3A4LA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
250
structure length
236
Chain Sequence
DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 99
structure length 236
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4lA01
3TVTA 1NJFA 4EPXA 1GG2A 1Z0JA 2P5TB 4KCGA 4JBWA 3AVTA 4U7DA 3TR0A 2ZITA 4GP6A 2DWQA 2GEVA 2CJWA 2YOFA 4BZXA 3BFVA 1AQYA 2B8TA 1FNNA 2E1RA 4ZO4A 3KQNA 4WZBE 2GBLC 3CRW1 2WWWA 4F7WA 1UKYA 4KYUA 2XJ9A 3AVQA 1OW3B 4RD0A 1EFTA 4WXRA 3AKCA 3AVOA 4TZ0A 5FPHA 2GAAA 1ZU5A 3NEYA 3KB2A 2JJ2A 2YWFA 1DAKA 4US1R 1O3YA 2GVZC 2IF2A 5KDDA 3F3YA 3AF4A 2YJTD 2JLVA 5J40A 1OV4A 1VCNA 1QBKC 4V0LA 4TYQA 4D4MA 5CDFE 1TL7C 3AUYA 3I72A 1ZNWA 1IM2A 5FUXA 2V1XA 4QGFA 2GZAA 1KSHA 3OIVA 4DT1A 4RCYA 4C0AC 4YQFA 2J87A 5FPYA 5CITA 4G5RA 3K70B 1R0WA 3WP1B 4WAUA 2BBSA 2AWOA 4AKIA 4Q7LA 4P4SA 2IS4A 2ZRLA 1G19A 3ZIAD 4JJKA 2B7CA 4NTZA 4EPTA 3RRMA 2OLKA 2DR3A 5L3SB 1B23P 4P4TA 3SOPA 3NVAA 1OHHD 4QJ3A 521PA 4IDNA 4B3GA 3WYGA 3IO3A 3C4JA 2Q3MA 3PXGA 5HPYB 3C16C 1AN0A 4NP6A 1G3RA 3WHLA 2IT1A 3FMFA 4B44A 2KBFA 3BB1A 5JS7A 5IDVA 2A5JA 1EFRD 3TE6A 3RNLA 3GLHA 3GLIE 2O8BA 4G01B 1SXJB 5BXQC 1TQDA 2GILA 2GRJA 2HJVA 2YYZA 1I2MA 3E70C 3X1WA 1DAHA 1JQLB 1ZU4A 5FUYA 1CTQA 4PC2A 3KQKA 5GJBA 2W83A 3GP8A 2B6HA 1KK2A 4HB2A 5HKKD 1E2MA 3KKOA 3E5HA 5HE8A 1XPUA 1D5CA 1KMQA 4E5UA 4Q47A 5DH9A 3H0KA 1V5WA 1LS1A 4JZKA 3R9WA 2BEKA 2H18A 1SXJE 2QMOA 2DCUA 1W0KD 2ODEA 1VCIA 2O8EA 1S96A 1W5SA 4FD2A 1ZM7A 3K0FB 4EKDA 2C9CA 1Z6XA 1N2CE 2QAGB 3BC1A 4YDHB 2YWHA 4FCVA 3ASZA 4WZ6A 4UNQA 4DSOA 2GCNA 2FSGA 1ZNZA 2G0NA 2DB3A 1UJ2A 2IXEA 3BBPA 3W6OA 4B34A 1FFHA 3TQCA 2OAQ1 2ZRJA 4DZZA 2G6BA 2XNDA 4D6PA 1J7KA 2LWIA 2P6RA 3AGQA 3T15A 4D2IA 1ZIOA 3RS5A 5L8VA 2C2HA 3B6EA 1U2RA 4WBSA 2LKDA 3U6BA 2QE7D 3BAFA 4IKEA 1XXHB 1XFAA 3LVQE 3JVUA 4YONB 4OI0A 4G5QA 4KU4A 4Q1AA 3T06B 2OLJA 3GJ6A 3NHBA 3M1IA 3IBGA 1Z83A 4TLDA 5F9FA 1WP9A 1DE0A 4R2IA 4Q7KA 1CRPA 1CS4C 3VTKA 4HLQB 1QHIA 3DHWC 3PUXA 4LI0A 2X1VA 4NCJA 4HAVA 2ZJAA 4PQRA 2V54A 2ZPTX 1ZNXA 1ESMA 1E79A 2P67A 1W48A 3SJCA 2BBWA 4A6PA 4D4LA 4CYMA 3B1XA 2PMDA 3L2OB 1PJRA 3VU9B 2HF9A 4NYJQ 2FG5A 1R0ZA 1XXHA 4URZR 3SNHA 5JI3E 4Q7MB 5M04A 1KI7A 2GTPA 1HE8B 3OIWA 2FSHA 4RD2A 1JPNA 2ZRBA 4Q4JB 2H57A 3MMPA 1YU9A 2WPDA 4PO1A 4KLNA 3L0PA 4TMXA 4E07A 4IEIA 1E9DA 2AHOA 4AKGA 3CW2A 2FPMA 5AUOB 1T4GA 2CBZA 3CNLA 3CRVA 4NCKA 1HUQA 3K0AA 2XTNA 2HXYA 3KKPA 4DB4A 1YRAA 4DCVA 2FMXA 4ZI2A 2VSFA 1E3MA 2DWOA 1OIXA 5JHHB 3H86A 1QHHB 2GWHA 1TMKA 2BVNA 5FPSA 4Z1MA 3OEHD 5JZVA 3AF0A 4EFMA 2PLFA 5JLJA 1KDRA 1HH4A 2A5FA 3HR7A 1ODFA 4TMZA 4D0GA 1KSGA 1GKUB 2CK3D 2HXSA 2ZAOA 2ZR0A 2NOAA 1XMVA 2ZREA 2IC5A 2WSSD 5P21A 2FFQA 3KTAA 821PA 5FR1A 1T8TA 1WF3A 3U2QA 1AS0A 2IF0A 5IT5A 4PO8A 3KL4A 4AURA 4US0R 1TU3A 1Q44A 3RYTC 1KNXA 1F2UB 2PEZA 1VG0B 2GAOA 1OFHA 1VIAA 2CVFA 4OBEA 1WBBA 1M7BA 1T3HA 1D9ZA 3OIYA 2A7QA 3IGFA 3UWOA 1Z63A 1W46A 1W4BA 4FXPA 3CF0A 3A37A 1F5NA 3T61A 4DCSA 3THXB 4A1FA 2V9PA 4AYWA 5DN6A 2H17A 5TDHA 1G3MA 1N5JA 1ZIPA 4B35A 3FHOA 2CL0X 4OHZA 4IOMA 1SKQA 2GVDC 4E03A 2R9VA 1KTVA 1DARA 1N6HA 2UVQA 2CXXA 1EX7A 4L8GA 2FPLA 1SQ5A 3H1TA 4N0EA 2AX4A 4EUNA 4NMMA 1GP2A 3HJNA 3LLUA 2ZRNA 2CVHA 2ODWA 3QNUA 4HI0E 1JNYA 4K8OA 4GL2A 1XB2A 3QI2A 4XWAA 1RYFA 3FPAA 4KFTA 4LCBA 1E0JA 2QPOA 1DAEA 1G5PA 1QHNA 3FKSD 4MRRA 4EQ6B 2TMKA 4M1YA 3D3QA 1P61B 1VG9B 1XEXA 1VHTA 2G1KA 3B1ZA 4JLBA 4ON9A 1FNMA 1P9RA 1KZGB 1CJTC 4ZPXA 3JZAA 4OQLA 3TUZC 1DADA 3CX7A 1DVRA 4JVSB 2R6FA 4KI0A 1R4AA 3MJHA 4GFDA 2OBMA 3OEEA 1ZUHA 1DAGA 4Q4HB 3BH7A 5D3MB 3GMTA 1F2TA 2Z4SA 4BFWA 3QSYA 5E7JA 4PC1A 4D82A 3D8BA 4Q9KA 5SZHB 4MKIA 1NBMA 4UJ3A 1XEWY 1E2EA 4V0ME 1G7CA 3RS3A 4HUQA 4IDQA 5KPDA 2O0KA 2C78A 2EWWA 2RGNC 5JRJA 2XNSA 1JEDA 3N70A 2ZRGA 4JT2A 1S9HA 1OFTA 5EZ5A 3VMFA 2ERXA 4TYNA 3RSOA 4K46A 3TVDA 1D2MA 1YZGA 5EE3A 4PANA 2C03A 1OH7A 1VECA 1E4VA 5FR2A 1XD2B 1E1QD 2C5LA 3CZQA 2QU8A 2WTUA 2ZRPA 2R6AA 4UNRA 2IYXA 2O8DA 4KFUA 2MSCB 1Y3AA 1COWD 4TYPA 2CLSA 2P3SA 2RKOA 1QHSA 1ZUIA 4AKHA 2IUSA 4EFLA 3C14C 1Y63A 3B8HA 4C0QC 1L8QA 3GJ4A 1JB1A 6Q21A 4Z8XA 2VSOA 4BRWA 3LY5A 3I8XA 2QPAA 2XNDD 5C4GB 4LJ5A 3UIEA 5ELXA 2CJWB 2WKRA 1IXZA 2BDTA 2JLQA 2ZI9A 4HLCA 1CLUA 2CK3A 3M6AA 1PLJA 1X1SA 4AIIA 2GJKA 1KDOA 3QOFA 4I1SA 3UMRA 4EPWA 1RKBA 1U8AA 1XTQA 1RFLA 2GJSA 4GSYA 1GOTA 3AVUA 4JSYA 1OXVA 2ODBA 2RGGA 1T5LA 4QGGA 1EXMA 2B7BA 4URVR 1DPFA 1IY2A 2ZIAA 4ESVA 1PV4A 2JATA 3PUYA 2C98A 4L16A 4OKSA 3TNFA 5JS8A 4WA7A 4DLTA 2HLDD 3SEAA 4XIGS 2KSQA 1LF5A 4ILEA 5JJLA 3RWOA 1A1VA 4GOJA 3I73A 1J90A 1ZCAA 5B30A 1G4UR 2X8AA 2C8VA 2ZI5A 5KUTA 1AKEA 2ORIA 4FWIB 4PX9A 3AB3A 4L4UA 4K81B 1WDTA 1UADA 2I4IA 4ITRC 1L2TA 1EFHA 1NY6A 2XB4A 4ZKDA 1D6JA 4B2PA 1DAFA 2YC2C 3KJGA 4G5SA 4NZYA 3UK6A 3PEUA 5C1BA 1FQKA 2W58A 3E1SA 3LQQA 4I1UA 4NBSA 4XSGA 3C8UA 1T6NA 1RJ9B 2QENA 3SFVA 3TUIC 3MJRA 1IAQA 5L3SA 4B3DA 4ACAA 1KDPA 3BH6A 3ONWA 1YR9A 3UMSA 4PC7A 1G8FA 4FMBB 1YRBA 1G41A 1SVWA 1ONBA 2C95A 3DPUA 1X6VA 2DWPA 5DI3B 2OO7A 2VBCA 2XTZA 4ESHA 2WBLC 2CL6X 4OQMA 4GOXA 4HDQB 1OFIA 5KPJA 2OCBA 4XWKA 4Y0VA 3TUJC 1RW4A 2PX3A 2BOVA 2C96A 4MDFA 2BMEA 2HCJB 1KI3A 4BECA 3MGCA 5J47A 1DG1G 5K8IA 4XTCS 3PUVA 2RGNA 3VR4A 2CHGA 3AUXA 1CJUC 2QRZA 1XP8A 1MO4A 3QUSA 3ZS8A 1KOFA 3SU8A 2V7QA 2QROA 1YVDA 4F4IA 1UPTA 1T5IA 4KAXA 4OI2A 4D4KA 4MGZR 2H8KA 1OF1A 4C4PA 1ZM4A 1JI0A 1KO8A 2VL7A 4JLJA 4Q4HA 5TV2A 4X8OA 4AK9A 3KQLA 2QM7A 3C5HA 1ZJ6A 5EXSA 3QPVA 1R2QA 5E7MA 4DXAA 3IBYA 4NL4H 3ZJYA 3T1OA 1G16A 3UWKA 3SZRA 1KJWA 4OI1A 3PUZA 4LJ4A 4XVRA 5AUPB 1U0LA 2IXFA 2ZI6A 3REGA 1IN8A 3U4QA 4YLGA 2CNWD 1G3QA 2W6JA 3PG5A 2RGEA 1NLFA 1DAIA 4DIEA 3IHLA 3SFZA 5B58C 2CMKA 1OE0A 1I4DD 4Q9JA 3REFA 5KNCA 4LJ8A 1W7AA 1VTKA 1LY1A 1L4UA 4QXAA 2Q0HA 4QGAA 1XMIA 2C9YA 3N5CA 3NC0C 2EVWX 1R7RA 3SN6A 4V0NA 5G40A 4TTRA 3WMEA 2WIAA 2YNMA 5IHPA 1NN3A 4DLYA 2XOKD 5LDDC 3SDZA 1CRQA 4LBWA 1N0WA 5KTYA 3IQWA 3VNVA 3LV8A 1OH8A 1JBKA 3ZVRA 1CJKC 3NTUA 4IDOA 1QG2A 4DSNA 5DGXA 1IHUA 2OAP1 1E9RA 2I1QA 1OKKD 3ZS9A 1KO5A 2P6UA 3A1TA 4QKQA 4FCTA 2W0MA 2BMFA 2DPXA 2WV9A 5EE9A 5JWRA 3EA0A 2ZS7A 4URUR 4Q4AB 1A5TA 1W5TA 3CH4B 3L8YA 3DVLA 4PSAA 3A4LA 2OG2A 4Z1MD 1E0KA 4BFYA 2D4HA 2HV8A 4C0BA 1Q3TA 1ZVQA 4POAA 3W8NA 1W47A 2RMKA 4A82A 2O5VA 5IK2D 1N5KA 1P62B 3BK7A 4LJ6A 3F0TA 3QKRB 1NKSA 1KI8A 1ZM9A 1ZP6A 3ECCA 3QIAA 4DUGA 3UG6A 4LYFA 2QUZA 4PC3A 1BYIA 1E69A 3BJIC 3T1QA 3CNOA 3UMFA 1MT0A 1MABB 1BS1A 2NPIA 2F3RA 2WWHA 4F92B 4RKEA 1YR7A 4C3ZA 2F3TA 2K5UA 3UKDA 2G1JA 2W00A 2A30A 2XXAA 3BGWA 2CDNA 1LNZA 4TL6A 3QKRA 1Q1EA 1E79D 4LDJA 1XJQA 1U0HC 1XF9A 1AIPA 4X8LA 3LX8A 1FUUA 3DOFA 2KWIA 3M0EA 3DKVA 4FMDF 5LD2C 4TTPA 3K9LA 3GFOA 5FBQB 3WXMA 5TARA 1AZTA 4NH0A 2FZLA 2QTHA 4JLPA 2O52A 2XAUA 4HAYA 4JKIA 5AUNB 4AD8A 2WMOB 4B2IA 3AEZA 4C30A 1AQUA 1XTIA 2DYKA 3LQRA 3BFKA 4GNKA 2DY1A 1W2HA 1EWRA 2BJVA 3R8CA 2JLSA 1K6MA 1ZMXA 2YC4C 3K9GA 2QSYA 4YMVA 4A9AA 3SS8A 2IYUA 4MRSA 1FW6A 1AJEA 4MUAA 4JS0A 4IRUB 1ZRHA 2OCYC 2ZE5A 121PA 3AKYA 4TLBA 1GWNA 2WKQA 1DOAA 3R7WA 1ZYUA 4JLDA 1ETUA 4CEJB 1G9XA 5DIFA 3CLVA 1G291 2OFXA 4ZIRA 2W6JD 4RZUA 4ASUA 4MYTA 3ADBA 3BS4A 3WP0A 4UNPA 5GVRA 1KGDA 1IN4A 1IONA 4IDPA 5CIWA 4W7SA 4TQUS 4YC7A 2KE5A 4JL5A 2XGJA 3B7GA 5FL3A 1Z29A 3DZDA 2HT6A 2Q9CA 5KDLA 3OHMA 1UM8A 2IYVA 2ZRIA 2GEUA 2D3WA 2WWIA 2YVUA 5C46F 1NN5A 4HDOB 1SULA 3CBQA 4FINA 4G5GA 2IYWA 4TL9A 2R6GA 3SBDA 3SBEA 1MRNA 3EC1A 5D3QA 1N6PA 4JBXA 4LUCA 2ZRHA 2ZUCA 1Q3HA 2O8CB 1QG4A 2QA5A 3PV0A 5FFMA 3WNBA 3ZVMA 1G7RA 2ZSFA 1ZINA 3FMPB 1H8EA 2CHQA 3CF2A 2JLYA 2IL1A 2JDID 3I4LA 4KHZA 4M1OA 4A2PA 2ZI3A 1KY2A 5BW8A 5DNYB 3AVXA 4ZKEA 2C99A 2VP4A 4KITB 2J7PD 2NTYC 3F5FA 3K1JA 1G21E 2XZLA 3IIMA 2REOA 1BYUA 1EFCA 1WMSA 2VHJA 1VCMA 2JIZD 2EFEB 2VEDA 3TH5A 4MKGA 5E7IA 1HY3A 1J8MF 2F1RA 3KXIA 4EIWA 4TQ9A 1Q21A 4PC6A 1XCPA 2J3EA 1SHKA 3DEFA 4ZCLA 2WJIA 1FP6A 1JJVA 1AGRA 2QORA 221PA 4DLUA 1FTSA 2Q21A 4C2TA 4TYWA 3IKJA 1M2OB 3IPXA 1X8KA 4HB3A 3TAHA 4NYMQ 3TSZA 1WRBA 1XRJA 1IOZA 3ETLA 2VF7A 4P33A 2ZYVX 1G5RA 3T1TA 1XMJA 4X8HA 1LW7A 4C0KA 1M74A 2WVJA 3U5ZB 2YKGA 4U5XA 4MRPA 1YHNA 4UKDA 4M21A 5AUQA 1GM5A 4TLCA 2EW1A 5DN6D 3MWLA 4LHZA 4JLNA 5FUVA 3BIFA 1WB9A 2P6NA 4RSGA 3ZYCA 3OFND 4I99A 4XVQA 1Q1BA 3A4MA 1BMFD 2D06A 1CP2A 1J8YF 5BWMA 1D2EA 5L3QB 5AJZA 1XTRA 2YINC 1Z0AA 4V03A 1JAIA 1JR3E 1E2JA 2ONKA 3FHTA 3ZIAA 3PJRA 1KI4A 1XD8A 1U94A 3T1VA 1EX6A 1Z0IA 2ZJZA 4XJXA 4OK5A 1SXJA 3K9HA 4JKYA 3L0SA 4OI4A 1RJ9A 1Z28A 4QL3A 1A4RA 3FFBA 1JECA 1H8HA 1JAHA 1M7GA 1JXMA 3TBKA 4BLQA 5CLLA 3R9IA 4CIDA 3LXRA 4A0RA 4BLTA 2O8DB 4LRWA 4MYCA 1IJEA 2ZRCA 4Y0AA 1E0SA 4JMPA 4YMUA 4BFZA 1MO5A 3WRYC 4EPYA 3C15C 1A7JA 1F2TB 1KK3A 3C7KA 1E2IA 4TMVA 1ESNA 1ZC4A 5BQ5A 3CM0A 3CX6A 2HDNB 3NWJA 3SHWA 4XOIA 1E2NA 1U9IA 3BERA 2ONJA 3WY9A 3EPLA 3H84A 1NBMD 1GDDA 3DDCA 1IN5A 2Y8EA 1SVOA 1UDWA 3AVWA 3RRYA 3IEUA 3VR5A 1PUIA 4QRHA 4RVCA 1II0A 2IW3A 4BFVA 1HQYE 2REXB 4IVRA 2PCLA 1VG1A 3FWYA 1E9AA 2AD1A 2ATXA 2D62A 2IYLD 5SZJA 3GLGE 3K70D 2ZXUA 2EYUA 1FQJA 4DKXA 2EWVA 3FMIA 4Q7JB 3SJAA 2AL7A 1OH6A 3FTQA 1AK2A 2MSDB 5HR5A 4E22A 4PXAA 1WQ1R 5AJWA 1R5OA 1RE0A 1E4YA 3ASYA 3W6PA 1GTVA 3PEWA 1TTTA 2N46A 3Q5DA 3LXXA 5JHGB 4LPKA 3GJ3A 1M6NA 2C9OA 4G5OA 3B1WA 2EFCB 1D8TA 4UXHA 2IYRA 3QG5A 1G8HA 2PZEA 3MAAC 3BXZA 3I61A 1IN6A 4RFVA 4Q9IA 4PSKA 4WZAE 1KO7A 2VH5R 3RLFA 5CDFA 4B43A 1YKSA 4TWZA 1FL9A 4OJQA 4Q48A 3U3KA 4DDWA 4HDCA 4JT4A 3PFIA 5A5GA 4DDUA 4GPTA 3KFVA 4PQYA 1XNJA 2ZUBA 3LBIA 4IXNA 1OXUA 3LX5A 1PLLA 3KKMA 4OQFA 1NKTA 2IHBA 5CJPA 4MGKR 4P3YA 3K8YA 2HF8A 4IOLA 3U3RA 3QF4B 4V0OA 3R8FA 1Z2AA 2G0TA 4HZIA 4RZXA 5GVSA 4W5JA 1RVDA 2KJQA 4M2LA 4KVGA 1VIYA 2J0VA 3A36A 3N2EA 4QHYA 2NIPA 2Q3HA 1VYVA 3UXMA 2ODNA 1CJVC 2DFNA 2Q9BA 3AM1A 4LYAA 5K8UA 4JSTA 2ZS8A 1T9HA 3EX7C 1IY0A 2Q6TA 3Q5EA 4KFRA 3S1AA 1GIAA 3KKQA 1AS2A 1Q22A 2Q9AA 2GXSA 2Z4RA 4Q1FA 4BLSA 1OFUX 3QF4A 3BB3A 3A1WA 4OQNA 2VP0A 4MQBA 2ZTSA 1SVSA 1ZW6A 4R9UC 4W5WA 2OCPA 2IS1A 1LB1B 3TJZA 3EWAA 1F2UA 4URYR 3SHFA 3SJBA 1PVOA 2DHRA 2ZJYA 1AGPA 1Z6YA 2OSBA 4JYCA 2N1BA 4G0NA 4TL7A 3EASA 4DCTA 2G77B 4IOJA 4P4SB 3RHFA 1LVGA 4EPRA 3V4RA 5FOSA 4MDEA 1IBRA 3MSXA 1GILA 1E99A 1Z6GA 3MWJA 4U02A 4ERNA 2GNOA 3RRNA 2Z5FA 3QXHA 1G17A 1T3LA 2WSMA 2BHRA 2QQ0A 1T0JB 1E2LA 3LO5A 2GBLA 3AP3A 4F91B 4LC1A 3UANA 2JDIA 4Q02A 4WXPA 1XCMA 3LNCA 4HZUB 4C0HA 3GEIA 2XXAB 4FN5A 4JVNA 4Q9HA 3U6KA 3LRPA 5KSPA 2QM8A 4HAWA 2D2FA 1I4LD 2J41A 2X2EA 3O8DA 1P3JA 2BCJQ 5LB2A 4M53A 3FOZA 4TMWA 4H9GA 2IXGA 2JJ2D 3TW4A 3VX3A 2ZR9A 4OHYA 2RGDA 1T91A 1XEXB 4MGYR 1FP7A 3ZQJA 2CE2X 4S2EA 4YMSA 3WBJA 3CH5A 5AJYA 1TUEA 5DLQC 1P73A 5FBVB 4O3MA 4XD7D 5FL7A 3FVQA 4PHTA 5EZ6B 3KUDA 4DCNA 4IXMA 5J4HA 4UXJA 1P6XA 5SZKB 5JFGA 1FTNA 1Q1ZA 2GJAA 2V4ZA 4JVLA 1CR2A 1KDTA 1OYYA 1Z3IX 4NYIQ 4OK3A 4WVFA 4EAQA 4XVUA 3IHWA 3EZ7A 5F98A 1TADA 3CKLA 1NMXA 1DTSA 4CVNA 3QVUA 2YOGA 2BJWA 2CLDX 1NJGA 2QAGA 4UXIA 2ZRMA 2ZYUX 3IDQA 2OM2A 1X1RA 2H16A 4ZIRB 2FSFA 1SXJD 3EARA 4HUQB 4F4CA 3HU3A 1GRRA 5A4JA 1G18A 1E98A 2FF7A 4DCUA 3AV0B 3VR2A 5B57C 4AYXA 2QT0A 3RABA 4NYIR 1U81A 3WNCA 1N5LA 4UNNA 3G82C 1TPZA 1W2GA 2F7SA 2PJRA 2ZR7A 2NQ2C 5JSZB 3AVYA 1C1YA 3A1VA 1R10A 4CEIA 2GF0A 1D9XA 1LV7A 2WHXA 4MRNA 3I5YA 2EQBA 2NGRA 4BZPA 4B74A 2O8FB 1SGWA 2R6DA 3RS2A 2VSXA 2GXAA 3CO5A 5E95A 4FIDA 3MWKA 1WA5A 2WPDD 4JBYA 1KI6B 2O8CA 2NO7A 5HZKA 2C77A 3K0EA 1IN7A 3LDAA 2Z0MA 4TSFD 4M9SA 1RZ3A 4LJAA 3MUFA 2R44A 4LJ9A 4TMKA 5AJXA 3IILA 4B3BA 4HUTA 3W3ZB 3RC3A 4QOSA 2AFHE 1TX4B 4B3FX 3LW8A 1XJCA 2OFOA 3B5JA 3V9PA 4D26A 1GVNB 1XMSA 2ZI4A 2HYIC 5H8WA 1XZPA 1QHGA 4AYTA 3HDTA 4XH9B 1OIVA 3IIJA 3S1AB 1MABA 1G7SA 4I81A 3RWMB 3SE0A 1NMZA 5JEDA 4DSTA 1U8ZA 1Z22A 2GKSA 2XX3A 4MRVA 3X1DA 2WSSA 4S35A 4MITA 5EE0A 5FBLB 3ICEA 4PAMA 2XEXA 3QBTA 5AR1A 1P72A 5FBRB 1QHHA 2LCFA 5FTLA 1T8UA 1KMHA 2CCJA 2VP2A 4DLWA 2RCNA 2WKPA 1NIPA 2ZSEA 3PEVA 3EPKA 2EYQA 4D0LB 2VYFA 4XTRA 2ZJBA 2BMJA 3THYB 2AK2A 1G8PA 4N1AA 3THWA 3GLHB 3A1UA 3KKNA 2G3YA 1K8RA 4LBYA 1KK0A 4M9XA 5KO2A 4OHWA 4LHXA 3B78A 3EZ6A 5HCNA 1FMJA 1VYTA 1NRJB 4Q01A 2VQSA 2QMHA 1UKEA 5FTKA 1YE8A 5CK4A 3GLFA 1OSNA 3GLHE 2ZVQX 1F48A 4B6FA 3CWQA 2QMEA 1W49A 1OT3A 3GJ8A 1UKZA 1YZTA 3FFAA 3VNUA 2GDJA 4M4SA 3H4MA 3QENA 1VG8A 5G53C 2V3CC 2FGJA 3O8BA 1E2KA 2FPKA 1JPJA 4MA4A 2HUPA 2QN6A 4W9MC 3W5JA 3ZD7A 1W4CA 1AM4D 3GJ0A 3I1FA 2JLZA 3NBXX 3QE0A 4IVQA 1N6RA 2HEIA 3X1YA 4CGZA 1ZD9A 2ZUDA 3AKEA 3N2IA 1US8A 4Q9LA 5AK0A 1HYQA 5H68A 1N6LA 5DYGA 5TY0A 2B8WA 3I32A 2X19A 3GLFB 4MYHA 3EIHA 2YWGA 4NCHA 1KKMA 4LZZA 3WYAA 2OCAA 1RRPA 4HB4A 1H8HD 4EPVA 5D3MA 1IJFA 1N0UA 4DHEA 2W6IA 1QHXA 1SXJC 2AKYA 3OEHA 2PZFA 1NVUQ 2E9SA 3LH5A 3PENA 4ASUD 2F55A 2ZAMA 5FTJA 2ANCA 4KXFB 1MO6A 2JJ1A 5JBQA 1GSIA 4Q00A 2GETA 3PEYA 3NHAA 2J0SA 1KAGA 2V7QD 4KV9A 2ZE6A 4JLVA 2QQEA 2ZEJA 5FPTA 3LD9A 3TMKA 1A82A 1SVKA 4TL8A 4BRUA 4PHGA 4AG6A 4FWTA 2PJZA 1EFUA 3KXKA 1OLOA 2W6ID 2R2AA 1UBCA 1H8ED 5EUQB 3W5IA 1G1MA 1HT2E 4LYJA 4Q1BA 4BGDA 1U9IC 1B0UA 1CIPA 1KSFX 1PUJA 2W2XA 3B2EA 4CEJA 1FPMA 3DMNA 5EE5B 1Z6AA 1XD9A 3QEOA 3U61B 4H1UA 2FH5B 2VTKA 3A1SA 1XX6A 3AF3A 3BRWD 3IPYA 4P31A 3RS4A 3VHLB 2AXNA 5DISB 1W36C 3ICQB 1L4YA 3LBNA 1GZSA 1DBSA 4XD7A 5JCPA 4KSCA 1XPOA 2P0EA 4TSFA 1U8YA 1R0YA 2PL3A 3P32A 5JJIA 3FMOB 5EXTA 2WWGA 4R71A 2VLIA 3WYFA 2QPTA 1I2DA 3GEEA 5EQTA 1ZD1A 1R8QA 4LHYA 2ZYTX 3U7FB 4PR0A 1HE1C 5EE1A 3QPWA 4LV5B 4A6XA 5CB6A 5BYKA 4M1WA 1SVIA 4FI3C 1JJ7A 1X3SA 2YZ2A 1E9FA 4B47A 2WJJA 1EK0A 3LWNA 4QBIA 3W90A 4DLRA 2WWFA 4IFEA 3KQHA 2MSEB 5J4YA 2ZJ2A 3HWSA 4NE2A 4V0MA 2EU8A 2WAXA 4RJLA 1RC8A 3CRRA 3L0OA 4DT1B 2H1LA 3B9QA 5G3YA 1NBME 3K0CC 4LJYA 5FOUA 4BLRA 3L8ZA 3I92A 5JJKA 5JWHA 3EA5A 4DLXA 2IK8A 4DB2A 4PHFA 5EP4A 4QJ5A 2JJ1D 4ACBA 4Q03A 2QY9A 3U60B 3B13B 5DE3A 1UBEA 2CEAA 2ZQ5A 2ZSBA 3TQFA 4PFSA 1Z0KA 3A6PC 4KSBA 2XITA 1KI1A 3HP1A 2UKDA 4KBFA 2FSIA 2GK7A 2V6JA 4OJKA 3U3JA 2E87A 5J4LA 2ERYA 2OZEA 2VHCA 2BEJA 4DBLC 3TGPA 721PA 4HLDA 2DFKB 4BE7B 2KBEA 3GQBA 4A92A 1N6KA 1KHTA 5DHFA 4DC9A 2WZQA 1WE2A 1OIWA 4EJSC 4DIDA 3U7HB 3ZQ6A 1KNQA 3AQ4A 1OYWA 5FI0B 1IXSB 4BZQA 1BO6A 3AVVA 4A4DA 4RZ2A 2J0UB 3DO6A 1FX0B 2VHQA 2QP9X 1NVWQ 4QBFA 4P0TA 3QXJA 1OHHA 1W1WA 2V55B 5F9HA 3AP1A 3P26A 2WIBA 4B2LA 2D7DA 421PA 4JL8A 2QZ4A 1X86B 1UBFA 2VRWA 2RGCA 3KJEA 2A9KA 2CCKA 4PPQA 1SZPA 2BKEA 4BFTA 2J1LA 4L5BA 3OE7A 4AWXA 1TQ6A 2IYZA 1E0AA 4IEEA 1HEIA 5J4VA 3GLIB 2UZ3A 3FE2A 3GJ7A 1EG7A 5EP1A 3ZZTA 5CB8A 1NSFA 2W0SA 1C9KA 2O0HA 4NPHA 2ZU0C 5LBIA 621PA 2J46A 1JR3A 2CL7X 3THXA 1G6OA 3K0FA 4A0FA 4GDFA 4MH0R 2R65A 2BV3A 1ELOA 3BFXA 3CPHA 4IFBA 4KJZA 1QRAA 3A4NA 4AC9A 5HZHA 2VPPA 5F2EA 2ZROA 1II8A 3L0IB 2JCSA 2IYTA 1W36B 3ADDA 4GT1A 3IO5A 3KJHA 4TLEA 2ZANA 1PLKA 4LHWA 3CPJB 2RGXA 5EP2A 1GL9B 3A8TA 1KKLA 1NSTA 1VHLA 2H7VA 1O87A 4HLUA 1XBTA 2PMKA 3CB4A 4B71A 4ZCIA 1MRSA 3DM5A 1GL7A 1OXTA 1Z2CA 4V02A 5AWFC 1TQ4A 4DLSA 2AXPA 4BWYA 4OQXA 4TN1A 3LAWA 2QGNA 1II8B 4N3NA 2OHFA 3V00A 1E2QA 1PZNA 4PPFA 3ZZUA 4AKEA 1CJMA 2I3BA 5KU1A 2PCJA 3LVRE 3SYLA 2PT7A 3BORA 3HR8A 2F1IA 4Q1CA 3C41J 3VR6A 4G3XA 1TEXA 2ZRFA 5CM9C 2FDCA 3QKTA 4LC0A 1QZXA 1A2KC 2WAYA 1SVLA 2C04A 2FFBA 1CBUA 2EFDB 2H92A 2IUUA 1U90A 2BWJA 2FGKA 5FPKA 2FOLA 3P4YA 4UNSA 3D31A 4GRAA 2NPFA 3SJZA 3CWZA 1UFQA 4C9BA 2G88A 1DELA 4QBHA 4LOAA 5DHAA 2NG1A 5GJVC 2QAGC 3K0AB 2GJ9A 4B76A 2HJGA 1S1MA 3MCAA 2X77A 4D80A 4JLMA 4B75A 4RZ3A 3EPHA 3Q9LA 4EJSB 1ZBDA 3U7GA 2DFTA 4LGMA 4BFUA 1QF9A 3JVVA 2ZRKA 1W0JA 1AKYA 3R20A 3LA6A 3WRXC 3P27A 3CNNA 3DZ8A 1Q20A 2GXQA 2Q3FA 1M1YE 5JEEA 5CYPA 5HCIA 2ECKA 3KTAB 1IXRC 2ZRAA 4PPNA 2FEMA 4FCWA 4P32A 1KJZA 1Z6TA 4NYMR 1HQCA 1NLZA 1ZUNB 2WWYA 1K5GA 4Q4LA 1GUAA 4HZUA 3CR7A 1JALA 5H1YA 5KSOA 3NDPA 2PEYA 3GEHA 3U44B 2BBTA 3IUYA 3D7MA 4DDTA 2CLCX 1COWA 1G7TA 1S3GA 4DRZA 1C4OA 2JLXA 3RC8A 1BMFA 4F38A 2NO9A 4V0KA 2XJ4A 4M9QA 5DSZA 1SKYB 2J0UA 3X1XA 1MR3F 3Q3JB 4US2R 1FZQA 3KQUA 4QG7A 2R6CA 2G83A 1XDBA 2ZI7A 2VHUA 3W6NA 2FWRA 5GADl 5EJEA 1BIFA 3BD9A 1ZAKA 5IK2A 3DKPA 1M8PA 4L9WA 2IWRA 3U44A 4OHXA 4PZZA 1NNEA 2F9MA 2RGBA 5DYIA 3TSWA 4NYJR 3ZGXA 1RRGA 2AR7A 4JYBA 4B32A 3WNDA 1XEFA 4C7OB 2AK3A 5TB5A 2ZU6A 1KO4A 2DFLA 3EC2A 2RH5A 3ZH9B 2P2LA 2ZJ5A 1MKYA 1JR3D 4Q18A 4Q19A 4DLVA 2MMGA 4QM7A 2XOKA 4XWOA 4A15A 5LPNA 1G8YA 2ZE7A 1RYHA 3HU2A 1N6OA 4BEBA 4CEHB 5HE9A 4FMCF 3U4QB 2VP9A 3RDPA 5L3VA 1N5IA 2ZYWX 5CYOA 4CF7A 1QDEA 1RRFA 2VIIA 5CM8B 3SI7A 3EW9A 5K8TA 1ZM2A 3D6TB 1GAJA 3PIRA 4QFMA 1Q57A 4YMTA 5JRZA 2F43B 2O0JA 3VKWA 3EAQA 4CRWB 5TMPA 4LSGA 1LFDB 1XTJA 2HCBA 3GFPA 4X8MA 3T5DA 2MMCA 4L15A 2WOJA 8OHMA 1E9SA 4QHSA 1G8GA 3Q85A 4BFXA 3NKVA 2EFHB 3KB1A 3BE4A 4YMWA 4IOKA 3OF5A 3KUCA 4LV6A 2PLRA 4M1SA 4MGIR 1P4SA 1TU4A 3UATA 3EZ2A 1D2NA 5K8LA 3NC1C 3QF7A 5FH9A 4LBVA 2F43A 4WIAA 4GOKA 1JEEA 4KODA 2V1UA 3IQXA 4EDHA 1KO1A 2BKUA 2FV8A 4NONA 5FOTA 4QM6A 2ZJ8A 4C0SA 2OT3B 3K53A 3KZ1E 4Q4AA 1YJ5A 1RPZA 3G0HA 2Z83A 3VKHA 3UG7A 4TZ6A 4D0NA 3ADKA 3T12A 3P1JA 2ASEA 3QXCA 1S0UA 2BIFA 1W0JD 2QSZA 2REBA 4MKHA 2AN9A 3MWYW 2BM0A 4I4LA 4O25A 2CCGA 3CONA 2ZS9A 4LJ7A 2B21A 3CRMA 3RRZA 5GJCA 4HSEA 4A2QA 1S3SA 1VMAA 4JL6A 1N3BA 5F3WB 4FMCB 4CEIB 1WCV1 4Q4JA 4D81A 4ZDKA 3QKSB 1E2GA 3L43A 4GZLA 2O8FA 4RD4A 1Q12A 2ATVA 3FKQA 5CLQA 2A78A 1XPRA 3CUEF 5EP3A 3WMFA 2GEDA 1UKVY 4KFSA 4D25A 4NDZA 5JMTA 3VFDA 1ZCBA 1VYUA 2QP3A 4BQSA 2A2ZA 3PITA 3DM9B 2JAQA 2QAJA 4HB0A 2GCOB 4KVAA 1CR0A 1E96A 1XZQA 2OUKA 2WMNB 3FB4A 2WJVA 3P4XA 4IW3B 4KBGA 1NP6A 5H70A 1E6CA 4LBZA 1XJ0A 4B3XA 3U3OA 1M7HA 3ZD6A 3OESA 1KK1A 4A0GA 2J5XA 1CULC 3M4YA 1KYIA 3O8CA 1NVVR 1SHZA 1SVMA 2ZETA 2CHVA 1U99A 4UQOA 2O8BB 1N6NA 1OXXK 2GA8A 5EUMA 1GNRA 1BH2A 1ZC3A 4DJTA 4DVGA 3B1YA 3ZVLA 3B1VA 3KX2A 3AP2A 1DAMA 1US8B 4I1VA 5IRCD 5BN4A 2Z43A 2PH1A 2D7CA 3FYHA 1WBDA 3TR5A 2IS6A 4G1UC 4JJZA 3QXSA 2QGZA 2J7KA 5L3QA 3VX4A 4AI6A 4M0LA 4PPGA 1NVVQ 3NIBA 2YV5A 4LHVA 4B6EA 1VPLA 4QHTA 2IHYA 2GESA 3WHKA 4BFSA 3THWB 4TMTA 3VKGA 2QE7A 4WOPA 5B2ZA 2ORVA 3GLFE 4AG5A 3GPLA 1R6BX 4A0HA 4RFSB 1NLYA 1NG9A 5TVKA 5B64A 3EIEA 4GP7A 4WW0A 1RRCA 4JLKA 3LFUA 1G4AE 2F1JA 1S8FA 1XWIA 2VO1A 1CR4A 1NVXQ 5FOVA 2IX3A 1T0HB 5KSZA 2XSZA 5FL7D 4AY2A 4A36A 1NL3A 4OHVA 3I5XA 1SKYE 4QGHA 4LYHA 3QPUA 4KLZA 2WJHA 3NXSA 1E94E 2ANBA 4HLUC 5BYJA 1UAAA 1E2FA 2D2EA 2IEZA 3H2YA 2J59A 4CZ2A 2JASA 1P5ZB 2WICA 1MH1A 4QNRA 3EIQA 2QEQA 5FI1B 3U3MA 3HU1A 1E2HA 1XTKA 1HA3A 2PX0A 3LW7A 2J0QA 1W4RA 3OEED 1QHYA 2IWHA 3Q8XB 5KSYA 4TQAA 3MG9A 1KI2A 2XZPA 4E09A 1JXOA 2R8RA 3VQTA 3VU9A 4B48A 3FDIA 2CE7A 3CIOA 3TW8B 2QTFA 1KIMA 2RHDA 2YWEA 4URWR 3KFXA 1E32A 1OKKA 3PR1A 1WXQA 2XTMA 1TUIA 4DSUA 1DG3A 5FUWA 4ABYA 5GJWC 1EFRA 2PZGA 4NCIA 1GITA 3T34A 2IA5A 3QXXA 1GFIA 1AZSC 1CXZA 2ZSAA 4M22A 3DOEA 5KNDA 4H1VA 1Z08A 3BOSA 1N0VC 5G3ZA 4PQFA 2V8OA 1DO2A 1RIFA 1Z0FA 2FX3A 1J2JA 1QVAA 1EESA 3VR3A 4BEJA 1NN0A 4II7A 3TIFA 1UEIA 2VHTA 3NH6A 3HPRA 4A8JB 4PSVA 3EZ9A 3SR0A 1Z06A 2P65A 1OPXA 1OB2A 4CDGA 5TXGA 3CR8A 2QBYA 1HV8A 2OE2A 3W34A 3VR1A 4FMDB 2FE4A 5SZIA 3W3AA 4F4JA 2GXUA 3B85A 1JQJC 1XEWX 3Q72A 3SYNA 2OESA 5CJ2A 1Z07A 3NDBB 1KJYA 4D4JA 3GJXC 3ADCA 2JGNA 1QVRA 1NI3A 4R7ZA 1ZNYA 2RHMA 3SC3A 3ZZ0A 4URXR 1E9CA 5G41A 4ARZA 3O47A 3AKDA 1F60A 2GCOA 3P20A 3MFYA 2NO1A 4BLPA 2RGAA 3JZMA 3QEJA 5JI2E 4Q1DA 4A8JA 1TQ2A 1F3OA 1CKEA 2X2FA 1W36D 4M1KA 2A5DA 1UEJA 2QBYB 3THYA 1CF4A 4JLAA 4NCNA 3ND8A 3GLGB 1YZLA 5HTKA 2QT1A 4DLZA 2CNWA 3Q7QA 4Q21A 4GI7A 1R8SA 4O2RA 4RD6A 4PAOA 1P9WA 4PZLA 3IEVA 1TF7A 3UPUA 2BCGY 2PT5A 4M9ZA 3ND9A 4DEYA 2RB4A 3EG5A 2FFAA 4ARZB 2NMVA 4MYUA 3OAAA 1TEVA 4M1MA 1A2BA 5E3HA 2J9RA 2FFHA 1NG1A 1CEEA 1KY3A 2JIZA 4HAXA 1KSJA 2JLWA 3OIUA 1S1CA 4HYYA 4DEXA 5C4MA 4IDHA 2YOHA 4Z8YA 2OILA 1W4AA 1YR6A 1P2TA 2W2TA 3BH0A 3HYTA 4R2HA 1P9NA 2OV2A 1Q0UA 1YZQA 2J7PA 2QNRA 2UZIR 5DO9A 3RAPR 3V4FA 3X2SA 1G3UA 2AWNA 4RFSA 2HYDA 1R0XA 3K09C 3NBZC 4O2LA 2RAPA 4PO9A 3FHCB 3L82B 1XTSA 3MD0A 4GBMA 1W0KA 1P2VA 4B3CA 1W44A 3EXAA 4CW7A 5KHOC 2OXCA 2IYQA 4BPBA 2B92A 1U0JA 2DBYA 5KYKA 4LV8B 1FUKA 1Z47A 5BN3A 1E9BA 2J45A 2BMDA 2OBNA 1Z5ZA 4R98A 3RS7A 1NY5A 1T3SA 2EFGA 4ZCMA 1Z8FA 3K0SA 2FEOA 3CF6R 5EXXA 2O8EB 1KI9A 4TT3A 1E1RD 3THOA 4L9SA 1XCGB 4CT5A 2WWXA 1J99A 2GHIA 3QVVA 4TTQA 3AF2A 2OBLA 1FX0A 2R62A 4IHQA 1TNDA 2QMUA 3HPQA 4I1OA 1X8LA 4QC2A 1FOEB 3MLEA 3RS0A 1J70A 3BWDD 3VAAA 1S9DA 1NN1A 1TF5A 4M8NE 2A5YB 1UBGA 3GCGA 2QG6A 2QL6A 1IY1A 1OH5A 1GL6A 2V6IA 4MUBA 1YZKA 1TAGA 2VA8A 4A8JC 5DI9A 1Q1QA 3SQXA 4OK6A 3Q7PA 1VKJA 4A2WA 3K70C 4TT3D 4ZDJA 2W2VA 1GRNA 1XD2A 3AF1A 5FTNA 4C2UA 1DEKA 3EWSA 2D74A 4IJMA 4JLOA 3RVBA 3VHXA 2I1VB 3NBFA 1TF2A 4JVMA 2AD5A 5A0FA 4NKRA 4BUJA 5KDOA 2FU5C 1OB5A 4YDSA 4BLOA 4DUGD 3K09A 4NU0A 3B9PA 4LX0A 3WBKA 2BBOA 2OEPA 1LTQA 1X8JA 1MO3A 4U00A 3OFNA 4B33A 3ZDQA 4YXWA 1IQPA 2XZOA 2PBRA 3WMGA 1ZD8A 4CT4B 5FBWB 4EJSA 3SYKA 2VP6A 4Q5IA 4LY6A 1DS6A 3PVSA 3TKLA 1P60A 2AFIE 4N0DA 5IF9A 1Z0DA 2AKAB 5FTMA 4F93B 3KDSE 1NMYA 1GKIA 4HATA 2FZ4A 4QBGB 2JLUA 2QI9C 1XXHE 3R9XA 1BOFA 4HAZA 1E1QA 5FOWA 1GKYA 3O8RA 4UJ5A 1V43A 3I8SA 4GMXA 2F6RA 4QNMA 2SHKA 3IIKA 3TLXA 1P7CA 4OL0A 4HEJA 1GNQA 4DDVA 2GK6A 1YZUA 2FNAA 4EFNA 1N25A 5HKKA 2QP4A 3ZLJA 1GRQA 1P2SA 2ZSDA 5AJVB 4DWJA 5J5CA 4ZI3A 4Z54A 5BN5A 4J0QA 3A58B 4TYYA 2XB2A 1LF0A 4W5HA 3LLMA 3QKSA 4MKFA 4RD3A 5LD2B 2WJYA 3NEJA 1KAOA 1S4QA 2ZE8A 3PCRB 4IVPA 1G64A 2NZJA 3GLGA 3J81k 3KXLA 3AVPA 4ZDWA 2GZHA 3FGNA 5KOYA 2A3RA 3K9NA 2Z6VA 5JECA 3AH8A 4KYIB 1HT1E 1VCOA 5CK5A 4Z51A 4PAQA 4Q66C 3CPEA 2FN4A 5C18A 2OFWA 3C5CA 3X1ZA 1KMHB 2YHSA 1GNPA 1U98A 1NF3A 2IBMA 1HURA 2NO6A 3RSLA 3TAUA 5C2JB 4RY2A 1AA9A 3NH9A 2BM1A 2NZ8A 4LWZA 3U7EB 2F1HA 1YR8A 5CIQA 1S2MA 4ZV4A 4C0JA 3FKSA 3B82A 4YXWD 4TLAA 3W9YA 1CU1A 1UDXA 2KI5A 3DL0A 4NHOA 3K0CA 2IUTA 2ORWA 3I62A 3GD7A 1G6HA 2ZVPX 1E9EA 2ZJOA 2H5EA 5EXPA 3GLIA 1ZM3A 4PZYA 1NIJA 4O0MA 1I4TD 3OE7D 4C0LA 1F6BA 1II9A 5E4FA 2KB0A 1AS3A 4GZMA 4HAUA 4Q1EA 4RD1A 1P75A 2HT1A 1EGAA 3MRSA 4JIMA 5JWOA 3TRFA 2OXRA 2WM9B 3F8TA 3ZVNA 2FA9A 1G3IA 1E1RA 1JR6A 1UF9A 2ZM5A 4EQ6A 3DMDA 2G9NA 1E2PA 1K5DA 1DO0A 2NO0A 4PHHA 1OJLA 2XSZD 3AGPA 1CR1A 1G20E 4RCZA 1M34E 3GJ5A 2JEOA 2P5SA 2GJ8A 2ZRDA 4KO8A 1MOZA 3QY0A 5UKDA 2A5GA 2VF8A 5J4KA 2JA1A 2HLDA 4PTLA 3CRQA 5L3RA 3T5GA 3BB4A 2IYSA 5DI3A 5JSZA 3B60A 1MV5A 1G5TA 5LB4A 4C7OA 3QKUA 1H65A 3GFTA 2JLRA 4LK2A 3EZFA 4GMDA 4ZDIA 1XU4A 2GCPA 2IEYA 2N42A 3EPJA 3R7WB 3SQWA 2IYYA 4FW9A 3RANA 1R5NA 1L7VC 3E2IA 3T35A 3KJIA 3CX8A 3HYRA 1OXSC 4LPSA 1KI6A 4OYHA 5JCZA 1EWQA 4XSHA 3W8RA 5FOXA 4CEHA 1VDZA 3OAAD 2WJGA 4P4UA 2L0XA 3NBYC 3OZXA 4QJ4A 5ANRB 3QJYA 2IS2A 3G5UA 1KZ7B 1HTWA 2QTVB 1R5BA 2WOOA 1FMLA 2BC9A 4BASA 3NG1A 2JJ8A 1YQTA 2GZDA 2QRNA 1BKDR 1LS6A 2LKCA 3LBHA 2F9LA 3PUWA 4B73A 3CZPA 3QQ5A 3QG1A 3TK1A 3PQCA 3QBVA 1N6IA 1P2UA 1YZNA 5KNBA 4RKFA 1E2DA 3I3SR 1ANKA 3TSOA 4M1TA 2FJUA 2GF9A 2VP5A
chains in the Genus database with same CATH superfamily
2QJFA 3Q0GA 1X42A 2WUDA 3G2OA 1NAIA 3LF2A 2P5TB 4IDGA 4PG7A 1IWBB 4JBWA 3A9TA 3GLSA 3KAJA 4OLAA 4U7DA 3TR0A 2CJWA 3IDFA 1MRZA 2YN0A 4W9NC 1FNNA 3NBKA 2PYIA 2W4QA 4P93A 5HCUA 4BMCA 3V8RA 3JAWA 1NI4A 1PL7A 2WB2A 4EG6A 2Y1OA 2Z8YM 1UKYA 1JEQA 2XDAA 4HYQA 4B8YA 3AVQA 3CNHA 5KHAA 4DNOA 5KQSA 2CMHA 2RC6A 1EFTA 1UP6A 2Z8YA 3AKCA 2GAAA 4J9VA 5FB3A 3WGGA 3KB2A 2GAJA 2HN9A 2JJ2A 1V16A 1DAKA 4B5LA 3ZBUA 1O3YA 1E1DA 2GVZC 2YUIA 3RG2A 4UCFA 5LR6A 1NSYA 1ZN8A 3DXZA 1ODSA 3GPBA 3IP8A 1C0PA 5BMVA 1WD7A 4C5CA 5JAHA 1QX3A 1SQ6A 2ZBFA 3B9BA 5J40A 1T1RA 1LUAA 3JU3A 3HQ4O 3DEHA 1L8OA 4EYQA 4UBOA 5EZYB 4D4MA 4EY8A 4ZZ2A 4EHFA 4DR2B 2CJYA 4XJSA 4AP6A 1SOVA 1DC3A 4EL5A 1IM2A 2JFWA 3B1JA 4FNGA 1VHDA 1L5NA 2Q6VA 2J3KA 4QGFA 2GZAA 2Z04A 2I91A 3H8SA 4RCYA 9LDTA 5CITA 3BQ9A 2EKPA 4KO3S 1GT6A 1I6KA 3R9KA 4AKIA 1U9YA 1KU0A 2XYGA 1ABEA 4EB0A 2VZ8A 4DXDA 5A1JA 4P4SA 3I2HA 1G19A 1USKA 2Q2OA 3N53A 5ENVA 2Q1SA 2V65A 1XWWA 1H85A 2B7CA 3A9SA 4B9EA 1OZHA 4B82A 3RRMA 1LNSA 2I7TA 3Q8WA 1EVQA 5L3SB 1B23P 2GI4A 3S55A 2DJ5A 4MHOA 3HJAA 3SOPA 2CFTA 4QJ3A 1UMBA 1IRIA 4QOEA 1OXKB 3DJYA 1R6TA 3PHHA 3SHOA 1MEEA 1U28C 2VPXA 5HPYB 4NP6A 5LMCA 1G3RA 2OZVA 3WLJA 3EXIB 1S01A 5B3LA 2AOVA 1SCQA 1SEVA 4RKYA 5KWSA 2GAIA 2DJIA 3FPHA 4PLFA 4EGFA 2VVTA 3FMFA 3MCVA 1I80A 3HUFA 2GYVA 2KBFA 2BPOA 3LXUX 3Q0IA 5TQ2B 4EYGA 3HFSA 4G1VA 5IDVA 4CFZA 5JS7A 4HNTA 1EFRD 3HA3A 2YN4A 5TNXA 2Y1DA 3RNLA 3WLTA 2B1GA 3UOWA 5JC8A 3T3NA 1E3EA 2F00A 2Z5LA 3KU4A 5BXQC 3CZMA 2V5AA 3MW8A 1UT6A 2HJVA 3E70C 4C1NA 4D9FA 1VIDA 4CIYA 3T41A 3RK1A 1NR5A 5FUYA 2W6MA 1CTQA 2Y93A 4JBHA 4DFDA 5BV1A 3DZCA 2W83A 2EDAA 3NHRA 1KK2A 1SA0B 3P9IA 4DQUA 4Z1OA 2HWXA 3E5HA 1PSDA 5E3IA 3OTQA 1KMQA 4Q47A 1A7UA 1V5WA 2DCUA 1UPAA 1KMIY 2DMRA 1VCIA 2ZIGA 2A0WA 2J32A 2HIHA 2PH7A 3OZGA 5ALMA 3TW8A 4D9BA 2O8EA 2Q0QA 1M54A 1OWMA 2PYDA 2XUOA 3DB2A 3FPFA 3K0FB 3OCXA 3OI7A 3Q4GA 2C9CA 2AE2A 3FWKA 4UHJA 1WAMA 2AN1A 4ZA2A 3TRHA 4L8FA 4LZJA 4YA6A 1NNLA 2YWHA 3BRSA 4G5FA 2RAUA 4HDRA 2FSGA 2DB3A 2Y27A 1SXIA 1Z38A 2IXEA 2OHXA 4S1VA 4ZU2A 1LSJA 1SBQA 1SKUA 2JAXA 3T7SA 3TQCA 2G6BA 3VPAA 3GT3A 4TQGA 1JH9A 4I42A 3RNOA 4OY3A 3ERCA 2DBZA 2PH3A 1ZIOA 3G8BA 3PE3A 2C2HA 5EQFA 5HBRA 5DOZA 4QIHA 1XL0A 4UE6A 3RVPA 2HIGA 4FLEA 4WBSA 5A3VA 4IKEA 3CF4G 1SNYA 1XFAA 3LVQE 3RHZA 5ALPA 1AUOA 4J3JA 4JUBA 4KU4A 4Y2PA 4OI0A 3ZV4A 1R6UA 4R2MA 3WDSA 3HMQA 2BTQA 1WL8A 2UVDA 4PGHA 5F64A 5K6RA 1WBJB 3WZ2A 5JYEA 3KDAA 1BSVA 4WXYB 4G41A 3RR2A 1IQRA 2GCIA 5DGCA 4Z7QB 1XAJA 1CS4C 4HF7A 1CEYA 1P74A 2IZZA 3PUXA 2PZBA 4EO4A 4MPRA 1C7ZA 4X7PA 3JZFA 1J06A 2H59A 4EW3A 1N78A 2YZMA 3U09A 1DIHA 2I8AA 1EXWA 2DECA 3AR6A 1AN9A 1JGTA 3EPPA 4UFPA 3RAEC 1PJRA 4H4EA 2C00A 2HF9A 3KU1A 2FG5A 4NYJQ 5JI3E 5M04A 4DCGA 1TA0A 2Q0SA 2V7GA 4B4KA 4ER7A 1JPNA 4Q4JB 2V9ZA 3MMPA 2NYRA 5ICMA 2PWBA 2WILA 3H5IA 4G9EA 1Y1KE 4FI3F 1AX9A 3L0PA 4KLNA 5B3JA 5CFOA 5AW4A 4PIPA 5ERXA 2NXCA 4DUYB 2FPMA 1UT8A 3AHEA 3G0BA 4ITVA 4ZI7B 5AUOB 3KR2A 2CBZA 2XADA 3A1CA 1A2QA 1PTJA 3F2VA 3K0AA 3NORA 1JHXA 3DHEA 3S4YA 1FYEA 4IV8A 5A0VA 4JK3A 4BQIA 4JCOA 4LFBB 1YRAA 1OTXA 1OX6A 4DCVA 4YRFA 4D3SA 1E3MA 1CDDA 3H86A 1QHHB 1VLLA 4KQIA 2BVNA 5LXTF 4BNWA 4ETMA 4LTNA 1JAYA 4MWDA 1E0DA 2LV8A 4EFMA 3ZHQA 1PU2A 5FAKA 3B1FA 4IUDS 4IXDA 2FPXA 4TMZA 4WUTA 1I5OA 5JXIA 1TM5E 2YS7A 1XMVA 5BQOA 2ZREA 1T5TA 2IC5A 2BI7A 3I1YA 4J6EA 3L1JA 821PA 3EAGA 3U2QA 3M4XA 2IF0A 3C39A 4PGAA 5IT5A 4NE9A 1QNFA 3NRBA 4M55A 1VKHA 1BMDA 4TVKA 2FRXA 1Q44A 2DRIA 3L1KA 5AVSA 2BZ1A 1JHUA 1AC5A 3KYCA 4TXJA 1GLNA 4Y6PA 3TEFA 1NQVA 4OBEA 3NBAA 1LPPA 4YTEA 5AKLA 1WB5A 4XQGA 2ZJ0A 2JAPA 2A7QA 3GD5A 3IGFA 2VBGA 4JENA 4KRYA 3BULA 5EIEA 2FW9A 5K0FA 1W4BA 5J2UB 3CF0A 3A37A 1F5NA 3NCHA 3THXB 1RM3A 5B3JC 1GG9A 1KRWA 1JQDA 2WHRA 4U3JA 5DLEA 2V9PA 3WDKA 4OUDB 5THQA 1EUQA 5EIAA 4ZK2A 3F3SA 4UTXA 3FOWA 4YCNA 1G3MA 1JBQA 1D7AA 1N5JA 2OZLA 1ZUD1 4NY1A 4QGBA 2PSEA 3WLLA 1R6AA 3QXZA 1E20A 4IOMA 1S7CA 1QIJA 2R9VA 1KTVA 3FPGA 4K9OA 4KTTE 2UVQA 4EBBA 2J33A 1EX7A 2R6R1 2FPLA 3H16A 3H1TA 4MGHA 5A7FA 4PCAA 2A33A 2CVHA 2I7CA 5T4BA 4DUZB 4YCBA 1SK9A 2GBPA 2ZVDA 4YCCA 2HHLA 3MBIA 3O1IC 4K8OA 2VOEA 2O2GA 3PYMA 4O4JA 1Y3IA 3OOEA 5DYNA 4RL6A 1NJ2A 3RUCA 3I2JA 1RYFA 3T5CA 3UNXA 1XLUA 3HBLA 1GPAA 2H3HA 2QPOA 1NDUA 4EQ6B 3N8DA 2TMKA 4UAJA 2Q4BA 3UT5B 2G1KA 4JLBA 3WL4A 5AI6A 4KE6A 1FUYB 4GKBA 1WTAA 1M6VB 1QX4A 3QHPA 4ZHQF 1MVNA 1CJTC 2I7XA 4HVCA 4D7AA 2D5BA 1YK0A 4P2BA 4BC1A 3TUZC 5B7PA 3KTDA 1EWTA 1IJBA 5AH0A 4RZIA 1Q74A 2XVAA 3BXGA 6REQB 1R4AA 2RJOA 3KZMA 1ZUHA 2PS1A 4Y1RB 3CZ4A 2B69A 3I4CA 2GPSA 1QP8A 3MAGA 4NEGA 1SR8A 3KSUA 3EUFA 5KVSA 2OV3A 4O4IA 3QSYA 4BFWA 3O0DA 4E4RA 4PC1A 2WU0A 4S2UA 4D82A 3PI6A 3WGTA 4XWGA 1C3LA 4V24A 2NWQA 2WINI 1NBMA 3O95A 2QMYA 4LOLA 4UJ3A 2I54A 3DT9A 3U48A 1UXGA 2AA3A 3UT5A 5KPDA 3RS3A 4ELXA 2Z08A 4I36A 2O0KA 1Q0HA 4G8DA 1JEDA 3N70A 4P54A 4QX6A 1OFTA 1PL0A 5EZ5A 1E4OA 2I7DA 2NV2B 5IBCA 3PTLA 2VTBB 1MEOA 2PO5A 3GA7A 4QYIA 3TQQA 3K1AA 5KOJA 2I2CA 1MHTA 1DIBA 2FTKE 4QICA 6REQA 2QR5A 4FU0A 3B6KA 4RHFA 3IVGA 3TOXA 1IWOA 4J1NA 1E4VA 1CUXA 1XD2B 2C5LA 2V7VA 3NFRA 2QU8A 5G1OA 2R6AA 1G21B 4UNRA 4S1WA 2RARA 2X5OA 3D3WB 2F4VB 1Z25A 2O5RA 1ZGZA 2C7RA 1QHSA 1WTCA 2DU8A 2WFLA 2IUSA 3I6QA 3MIIA 3PVCA 5AW2A 1L5RA 1MAWA 2BDEA 2JNWA 2X9LA 3B8HA 4MQ5A 4CMHA 2J3HA 2JPDA 4C1BA 4GMKA 1XZFA 3DWIA 1UWKA 1B16A 1JB1A 1Z68A 3FWNA 4CGYA 1RMYA 1Z45A 4BRWA 5MDHA 4JYAB 5C4GB 5ELXA 5C53B 4RPGA 2CJWB 3PX2A 4MRMA 3NHMA 4GUDA 4OFWA 13PKA 2BDTA 2JLQA 1N3YA 2CK3A 3M6AA 4BATA 4YT2A 1PLJA 1ATZA 4AIIA 1MOSA 5KTMA 3VVMA 1RKBA 5DBIA 4P83A 4DM4A 3NHYA 3NWEA 1LNQA 4GSYA 4N3BA 5BT8A 1JMKC 2WUWE 1OXVA 1DINA 2ORYA 4LG1A 3WWYA 5JATA 1PE0A 2YHUA 1L4LA 2UZ1B 3ND7A 4I14A 1WP4A 2JATA 3MEQA 5JS8A 5TMEA 2IHJA 4TXMA 1QG6A 2NXNA 1QH9A 1X2EA 4OGKA 5DHTA 4WA7A 4KR7A 1KJJA 4C20A 1QWSA 4K2NA 3C24A 4MR7A 1MPTA 5JZMA 2Z9CA 3QMPA 2AMFA 4F3KA 1J90A 1DQYA 3M4JA 1C3VA 1G4UR 1SU8A 2ZI5A 1XRQA 2CUKA 4OFXA 4R1MA 1VLQA 4BQFA 5KUTA 1I4OA 4PZEA 1X1BA 4NOMA 1WNFA 2D5CA 3AB3A 1I13A 3O1HB 3PFNA 2I4IA 4K81B 5DBOA 5DBGA 4EHJA 1L2TA 3LLCA 3AILA 1F0PA 1LLUA 1JHAA 2NSJA 3GFBA 2YC2C 3EGEA 3KJGA 5CLFA 3B2QA 4WA8A 2PBPA 4IWXA 3UK6A 1YBMA 1FQKA 2VZLA 3P0JA 4G36A 2B3DA 1KFBB 1QCYA 3C8UA 4RUKA 5KJFA 2XXBA 3SFVA 2X76A 2V74B 5L3SA 1BZYA 5IT9A 4WFIA 3EHEA 4NENB 3ONWA 2VKTA 3LHSA 2VPZA 1I51A 3TQTA 2ZIZA 2BEVB 1CQXA 4IL5A 3EXEB 5ALTA 5JT1A 1X6VA 2DWPA 5DI3B 2OO7A 1XDSA 3DQPA 4EMBA 5JXWA 2R751 2OXTA 4BEWA 1OFIA 5KPJA 2Z3VA 2XA2A 2O54A 3RF7A 4KKVA 4DMMA 3ICCA 2PX3A 2Q1YA 4CBVA 3ITNA 2HCJB 1KI3A 3PWZA 4KIWA 4ND1A 4BECA 2XYQA 4RK4A 5K8IA 2CFCA 2MSWA 4ZVOA 4D9JA 3ZWQA 3PUVA 2RGNA 1AG9A 1J25A 2XVZA 4U63A 4G0PA 3MS7A 1KEWA 2QRZA 4JXZA 4COKA 4O29A 4E5KA 2ZIXB 3BUSA 3U4GA 5KYTA 1JEYA 1UFRA 5HM8A 3SU8A 4L4SA 1VKZA 2L69A 2C2GA 3ANNA 3T3HA 4D8TA 1Y6GA 4QTXA 3DYVA 1B1AA 1UPTA 2QGFA 2WIFA 2Z56A 4R2KA 4UOQA 4AUKA 1O58A 1OF1A 4C4PA 2POCA 1SIWA 1JI0A 2X5KO 1K4MA 4URHA 1KZ9A 1Q51A 4I4ZA 1KO8A 2JH9A 4Q4HA 4TVSA 4A27A 2BP7A 1FP1D 1B3BA 2QM7A 3PC7A 1ODKA 2P41A 2XGSA 3C5HA 4NBRA 3WNZA 4B40A 1USGA 3A27A 3MT8A 3NAGA 4H3KB 1JG3A 1R2QA 3NKFA 3PPYA 4PIVA 3LQFA 1ZONA 5E1DA 3VISA 3ZJYA 1G16A 1VMDA 1YS9A 3C3BA 2IITA 2JAOA 3QZUA 2G5GX 2HTFA 2W2KB 2JGMA 1FVOA 3BMCB 2Y92A 3QJGA 4IIJB 3REQA 1XCLA 4YLGA 3DEJA 3OOHA 4ZT4A 4AO6A 4F86A 5JJBA 2W6JA 1V2GA 3H17A 3PG5A 4MV8A 1B74A 1JSCA 1NLFA 3ES9A 4GVXA 4UD6A 3W04A 4E4TA 5CG2A 3EG9B 1JT2A 3RUEA 4A0QA 4Z7NB 5KC9A 5AKYA 4JV5B 3INYA 1X14A 4Q9JA 3OCWA 1Z2DA 3PNKA 5D87A 4RGQA 4BJ6A 1ZN2A 5KNCA 1W7AA 4H7KA 1L4UA 1Y8CA 4QXAA 2H11A 3W9BA 2C9YA 3NC0C 1DX9A 5LCXA 3HY4A 1F14A 3VR6H 1BVHA 4V0NA 4WBNA 3HB4X 1AY0A 3MPOA 1PWYE 1ZD4A 2H7CA 2V0NA 2XRZA 2WIAA 1UJMA 5IHPA 3P9NA 1T1IA 4DLYA 4F6CA 1F9AA 3MWFA 4NOJA 1CRQA 2C2MA 1H2HA 1VQ1A 2A57A 1YD7A 5CCXA 2R4QA 3WL3A 4MCAA 3VNVA 3OLWA 1JDJA 1F8UA 3ZVRA 4BCBA 1SHTX 2YVKA 4IDOA 1NM5C 4H3HB 4GX2A 4IQ8A 1Z36A 2AUNA 4NAHA 3TM4A 4DV7B 3MJEA 1ADGA 5DGXA 3EQ7A 1EE9A 5B6PA 2EQAA 1IHUA 1RXCA 2OAP1 2HWWA 1E9RA 3RYHA 1OX4A 3T8YA 3BXFA 2B4QA 2P6UA 3E9YA 3A1TA 4FCTA 1TQHA 4RTSA 1NW7A 4G4JA 1QZZA 3OF2A 1A50B 3QE3A 3RSFA 3P0IA 4URUR 1B3RA 4X7BA 1D8AA 1MJHA 3O03A 2D4AA 4UUPA 1LJLA 2WQ6A 2PNFA 5FA8A 3N07A 3W4KA 1ISSA 1OI4A 4X1IA 1NASA 1BCRA 4UMVA 1E0KA 1XUOA 4MUEA 4BDTA 1KYXA 3BA1A 4RHXA 1W47A 4XX0B 2X0DA 1XZAA 3AL2A 3LC1O 2PK3A 3WIVA 2R1UA 1USUA 3ORQA 5D85A 1P0FA 4DUGA 1KI8A 2EKLA 2J4FA 3ECCA 5ALNA 4WFKA 4G26A 1NMQA 3NC4A 4LYFA 3IUBA 3KSMA 4TV9A 1VLVA 3MOIA 3TOZA 1K8QA 4B3JA 2AFRA 3T1QA 2C9MA 4RADA 3U3DA 5LQRA 3PBKA 4OQEA 4WNAB 1H3EA 2C82A 3JPWA 4NS4A 1Z5NA 3FNBA 4F92B 4ZT2A 1T34A 3GT7A 2ID9A 4RKEA 3CKKA 1S8NA 4BU0A 4OF4A 3MC1A 3Q6IA 1P6UA 4IMIB 3OPNA 2EX1A 3UMCA 4J3NA 3WADA 2ZSUA 3T5MA 1MB4A 2P77A 1QS0B 3GVCA 1SM4A 3BGWA 4YHHB 2CDNA 4TL6A 2APJA 1L9KA 1Q1EA 1ONOA 2Q28A 3MB8A 3EOZA 3IDSA 1XJQA 3SIWA 5EJIA 2ZUFA 1U0HC 3BIWA 1Y42X 3DKVA 2I3ZA 4K1LA 5LD2C 2FKNA 1O03A 3FX2A 4B79A 3ED5A 5BWNA 2MIIA 4XQEA 2EWMA 3JTEA 3ZV7A 4DN6A 2AW3A 2RI6A 3TRRA 4Z0TA 1BHO1 4IIGA 5IUJC 2GSWA 2P9TA 1SUSA 2NTEA 2I2AA 4M3NA 1GGMA 2FZLA 1FPQA 2QTHA 2WLTA 4WCFA 4CG0A 4HK4A 4WESB 1Z3CA 1Q0LA 3BGOS 4PGMA 4KR2A 1KH2A 3LQRA 3NJ8A 3MSCA 4MAFA 1FW8A 1LJ8A 3LO8A 1KJNA 2BJVA 1SCNE 4OIFA 3KXPA 2ZBVA 1ZMXA 3IAM6 2L18A 2YC4C 3FPSA 3I9NA 3K9GA 2H2GA 3KTFA 3U7RA 3Q88A 4YMVA 4YPFA 5FLXA 4YLYA 4G37A 1AJEA 4MUAA 5COQA 2Z5VA 4IRUB 2VNIA 2G76A 3OO0A 4OEHA 1T6ZA 3AKYA 3W6UA 1SHJA 1SUFA 1GCOA 1DOAA 3GFGA 1FS5A 3WGMA 2BKXA 3O4FA 4W6QA 1SY7A 1DHRA 4ZIRA 1OCEA 2OFXA 4Y18A 2W6JD 4MUMA 4BP9A 3ADBA 4MLZA 5KOIA 1WEHA 1TW2A 4R6WA 3PHCA 3C3WA 3T4EA 2IY7A 1EFPB 1YQWA 4ZQHA 2R2GA 2F48A 4YC7A 2TMGA 3DAFA 2W2LA 4N0PA 2ZWOA 2YFKA 4A5OA 3F6EX 1Z29A 2WTXA 1O9BA 3CUVA 3E9NA 3L7LA 1CR6A 2HT6A 1HEYA 2Q9CA 4H4CA 4JH0A 2IYVA 1D6MA 3Q8LA 3FSRA 2D3WA 2EIXA 2EFYA 2GEJA 2YVUA 1ZLYA 5AIBA 1V11B 3CBQA 1PAUA 1PI3A 1I32A 1MOPA 2FUEA 1K7YA 1G9TA 3TLBA 4RIIA 2IP4A 4BVHA 2OHIA 4LUCA 2BF7A 4RTMA 3NVKI 2O8CB 1QG4A 3QWIA 1HDRA 3FZYA 4JDPA 5FBZA 4K6HA 1Q7EA 3CN9A 1HBJA 1LLFA 1RJEA 1XVAA 3QPCA 4HT3B 1GR1A 4XIYA 3WAKA 3ZVMA 2CHQA 4BGEA 2IL1A 4QLAA 5E38A 5KU7A 4A2PA 5KQMA 1U7PA 4EZBA 4QPNA 1XVUA 4ZKEA 3JQAA 3Q2OA 1XCOA 5JNRA 1FDSA 2PUEA 3T7RA 4UZFA 1JIVA 4RA6A 1IJKA 3UV3A 5ITWA 5IVIA 1BHSA 5FWXB 2XZLA 4KDCA 3GNTA 1PDVA 1URPA 4B3SB 2PGAA 2POQX 5ITZA 5CUQA 2VHJA 5HXAA 1VCMA 3PGLA 2HHJA 4Q39A 3SC4A 1DKRA 4CUZA 3KXIA 3EIWA 4WPGA 1NW4A 4AT1A 3BGSA 1IZZA 1SCUB 2J3EA 1SHKA 3W7AA 3BL8A 3RKSA 4RE5A 1JI3A 3AIIA 4NBLA 2IELA 4RQBA 221PA 4MRMB 2Y1XA 3NI2A 2H63A 1XQ9A 1FTSA 4IJ5A 5F3RA 3PNBA 1OH7A 4LF7B 2PS0A 3IPXA 2GDZA 3TAHA 4K40A 2Q7DA 1N34B 4LCJA 3LC0A 4AJOA 3NZEA 3JQAB 3ETLA 4AZWA 2L2QA 2GYYA 3OQVA 2EBWA 1XMJA 4X8HA 3U5ZB 1M74A 2WVJA 1SUAA 4X71A 3G2LA 4MRPA 3A3PA 3PI7A 3U80A 1GPWB 5AUQA 4YRPA 4RORA 4BNKA 4GKAA 1NHWA 3ESXA 4U2GA 3EDCA 4MWCA 4LHZA 3IXQA 1G20A 3N59A 5CLIA 1RBYA 3O75A 5DNCA 3ZYCA 1MHPA 4UD2A 1M72A 1YK1A 4FJWD 4ENUA 4HWSA 1Z33A 1D6SA 2OHHA 4XVQA 1ZR4A 3ROZA 3WAJA 2H31A 3NIFB 4B4OA 1QTIA 2G36A 4GRIA 5BWMA 3DBOB 2O7QA 5AJZA 3JAKA 4V03A 3WB1A 3FHTA 1E6MA 3ZIAA 4ZCRA 3G79A 3ILVA 4KQEA 4KIGA 3T1VA 1RU3A 1EX6A 1EVZA 2ZJZA 3JQBC 1NX9A 5FFFA 5IYZA 2BFCA 1Y8AA 2R1VA 4JKYA 3AX6A 3L0SA 1G1AA 2BHTA 4MTLA 3RS9A 4V1CA 1RJ9A 1A4RA 1XQVA 2QRLA 1KVQA 4G07A 4KR0A 4BLQA 4X1KB 3TBKA 1T5DX 2HQRA 3OJCA 4LMRA 4TSKA 1RKQA 1JDVA 3R9IA 2HQBA 3JYHA 4A0RA 2XCOA 3GAMA 2IXDA 2X86A 2JRLA 1IJEA 4NBNA 3CX3A 3EXEA 3SLRA 3FPCA 1FRQA 3DUWA 4Y0AA 1TEZA 3DTNA 1JIIA 5EMLA 3WRYC 4TUYB 3R23A 4YALA 1ST3A 2BLNA 4I4CA 4R83A 1ZKMA 1NW6A 1W5AA 3C7KA 4G89A 4NMLA 4Q3DA 4TMVA 4DA7A 1ESNA 1ZC4A 1VGQA 3VOTA 4YT8A 4LDNA 2GB4A 2FQYA 4L2IA 3CX6A 3H1GA 4GLFA 1U2GA 2QTAA 4LRXA 4CQMD 4XOIA 3H2GA 1P7ZA 4FFNA 4NXMB 2PVSA 4IS2A 3MCZA 2PGNA 1O6CA 3GK3A 3W79A 5BXYA 3A9UA 3H84A 3OH8A 3RLIA 1P5FA 3TOVA 1PGPA 3H5LA 4RVGA 5H16A 1IN5A 3GT0A 4A8TA 1K8YB 4O4JF 3HYCA 4ZVRA 2GARA 3BRWA 4KE9A 4EATA 3AVWA 3VR5A 1NLMA 4JJ8A 4RVCA 1II0A 2H7XA 2WWTA 3ZCPA 1O0SA 4BFVA 3UT0A 1YMUA 2NVUB 5CT4A 1ORHA 2AD1A 2IYLD 2P30A 3K70D 2C9DA 2Z57A 3DE3X 4DKXA 2CXHA 2H9AA 3FMIA 2AL7A 1NA5A 2X3UA 3BQNB 5A6SB 3QWAA 1KETA 3ZCTA 9ATCA 1NU8A 5HR5A 3OQNA 1X7ZA 1L4KA 1YBFA 4EKYA 3OIGA 5AI9A 5AJWA 1R5OA 5HWSA 1E4YA 5KEIA 1GTVA 5ARBA 3Q5DA 3LXXA 4HNQA 2VUSA 4C7KA 3R9XB 2ID4A 5DIZA 4JI6B 4CM8A 1NAHA 1V45E 1IDOA 4ALLA 3SD7A 1RKXA 3B1WA 5ADHA 3AFMA 3PNOA 8ABPA 2ZJFA 2IYRA 3JR7A 3QG5A 4MOWA 3WJ2A 4RFVA 4Q9IA 5JO9A 4PSKA 4E5MA 2VH5R 1FXSA 1YH3A 1KVUA 3ROEA 1YKSA 2DBQA 2OLEA 3P9CA 1YXMA 3KCNA 4FDVA 4TWZA 5AKEA 3RT9A 2FXIA 3ZE0B 5BNTA 4M9UA 3DV0B 3O1LA 5IUNC 1JXAA 1CY4A 5T8KA 1Y5MA 2A5LA 3DC2A 1O96A 2HV9A 4PV7A 2ZUBA 2C7QA 2FHPA 4LVNA 5B5SA 3R3HA 2DERA 1U9ZA 2I7VA 2AJ8A 4R2WA 2AJDA 5JDCC 1PLLA 5AYVA 4OQFA 4EKNB 3KELA 4MGKR 3DFKA 1H9BA 1IG3A 3K8YA 4IOLA 1OBOA 4BVJA 4V0OA 4F5EA 4CV0A 3EK2A 1XZBA 5GVSA 1EHYA 1WLYA 4J0DA 4XDHA 2WZDA 1OGJA 4H6PA 1RVDA 1N8TA 2KJQA 2WFMA 4W5JA 5G1NA 5GP1A 3TX6A 4JB8A 4OUKX 3A36A 4MR8A 1ZZGA 4QUJA 5H59A 3V32A 5C8XA 4RY0A 3TTYA 1YDWA 2Q3HA 3BE8A 2YCBA 3UXMA 1IK6A 4IZCA 1DPGA 2ODNA 5A05A 5KWEA 1PKEA 2VTVA 1MMFB 3J80A 3IHTA 3PVZA 3P0FA 1R0CA 3Q12A 2NVWA 4ZO6A 2PL5A 3FIJA 3D6MA 1MDBA 1NNUA 2ZS8A 1T9HA 2G1UA 5HIIA 4IDCA 3V4SA 2SKEA 1OH5A 4MLPA 1Z15A 4L5CA 1F4PA 1I9CA 3S1AA 1GLVA 1GIAA 1L3IA 4WNIA 2AH5A 4NS1A 1A5BB 1JQAA 7ADHA 1DTWB 2GXSA 2VWHA 2XNHA 2B6NA 2OVFA 3PCTA 1ZOPA 5EKDA 4MQBA 3DAHA 1BCRB 4ML3A 1LB1B 4FGUA 3WMRA 1E7QA 3EWAA 3QITA 3ITKA 4CM5A 4URYR 3SHFA 3RCBA 3SJBA 1BX3A 5AW3A 1TIBA 3E48A 3H13A 3SM9A 3TIGA 4S1PA 4C3VA 2OSBA 4WOJA 2GJ4A 3D3KA 4JYCA 1AF7A 2N1BA 1AHNA 2GSDA 3PTZA 4G0NA 3EVCA 1NJSA 1XTZA 1HM5A 2XF2A 2PRIA 4IOJA 2W4MA 3NEPX 1TT7A 5FOSA 4K0KB 2NU6A 1L1FA 3CS3A 4QOHA 5FTWA 2TMYA 1GILA 3GDOA 3MSXA 3N6RA 4YRGA 1N9GA 2MT9A 3QOYA 4I6GA 3SLKA 4F6RB 4BNLA 3R0IA 4XGIA 3USCS 4ZZ3A 1CUZA 1KFEB 1ZK4A 1BJTA 1G17A 4WKCA 1HZDA 4ZU1X 2QQ0A 3GVXA 2X5JO 3LO5A 3VR3D 2BFEB 2GBLA 4L85A 3E1KA 4LC1A 1UMCA 1N7IA 2W48A 4TSRA 5DVZA 3WWDA 3H3XA 4F91B 3LC7O 3NR2A 2V58A 3BD7A 1ZJJA 4WXPA 4HZUB 4L08A 1B42A 1D07A 2IYFA 3IMGA 3N1UA 2K2QB 3CJTA 3CEMA 1TVMA 4C87A 3R76A 1MAAA 1QF7A 5HZGA 2D2FA 1YJBA 2K87A 3AHGA 1AQ6A 2FR1A 2ONYA 2YZ7A 2BCJQ 1A9OA 1N1DA 2OO5C 3BVPA 3F6YA 1EF9A 4GR9A 2QLFA 4HFJA 2NSLA 4BKUA 2JJ2D 2BT4A 2YQZA 1RBMA 1MFPA 3TSCA 1Y82A 1UBSB 3MWEA 5C8YF 3VJMA 3GGGA 2RGDA 4RMHA 2JCXA 4KOAA 2F9FA 2IIVA 2A1TR 4YMSA 2PKCA 4WCFB 4YAOA 4YN3A 2FF5A 1PJSA 2CLMB 1LI5A 1P73A 2XWJI 3FPJA 3N8KA 4HYTA 5AJHA 5ETJA 3TRDA 2EZ8A 2QMQA 5BQ3A 5FL7A 3FVQA 3KUDA 4IXMA 4G9BA 4ENSA 2B4YA 4EVSA 1MQAA 5SV2A 2NU7A 4BLWA 1KL7A 1FTNA 1Q1ZA 2BFPA 2V4ZA 4JVLA 4PGFA 1KDTA 1Z3IX 4WKPA 1SG6A 2NZWA 5D3MB 5TPZD 3F4LA 3WLFA 1X39A 2BMWA 4J8PA 5IWAB 1WW2A 3DBRB 4G63A 1DTSA 1A72A 4O4HA 2YOGA 2CLDX 2QAGA 5HIMA 2ZRMA 1Z5PA 3AONB 2OM2A 1VPWA 3OLCX 4YCJA 5DP2A 1L4MA 4YJ3F 2GBIA 5K1ZA 3O94A 2D1FA 1E1YA 4IGIA 3S7TA 1QB7A 5DCYA 5EINA 1CQIA 3O0TA 4ZDJA 1PYDA 6AT1A 2YJZA 3WNCA 1N5LA 2R8XA 4UNNA 5HRCA 1XZHA 2AE1A 3DLBA 2RIPA 1TPZA 4TKUA 2FMTA 1B26A 1C1YA 2Q2VA 5E4TA 2M6LA 1R10A 2FUG6 3KWLA 1LV7A 4OP2A 3KR9A 3RYIA 5LPNA 1JVNA 2Q5EA 3OCVA 3BHNA 3ONNA 4JHXA 4ZYVA 1USVA 1SGWA 1XRMA 2R6DA 1O0BA 4UREA 4G0ZA 1WXWA 4DLAA 3AHFA 3JWJA 3ML1A 3HDJA 1MJGM 1OAOC 4WZBB 6YASA 1RJDA 1I3MA 1IAVA 2O8CA 2Z8ZA 4ZREA 4B6JA 4ZCTA 2C77A 2QTTA 1QVZA 3K0EA 4J43A 2Y1FA 2ADFA 2J3IA 4KFCA 1MA0A 1PNTA 1V4BA 2VT2A 3MJ4A 4PIMA 1LC3A 1A8IA 1Z16A 1CSEE 2AJBA 2GN8A 4M9SA 5BQXA 2CXUA 4TMKA 4JJFA 3LOUA 4MVJD 1U6KA 2ICAA 5BNWA 4Z3DA 4QOSA 1EX1A 2V7XA 5DOVA 2AW5A 3P2YA 3LW8A 1XJCA 3LL7A 3B5JA 4CMAA 5EIXA 3AB7A 4G1EB 1GVNB 1K0FA 1PJLA 2QQGA 3V6MA 4DUPA 5KTNA 4AAYA 3GIDA 4HNSA 5DTMA 5F5NA 2GYUA 4D9EA 5C1DA 3DT6A 2QXUA 4YGXB 1WMAA 1FFXB 4XH9B 1D2CA 4E0BA 1BGWA 4WY2A 2ACVA 3IV9A 5LZ2A 1HFEL 5JEDA 1E8DA 4GP9A 1J8VA 4C43A 4FSXA 3WLAA 1J56A 1U2EA 4O1HA 3X1DA 4N41A 4KQCA 2HKIA 2WSSA 1A88A 3EVTA 1PZFA 2O05A 2ZKIA 4MITA 1M76A 4LI3X 4R2XA 4WLVA 5KKAA 1JR2A 3F9CA 4C4YA 1USWA 4PAMA 2NADA 3QBTA 1H93A 3WA6A 5LSAA 5FTLA 1KMHA 2EGUA 3JWGA 5DK4A 3S8YA 5G2OA 1IEWA 2WKPA 3H1EA 3D3JA 1HFJA 2IYEA 1YE3A 1ZJ4A 1G0OA 1I7NA 4DR1B 1SD2A 2AZ4A 3IL2A 5ER6A 2XVMA 5F1OA 4YCMA 3THYB 3VC7A 3WLPA 3GLHB 1L0BA 5G0TA 3ZOZA 4N3AA 4Y9RA 1KEVA 4ZHQB 4LBYA 3RTCA 1KK0A 4C6HA 4EA6A 5KO2A 2QZJA 5HCNA 1FMJA 1VYTA 2Y1EA 2SICE 2WPNA 1P8AA 3JQ8B 4MDYA 3R24A 2QMHA 4OLQA 1E4EB 3TI9A 1UKEA 3N3AC 4FFLA 4PLHA 1AKMA 2J67A 3PGJA 3FTDA 2QRVA 3UJCA 1IZ0A 3CWQA 2QMEA 1OT3A 4EHHA 3GJ8A 4A5SA 3VNUA 2GDJA 4M4SA 3HGMA 5G53C 2V3CC 3MT0A 4FNMA 3RGWS 4AXXA 3FCXA 4MA4A 2HGZA 1Y3DE 2PZMA 2HZBA 1L5HB 4MYRA 2SCUA 4W9MC 1PL6A 3W5JA 5AXAA 3P9PA 5I7UA 1AKNA 4PYJA 4CG3A 2HEIA 4Y7DA 3OTGA 5KX5B 4GLBA 1TAUA 4FBGA 3AKEA 3K0HA 5AK0A 1E1KA 4AJEA 1HYQA 1QO9A 5DYGA 2H4HA 2B8WA 2DLDA 2UUPA 1YV9A 4U7GA 2JBAA 2O2JA 3F7MA 5EJ2A 4I2VA 4GXQA 3TW0A 4DR3B 4RIGA 4LZZA 4U5QA 4V1CI 1H0RA 1O95D 1L8AA 4C4TA 4FHEA 4GVLA 4CCYA 4DHEA 2W6IA 1DGQA 1QF6A 2AKYA 4D42A 3FM9A 1SG9A 2E9SA 3LH5A 1GZHB 2F55A 2YYYA 2ZAMA 1JRLA 3K0KA 4J76A 2X14A 1FEZA 4N9WA 3T1YB 4KQKA 3VYTB 1L6IA 1MO6A 1MAHA 4DV5B 3D8UA 3PEYA 3DZJA 1TVKA 3ETGA 3ISTA 3VR0A 1GY8A 3F5MA 4GKVA 2VQ6A 1EK6A 1E63A 2ZE6A 4JLVA 2IE8A 4KV9A 4LMAA 5EXDA 5FPTA 4DJEC 3HABA 5A3RA 5G0UA 4CQLA 4EUKA 1FU8A 2RB5A 3FVTA 3CH6A 3G2MA 2RDMA 3HB7A 1EFUA 1YU6A 3KXKA 3QLUA 3VPCA 2GUGA 4PBSA 4C76A 5A5FA 1XHLA 3NUQA 3FNFA 1G1MA 1HT2E 5AHKA 3KYBA 1ZOLA 1UM9B 1CIPA 4BIMA 1X7YB 3NIWA 4C14A 3C3KA 5HKBA 1G8SA 3STTA 3I9KA 4BY9E 3UHFA 2RONA 4CEJA 1FPMA 1EXVA 3EFEA 3UM9A 5EE5B 3RIGA 4D6YA 4E14A 5K0JA 2I03A 1AMUA 4IYRA 1EF8A 4WN9B 3U61B 2VTKA 4XQCA 3BRWD 1H2EA 3HNOA 5MHTA 5HFJA 3R5TA 3PR3A 3WOVA 5BUQA 5IAKA 1V4NA 2IH4A 1BDMA 3ZHYA 3KSDO 4FEAA 1GHTA 1QORA 2WRZA 4CQLB 2FQXA 3N39C 1L4YA 3B3GA 3C6QA 3KB8A 3IMKA 3R6WA 4G4SO 2W71A