6RA 4PFPA 4J30B 1JAFA 2EPKX 5EGYA 2PNOA
chains in the Genus database with same CATH topology
3U0CA 1WTYA 3O4XE 1QVXA 3GM1A 4XEFA 1K04A 1RJMA 3W8HB 1OW7A 3A4LA 1OW6A 3ADDA 2HSBA 3GM3A 4R32A 4XEVA 2L6GA 2LK4A 5F28E 4EBJA 2YWAA 1K05A 4EBKA 3C8GB 3RQGA 3RQFA 3A4MA 1PV3A 1KNYA 3GM2A 1WWPA 4XEKA 3K7DA 4NNQA 3TULA 1WOLA 1Y64B 3JZ0A 1OW8A 2JX0A 3IRBA 3C8GA 3AJMA 3MFNA 1ZZPA 3BRJA 4NQFA 3O10A 3S9OA 2P63A 2PBEA 1UX5A 3A4NA 3L8JA 3JYYA 3RQEA 3L8IA 3W8IB 1O3UA 2KK1A 3C8GD 1KTMA 3ADBA 4GEHB 3AM1A 2Q00A 3B71A 3C18A 1K40A 2L6FA 2L6HA 3ADCA 3U3FA 1V4AA 1JOGA 2JPUA 1UX4A 1UFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U0C A;  1WTY A;  1QVX A;  3GM1 A;  4XEF A;  1K04 A;  3W8H B;  1OW7 A;  1OW6 A;  2HSB A;  5F28 E;  4XEV A;  4R32 A;  4EBJ A;  2L6G A;  2LK4 A;  2YWA A;  1K05 A;  4EBK A;  3C8G B;  3RQG A;  3RQF A;  1PV3 A;  3GM2 A;  1KNY A;  4XEK A;  1WWP A;  3K7D A;  3TUL A;  1WOL A;  3JZ0 A;  1OW8 A;  2JX0 A;  3C8G A;  3AJM A;  3MFN A;  1ZZP A;  3BRJ A;  4NQF A;  3O10 A;  3S9O A;  2PBE A;  3L8J A;  3JYY A;  3RQE A;  3L8I A;  3W8I B;  1O3U A;  2KK1 A;  3C8G D;  1KTM A;  2Q00 A;  4GEH B;  3GM3 A;  3B71 A;  3U3F A;  3C18 A;  1K40 A;  2L6F A;  2L6H A;  1V4A A;  1JOG A;  2JPU A;  1UFB A; 
#chains in the Genus database with same CATH topology
 2Y3G A;  4IGG A;  2KYH A;  3C8Z A;  4QII A;  3W2V A;  2A69 F;  3I5Q A;  3JT1 A;  5BUO A;  3EH1 A;  1ZU5 A;  2LD6 A;  2LQG A;  1YJG A;  3LLK A;  1Y6D A;  4Q4Z F;  2XXA B;  2VCB A;  4J7Y A;  2KJG A;  4JEA A;  4XPY A;  3EHN A;  1CPQ A;  1QKR A;  2IXN A;  5C9G A;  3QZC A;  2TMV P;  4I4Z A;  4OLQ A;  1LE4 A;  4NC3 A;  2A6E F;  1YYX A;  1Q0M A;  2AWC A;  4NTF A;  4YWQ A;  1UIY A;  1BBH A;  3MYF A;  4DRJ B;  4PR9 A;  1D0Z A;  1PCX A;  1LS1 A;  1A7V A;  2EIK C;  3IPM O;  5E2Q A;  3IHU A;  5B3I A;  3S29 A;  1H7I A;  2GWW A;  3AG2 C;  3DM5 A;  3DE9 A;  3HRX A;  1NG1 A;  3G50 A;  3GM3 A;  3TOL A;  1N1C A;  2YL7 A;  2I15 A;  3DMD A;  4A2N B;  4NTB A;  1E86 A;  3MBG A;  1APC A;  4U5E E;  1Q51 A;  2DGJ A;  4KBL A;  4Z9I A;  3A9C A;  1Z5Z A;  2LFD A;  3ECS A;  3U8P A;  4CIP A;  5K0I A;  2R7R A;  1Y4C A;  1A41 A;  1OW6 A;  5D92 A;  4AE4 B;  3LEV A;  4DBR A;  5KYX A;  4F4B A;  2QUP A;  4JE9 A;  4D4X A;  1J8M F;  1BZ4 A;  3H02 A;  1M56 C;  1BDJ B;  2QY9 A;  1WWP A;  2R7O A;  4MTO A;  2H7O A;  2J7P D;  2OQM A;  4N4W A;  4E7Z A;  1TWC A;  2OG2 A;  2YL0 A;  4JTA B;  4MTG A;  2NUT A;  3OEO A;  3PMR A;  5CIV A;  2PBE A;  4FWV A;  3KQF A;  2BE5 F;  4P9T A;  2XLV A;  5L0C A;  2Q4F A;  5KYW B;  5L0D A;  1EQ1 A;  3SXK A;  3KPH A;  3V5Z A;  3Q1T A;  3T6J A;  3S90 A;  4I3M A;  2WZF A;  3FXH A;  3ZIB A;  3LES A;  2KC3 A;  1G4W R;  2WVQ A;  3H2V A;  3L1M A;  2R9R B;  2CNW A;  3FOP A;  4H54 A;  4KNV A;  3RH3 A;  2XM0 A;  4PAC A;  4DVY P;  3U0C A;  3HKK A;  2OCC C;  2YL1 A;  2ZD9 A;  3O4X E;  1VOM A;  1G8X A;  1RJ9 A;  3MYI A;  3TQO A;  5KYW A;  4XWJ A;  1DOW A;  3MX3 A;  1HW1 A;  4JRZ A;  1Q0D A;  4EBJ A;  4Q5S F;  1LM3 B;  4IB4 A;  2QE9 A;  1RMV A;  2PFD A;  2HV6 A;  2GTR A;  1MMN A;  1ORY A;  4PK4 A;  4NNQ A;  5AGF A;  1YZA A;  3RVY A;  4U5C E;  2PPY A;  3N0T A;  3ZC4 A;  2YZS A;  4IAR A;  3EZH A;  3ZDL A;  4I52 A;  4UDV A;  5L0G A;  3K1H A;  3X1O A;  3U2L A;  3X2Q C;  4YT2 A;  2J7P A;  4OIP F;  3NYL A;  1YLM A;  1Z7Q c;  1OQC A;  3TOM A;  2V26 A;  4YT4 A;  3GAN A;  5KYU A;  2R02 A;  2L7A A;  4DVZ A;  3L0I A;  4BJ5 C;  4K3W A;  3T8A A;  1MQV A;  1JOG A;  2JD3 A;  2OJE D;  1UX4 A;  3AG4 C;  3GEH A;  1EF9 A;  2BC5 A;  2J45 A;  2P7V A;  4H4K C;  2PF4 E;  5A6B D;  4ELX A;  1R4T A;  3JSE O;  4DBQ A;  3WAQ A;  1TKN A;  3NRH A;  2DI3 A;  3C62 A;  4XLP F;  5JVE A;  3C8G B;  5FCL A;  4OG1 A;  3HNK A;  4IAO A;  3EFO A;  2FGY A;  1CGO A;  2IOQ A;  2IYL D;  4OIQ F;  4JCZ A;  1A0B A;  2R03 A;  2QNL A;  3LEO A;  1TWH A;  3PDM P;  4XLN F;  2NG1 A;  3EH2 A;  3G4X A;  4HFF B;  3S84 A;  1RJ9 B;  1TWG A;  2CYD A;  1TFO B;  3QK8 A;  2H7B A;  3R0O A;  2LP4 A;  4IZB A;  4GYT A;  4YK5 A;  1LKX A;  2OOC A;  2F22 A;  3DXJ F;  4K2N A;  1IZM A;  3V7O A;  4LDK A;  5A6J A;  2CNW D;  1O3U A;  4DRH B;  1RKC A;  2PP4 A;  1DCI A;  1Q0F A;  4MVQ A;  3LNR A;  3AM1 A;  3NYJ A;  1C02 A;  4BG0 A;  3ADC A;  3FDU A;  3KYI A;  4WCZ A;  2R7Q A;  3DKA A;  4BPM A;  3FDQ A;  4ZLD A;  3EGD A;  2XLO A;  3SP1 A;  3MLG A;  3RKO F;  3POV A;  4OD5 A;  3DE8 A;  1ZU4 A;  4XEV A;  1Q52 A;  1EY3 A;  1VMA A;  2LK4 A;  2Y3D A;  3CSK A;  3SXZ A;  3WHN A;  2XS1 A;  1J8Y F;  4DXW A;  2P6V A;  3ZQY A;  2W4B A;  3K7D A;  5KYX B;  3QW0 A;  4ULV A;  1E2X A;  2YLI A;  1QQ3 A;  3AG1 C;  2DYR C;  3U5S A;  5B3S C;  1E84 A;  5DS5 A;  4ANJ A;  5KYY A;  1QZX A;  3U3B A;  1M57 C;  3W8I B;  4I1M A;  2XL4 A;  4JKV A;  4U5F E;  3T6B A;  4EKW A;  1VTM P;  3C8G D;  3ZTZ A;  2F6Q A;  3JCU Q;  4E17 A;  2Q00 A;  1V74 B;  4U9D A;  2LSE A;  3R7C A;  4MQ9 F;  2YRF A;  1LI7 A;  2OJQ A;  4MOU A;  2Y39 A;  1D0X A;  1VB5 A;  2CGE A;  3S27 A;  1Z3I X;  2NSF A;  3GM1 A;  1ZYR F;  4W8K A;  3TK0 A;  1RJM A;  1OKK A;  2B0H A;  2MHR A;  3W8H B;  2AVK A;  3T6G B;  3S0X A;  3Q6M A;  1ZHX A;  1Z63 A;  2HJM A;  3NKD A;  2EJ5 A;  4LLC A;  2B0J A;  1LPE A;  3HNI A;  1EKY A;  2FAP B;  3P5M A;  3BEH A;  3RVZ A;  4CDY A;  4O7G A;  1D0Y A;  3TLF A;  5FZT A;  3GWN A;  2OEX A;  3DAF A;  2XLD A;  4QDL A;  5DQT A;  1HMD A;  4OIN F;  2IBF A;  5TJ5 E;  3EZI A;  1JPN A;  4HEA J;  5DS6 A;  4YT8 A;  4P9F A;  3R9S A;  4U9E A;  3NKE A;  2IXP A;  5E3A A;  4U1A A;  2HV7 A;  1KTM A;  1V55 C;  2EIJ C;  1NSG B;  3F46 A;  4E0H A;  2L6F A;  3M4C A;  4YL3 A;  4EML A;  2UZF A;  1I4Y A;  4PJM A;  5F5H A;  5L0J A;  2JPU A;  2GFH A;  1M2V B;  2PX3 A;  4MW8 A;  4MVR A;  3QVZ A;  3TJ5 A;  1OCR C;  3H2U A;  1H6G A;  3ZG1 A;  5A6B A;  3UGP A;  3US6 A;  5A6A A;  2ZXP A;  3A11 A;  5L3V A;  3SZR A;  2PX0 A;  3HLZ A;  1PV3 A;  1KU2 A;  2XM4 A;  2XL8 A;  2YHS A;  3CEX A;  3EGX A;  3QXZ A;  1CGN A;  3KMI A;  4X0R A;  2V3C C;  4BJT A;  4EWC A;  1SYQ A;  1YVI A;  3GEI A;  2QLA A;  3MFN A;  4NQF A;  5CI9 A;  4FZW A;  2UUH A;  5DQZ A;  4PJJ A;  2A1D D;  5AC5 A;  5HV9 A;  4G7Z F;  3A4N A;  2W4M A;  2C04 A;  2ZXO A;  1ORJ A;  2WZL A;  3IQ6 A;  4PJN A;  4OIR F;  4U5D E;  3ABL C;  1DUB A;  2HS5 A;  3HIN A;  2M64 A;  2OEV A;  3HTK C;  2AU5 A;  3J06 A;  3N2Z B;  1OCO C;  3FVY A;  3AG3 C;  3U3F A;  1WZ8 A;  3QMK A;  5JT4 A;  3QTH A;  3SNH A;  1MJ3 A;  1GS9 A;  2J0X A;  4O79 A;  2R25 A;  2XLW A;  3VYW A;  1QVX A;  2AWY A;  2EPL X;  1S7Z A;  3IQC A;  1NZY B;  4GQH A;  1T6Q A;  5JBW A;  4U19 A;  3E70 C;  4JTD B;  5GPG B;  2G62 A;  5B1A C;  2A0U A;  3HNL A;  1MNE A;  2EIN C;  4N6H A;  4AE4 A;  5DLJ A;  3B0V C;  2Q9C A;  3RFY A;  3UMH A;  4BEM J;  1ZHW A;  2NSG A;  4AX2 A;  1CPR A;  1L3P A;  1OW8 A;  2JX0 A;  3LAY A;  2PBP A;  2FW2 A;  3LNM B;  3DD7 A;  4C7O A;  1M2V A;  1BR1 A;  3L8J A;  3U2M A;  2ZQR A;  3Q0G A;  1T01 A;  2O9X A;  3PCV A;  1LI5 A;  3ABK C;  4J32 B;  2FBM A;  2IM8 A;  2XSE A;  1E83 A;  1R5I D;  2KW3 C;  1VYK A;  3K1I A;  3VM6 A;  4BJ5 A;  1I5N A;  5JUA A;  2WZG A;  1OR3 A;  4CSA C;  3IQT A;  3K1I C;  2Q7R A;  2J0W A;  1ZHZ A;  2VB6 A;  3ZVR A;  4CDV A;  5L0I A;  1FNT c;  1SMY F;  1QSP A;  4MVO A;  2YVK A;  1U89 A;  3CAX A;  3F47 A;  3NMI A;  4ELS A;  1HE9 A;  2HFI A;  2I8B A;  5JLI A;  1DOV A;  3RQG A;  3EPV A;  3DWW A;  1D1B A;  1GQA A;  1KNY A;  1HMO A;  2YEV A;  4XEK A;  3QW1 A;  4N06 A;  4NCQ A;  2NUP A;  1XZQ A;  2Q9B A;  2LCH A;  4BJ6 C;  3B0U X;  5DS4 A;  2HZ8 A;  4AL1 A;  1EF8 A;  3RQE A;  2IXO A;  2DUB A;  1BR2 A;  4WJ0 A;  3GOD A;  2YLG A;  2VH3 A;  4ONS A;  1VLT A;  2FFH A;  3GWL A;  4C3E A;  2J46 A;  4MS2 A;  2CCY A;  4O6N A;  1OXB A;  1V54 C;  5DVW A;  3M79 A;  5EK0 A;  5AC4 A;  3I4U A;  2VCA A;  3B9Q A;  3LLI A;  5KYU B;  5KYY B;  3QXI A;  3O39 A;  3RIP A;  5A6K A;  1MMD A;  2P0N A;  3DM9 B;  1W2W A;  2VX2 A;  1OW7 A;  4Z9J A;  3T88 A;  2ZXR A;  4IJJ A;  2Q9A A;  2L6G A;  1ZW2 A;  1FFT C;  3CQZ A;  4QI0 A;  2YLD A;  1CGM E;  3RQF A;  3TRR A;  2H8A A;  2VC9 A;  3GM2 A;  3AOU A;  3UMI A;  3HNJ A;  1YA7 O;  2A0B A;  2QTV A;  2XLE A;  1NBB A;  3K6B A;  4LLE A;  3SEO A;  1WOL A;  1SR2 A;  2XXA A;  3CZ6 A;  2G3V A;  4K1O A;  4BJ1 A;  1Q0K A;  1PD0 A;  1SF8 A;  3T4R A;  1UX5 A;  2VRE A;  2EPM X;  1ZW3 A;  2WL8 A;  2XLH A;  4MI2 A;  3JYY A;  4JW1 A;  1RKE A;  4DRI B;  4CIH A;  1XWJ A;  2EIM C;  4ZU2 A;  2XS8 A;  1U0B B;  1E85 A;  2R7X A;  1FAP B;  4KNW A;  1O87 A;  1OCC C;  1ZHT A;  4M63 A;  3T9O A;  4CS7 A;  3TJ6 A;  1U6H A;  4ER9 A;  2UUI A;  1LVK A;  2AP3 A;  1RJN A;  2DYS C;  5L3Q A;  2J9U A;  1XZP A;  2EPO A;  4IAQ A;  2QQ3 A;  1WTY A;  5COF A;  1T6U A;  2M4E A;  4K7B A;  1K04 A;  3AGU A;  1YYJ A;  2J9V A;  3NMK A;  4XEF A;  4WGZ A;  4FX5 A;  3IEE A;  2HSB A;  2VCC A;  3EJN A;  3FHD A;  3GOR A;  3M1C B;  4J7T A;  4Z9H A;  1JMW A;  4YL1 A;  3SYN A;  2YWA A;  2J9W A;  3KL4 A;  4PJL A;  2Q3T A;  5KJP A;  3Q7G A;  1WAT A;  2HJ3 A;  2W9Y A;  2IEX A;  3AQB A;  4PFO A;  3DZA A;  1FFH A;  4AK9 A;  1WAS A;  2R7S A;  1JRA A;  3IRB A;  3M4B A;  5T3W A;  1YAU O;  5COM A;  4O6Y A;  4FAP B;  1LS4 A;  1D1A A;  1FMV A;  3Q7L A;  2RD9 A;  5L0H A;  4NY3 A;  3W8H A;  2H7V C;  5BQG A;  2D4U A;  2KK1 A;  4O6M A;  1PD1 A;  1Q0G A;  2J8W A;  4F47 A;  1BR4 A;  1C17 M;  2W45 A;  3WG7 C;  2HUJ A;  1T5O A;  2R7U A;  3QVY A;  2Y69 C;  4GEH A;  3FOO A;  4CBE A;  2IXM A;  3EG9 A;  3MYB A;  1FMW A;  4MVM A;  4KNP A;  1T6I A;  2VAS A;  4MW3 A;  1H9T A;  2P61 A;  3DI5 A;  3K33 A;  4RBN A;  3M15 A;  4C3D A;  4K0D A;  2WB7 A;  4OIO F;  2HMZ A;  3JTL O;  2ZXW C;  2YQY A;  4XQ1 A;  3W4Y A;  3T89 A;  2X51 A;  4EHP A;  2GDC A;  3ATP A;  1QPU A;  3AJM A;  1LIH A;  1ORS C;  3S9O A;  5IY5 C;  4MVZ A;  4U5G A;  3TD7 A;  4FES A;  4KI2 A;  5T1D B;  2HKV A;  3G4Z A;  4RD9 A;  3UNG C;  2Y3B A;  4IWB A;  3L8I A;  4E18 A;  4E7S A;  5JS5 A;  2L81 A;  3JYH A;  3RF3 A;  2Z15 A;  4G7H F;  2BL2 A;  4JYL A;  3V5X A;  3B71 A;  3DAG A;  1ZHY A;  2L6H A;  4JC7 A;  3JRT A;  1RKE B;  4XPX A;  4EBB A;  2J9B A;  5E33 A;  3U9J A;  1GM5 A;  2E87 A;  4CS8 A;  4JJF A;  2A68 F;  3JRM O;  4Q7C A;  1AUE A;  1JPJ A;  2P1A A;  2NUT B;  1MND A;  1A7D A;  1VK5 A;  1WN0 A;  4YN0 B;  3ADD A;  5F28 E;  2L9J A;  4JVS A;  4CS9 C;  2ICW G;  3ZSU A;  1AEP A;  3LS1 A;  2C03 A;  4JWV A;  2OU6 A;  2X0C A;  1AVO B;  2MYS A;  3U8V A;  1TR2 A;  3NG1 A;  1H9G A;  4AL0 A;  3EFO B;  3NDB B;  3C8G A;  3ITF A;  3RYL A;  1YAR O;  3BRJ A;  3PZK A;  4CDA A;  3K66 A;  3H81 A;  1NFO A;  1RCP A;  1VLS A;  3OWT A;  4KC9 A;  1NZY A;  2XL6 A;  5BQH A;  2KGO A;  2NPU A;  3R9T A;  4CSA A;  3EG9 B;  2Y3H A;  1I4Z A;  1TWA A;  3AGT A;  2CW0 F;  4GEH B;  1UG7 A;  3W2W A;  1NZE A;  3C18 A;  4I1O B;  5B1B C;  4G78 A;  1JXZ A;  1L7C A;  2XLM A;  1NLX A;  1YDI A;  5E3C A;  1GGQ A;  2WVN A;  4JZA A;  1IW7 F;  4IRU A;  3ZQV A;  4JTC B;  2HW5 A;  4C3B A;  3I5P A;  1S05 A;  1YA9 A;  3N24 A;  4BJ6 A;  3A4L A;  3FMS A;  3KYJ A;  3I47 A;  4YT5 A;  3VAY A;  5JBX A;  3ABM C;  4EUK B;  1OXK A;  4WAB A;  5EHH A;  1K05 A;  1F1M A;  4EBK A;  4BEJ A;  5L0F A;  2ETS A;  2MWQ A;  1G5Z A;  4ULW A;  4RDA A;  4ZLC A;  1ST6 A;  4NEK A;  4NTA A;  1D1C A;  3PHF 2;  3TUL A;  3DJN B;  4MTF A;  3SWX A;  2ZPA A;  2LIG A;  4W8P A;  1ZZP A;  3EGD B;  1G4U S;  2CDQ A;  4LAC B;  3S28 A;  2P63 A;  5A69 A;  5F5F A;  3MOY A;  1C03 A;  4A4A A;  4ELW A;  1ZVZ A;  5JRA A;  3ASN C;  3O55 A;  4I44 A;  1O5H A;  1OR2 A;  1WGW A;  3ASO C;  1HZD A;  1NU7 D;  3SXM A;  3FAP B;  3NMJ A;  3OA1 A;  3KKB A;  4P6I C;  1V4A A;  3ZTM A;  3VF0 A;  3Q0J A;  1QLE C;  1MMG A;  1Z23 A;  3ZWI A;  4IZD A;  4N6C A;  3AQC A;  3V5Y A;  4MVS A;  1SZI A;  4YJW A;  4B6I A;  3UR3 C;  3JSZ A;  4WGY A;  1FTS A;  1EI7 A;  4U5B E;  4CX9 A;  3B0P A;  4CS8 C;  5KYN A;  5CI8 A;  1FR0 A;  3DJU B;  5JSL A;  4JFC A;  2HMQ A;  3E9V A;  1Y64 B;  1LE2 A;  3JZ0 A;  1HW2 A;  4QI2 A;  3H65 A;  4CS9 A;  3LJB A;  4G7O F;  5HSW A;  4D4N A;  256B A;  3O10 A;  2R05 A;  3NYM A;  4JJG A;  4U5H A;  4YL0 A;  5COG A;  5JP7 A;  1Z6A A;  1JR8 A;  3B29 A;  4IZC A;  1TQG A;  3VRC A;  4JIO A;  1EA8 A;  1M6T A;  3EHM A;  4MVU A;  2A6H F;  1RXQ A;  4CJO A;  2GA0 A;  2ASR A;  3HJC A;  4JOT A;  2WVO A;  2HSQ A;  3FAJ A;  1NFN A;  3OC7 A;  1OCZ C;  4LER A;  4XTK A;  1VYI A;  5BQI A;  3LUT B;  3UGO A;  4U18 A;  2KNH A;  1UFB A;  2YL3 A;  4LDR A;  2R7T A;  4XPW A;  1OKK D;  1A7E A;  3GEE A;  4JCS A;  4LDQ A;  2R7V A;  4JCH A;  1T9K A;  4FJW D;  4MND A;  4FZW C;  1HE1 A;  2RSE B;  3L34 A;  3UMK A;  3W8I A;  3IQ5 A;  4OD4 A;  4R32 A;  1B68 A;  2DB4 A;  3EGX B;  4JEB A;  2OKU A;  1M2O A;  2NUP B;  3LS0 A;  1NU9 C;  3A4M A;  2EIL C;  1HY5 A;  3O6X A;  2XRH A;  3WOD F;  1MMA A;  3Q6N A;  4E0I A;  2ZQQ A;  3KH2 A;  4JUR I;  4C7O B;  4G0H A;  3SLL A;  4EIY A;  4I42 A;  4CJG A;  3R2P A;  5D91 A;  4DOZ A;  4QIJ A;  3C7J A;  1TFK B;  2YKZ A;  4HE8 D;  2GAQ A;  3U9M A;  2G3K A;  3RSI A;  3SXY A;  2R7W A;  3EQL F;  1YZC A;  3G64 A;  2KQ9 A;  3C63 A;  3RW0 A;  4DJ9 A;  3ADB A;  2D5R B;  2EPN A;  4HFK B;  5T3T A;  1K40 A;  2KSF A;  2LFF A;  4L6R A;  4PFP A;  4J30 B;  1JAF A;  2EPK X;  5EGY A;  2PNO A; 
#chains in the Genus database with same CATH homology
 3U0C A;  1WTY A;  3O4X E;  1QVX A;  3GM1 A;  4XEF A;  1K04 A;  1RJM A;  3W8H B;  1OW7 A;  3A4L A;  1OW6 A;  3ADD A;  2HSB A;  3GM3 A;  4R32 A;  4XEV A;  2L6G A;  2LK4 A;  5F28 E;  4EBJ A;  2YWA A;  1K05 A;  4EBK A;  3C8G B;  3RQG A;  3RQF A;  3A4M A;  1PV3 A;  1KNY A;  3GM2 A;  1WWP A;  4XEK A;  3K7D A;  4NNQ A;  3TUL A;  1WOL A;  1Y64 B;  3JZ0 A;  1OW8 A;  2JX0 A;  3IRB A;  3C8G A;  3AJM A;  3MFN A;  1ZZP A;  3BRJ A;  4NQF A;  3O10 A;  3S9O A;  2P63 A;  2PBE A;  1UX5 A;  3A4N A;  3L8J A;  3JYY A;  3RQE A;  3L8I A;  3W8I B;  1O3U A;  2KK1 A;  3C8G D;  1KTM A;  3ADB A;  4GEH B;  3AM1 A;  2Q00 A;  3B71 A;  3C18 A;  1K40 A;  2L6F A;  2L6H A;  3ADC A;  3U3F A;  1V4A A;  1JOG A;  2JPU A;  1UX4 A;  1UFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...