3A4LA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
250
structure length
236
Chain Sequence
DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 99
structure length 236
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4lA01
2BCGY 4WXRA 4ZV4A 1DAEA 5FOSA 5FH9A 1IQPA 1CRQA 3B7GA 1JEDA 3D31A 3K8YA 1IY2A 1P61B 2GJAA 3ONWA 1NLFA 1W36D 2IX3A 1LF5A 1E1QD 1NKSA 2DWPA 3CRW1 1MO6A 2O0JA 2ZVQX 4HAXA 5TV2A 1YJ5A 4ZI2A 5UKDA 3RS4A 4DCTA 4ZCIA 3RRYA 1VPLA 1KJYA 1YVDA 4CZ2A 1EFHA 2IYYA 2AR7A 2H17A 2V1XA 1N5JA 3L43A 4TSFA 3F8TA 1W4AA 2OFXA 1Y3AA 4P4SB 2D4HA 2J7PA 3G0HA 1XPRA 4OQXA 3I8XA 1GIAA 4DHEA 2REOA 4HSEA 4B2LA 1Z0KA 1A2BA 1Z6YA 2IYRA 2J5XA 1S2MA 1F2TA 2GAAA 1R0WA 3AVXA 3SFZA 1VYVA 1G17A 1KNQA 1OFUX 3DOFA 1AQYA 2V6IA 2X2FA 1YKSA 2DPXA 2WWWA 3KTAB 1W46A 5LPNA 1GDDA 3BB3A 2EYUA 4M1WA 4POAA 4Z8YA 5DN6A 3PENA 1TEXA 3B9QA 3X1YA 4ZKEA 4DLVA 5C1BA 3IIMA 4DT1B 3NBYC 1KDOA 4MITA 3C8UA 1W2GA 5KSOA 3P26A 4I1OA 4DRZA 4ITRC 2AX4A 2WWYA 4YMSA 1GRNA 4DEYA 3AKCA 4KLNA 1R10A 4DJTA 4PR0A 4BZXA 3BS4A 4FMDB 1QHYA 1R5OA 1VMAA 2ZSFA 5EP2A 1S9HA 3MWLA 2J0UB 2WAYA 5DGXA 2YOGA 1UDXA 2ZJYA 3GLHB 1NBME 3QPWA 5EP4A 3C5HA 2BDTA 5CK5A 4BFTA 4PC2A 4BFWA 3SQXA 4I1SA 1XD2B 4TQAA 4B3DA 1G20E 1CR0A 3SZRA 4Q4AB 4MGZR 2GCOB 2UZIR 1NBMA 2IBMA 1G6OA 2RGCA 3N5CA 3QIAA 1Z6XA 2XJ9A 1G41A 4IDHA 3ADDA 2J59A 2YWGA 4F4JA 1E98A 2DR3A 1R0XA 3AM1A 5FPSA 4F7WA 1M8PA 1NJFA 1NVWQ 2QE7D 3PXGA 4US2R 2BHRA 4HAUA 2QMEA 4BRUA 1EFCA 3A6PC 2ZXUA 5DIFA 2JLYA 5DE3A 2F55A 3Q7PA 4Y0AA 1U2RA 1TF2A 5DYIA 1N5KA 1ZMXA 5JRZA 3FB4A 1Q12A 1YZGA 4EPVA 2V55B 1E2IA 1Z0IA 3ZYCA 1E9SA 4HB3A 2QP3A 4JL5A 5JWHA 1PLJA 3QXHA 4Q9HA 4UNRA 2HXSA 2NO6A 2XXAA 3GFOA 4D4LA 1YR8A 1XBTA 5DI3B 2HF9A 2FFQA 1VHLA 5IT5A 2OFWA 1SHZA 4Z1MA 3NDPA 1LV7A 4GL2A 3DZ8A 1E99A 1D9XA 3W34A 4AYWA 1ZU5A 4BUJA 2RGAA 4Q66C 3OE7D 3ICEA 2QA5A 1NN0A 4R9UC 5EXTA 1JECA 1IY0A 2IYSA 4GOXA 4MUBA 3QKUA 1W0JA 2E1RA 4NYIR 3U7HB 1E9CA 1VG8A 1IXRC 3IDQA 3QXSA 1F48A 4N1AA 4UXIA 2FSFA 5JBQA 1MABB 1BYUA 3QBTA 1ZIPA 5LBIA 1LNZA 5EXPA 2EFDB 1KMHA 4U02A 1XFAA 1VDZA 4DEXA 3LFUA 2OBLA 3MG9A 1AM4D 3UMSA 2QL6A 2A5FA 4RCZA 3GEEA 4AURA 5CYOA 2I4IA 3KFXA 4RFVA 3O8DA 4Q7LA 2XZOA 2OFOA 1XU4A 3NEYA 3TJZA 5L3QA 3KQHA 3CR8A 6Q21A 2WIBA 1U99A 3MGCA 4IKEA 3VMFA 1G3RA 4B2IA 1NMZA 3CIOA 5EE5B 3OIUA 1W5SA 5FTMA 3BGWA 1E9AA 5GVSA 3NIBA 1G6HA 2DCUA 3HR7A 1KZ7B 3D8BA 2RGEA 1E96A 1W1WA 1OH7A 4HATA 3VFDA 4FCTA 1JJ7A 2TMKA 3BJIC 3CF6R 2V54A 2XITA 3LAWA 4J0QA 4O2RA 1QHHA 1FTSA 2OSBA 3REGA 4OK3A 1SULA 3B9PA 2QM7A 1GWNA 4PHFA 5F3WB 1HTWA 4DDWA 2C9CA 2QY9A 4JBXA 2Q6TA 1E94E 2ZRDA 2ZROA 3IPXA 1UJ2A 1RRCA 2ASEA 1KAOA 2F9LA 5IF9A 4EFLA 2J41A 2Z6VA 1KAGA 5J47A 1RJ9A 4JLKA 3SS8A 3Q72A 3ZZTA 1E2DA 3TMKA 1R5NA 5FUYA 3C14C 3E2IA 3CRVA 3KQUA 1DAMA 5JJLA 4MYTA 4OHVA 1NRJB 1U94A 4CGZA 4B73A 3L8ZA 3THYB 4ZIRA 2F1HA 1QG4A 4OI2A 3EPJA 1G8GA 4BLRA 2JJ8A 3RC3A 2VPPA 1TUIA 5G41A 4WAUA 1FNNA 2YNMA 3LBIA 2QMUA 1CR2A 3PEUA 2WWXA 3WYFA 2D06A 1JPJA 2J46A 3AP3A 3G82C 4UKDA 2OBMA 4CRWB 1NSTA 1FP6A 2VO1A 1HE8B 2ZI3A 4HUQA 1II0A 1K5GA 1A7JA 1P9NA 1HYQA 4IEEA 1SHKA 4CEHA 1OKKD 2G0TA 4GT1A 1FUKA 1UEJA 4B3CA 2QTVB 1HUQA 1KI3A 2AFHE 1ZNWA 4HDOB 4KVAA 1UFQA 4ZO4A 1XCGB 3V00A 1YZLA 3IUYA 2ANBA 2ZRCA 4GMDA 1ZJ6A 3L0SA 4PZYA 2V1UA 5E3HA 3TK1A 3X1WA 1VG0B 1TAGA 2OESA 3VR4A 3FOZA 1II8B 2NGRA 4L8GA 3PEVA 2IYQA 2GBLC 4M1SA 1FP7A 4UQOA 3PG5A 1WP9A 4FCWA 4C0QC 1E0SA 1ZM7A 3ADKA 4DC9A 1JB1A 1KDTA 2JGNA 4AKHA 2ZUBA 1VCOA 4PFSA 1N6HA 3HU1A 1IN7A 1G8HA 1KGDA 3DKPA 1YR7A 2WWHA 4GZLA 4IJMA 4LY6A 4UNNA 5G40A 4UJ3A 3HR8A 2ZRKA 3U7FB 5TDHA 2W6JD 4H9GA 3QEJA 2WKPA 2QU8A 2IXEA 1UKVY 3MJRA 4MRVA 1MR3F 3TKLA 1H8HA 3IO3A 3SBEA 1R2QA 4G5GA 1Q3HA 1DTSA 2YVUA 4GZMA 4V03A 3UKDA 1OB2A 1Q57A 2JJ1D 2AXNA 4NE2A 3EIHA 1DAFA 2FSHA 5KYKA 3I4LA 1E79D 4TTPA 3LLUA 3A4MA 4C2UA 3T1QA 2FDCA 2VHTA 1M7BA 4KSCA 4AKGA 3LW8A 1U0HC 2ECKA 1KO4A 1UADA 4CEIA 1Q21A 2FZLA 3AF1A 4B33A 1OV4A 2ZTSA 2UVQA 2WSSD 2IXGA 1TQ4A 2G1KA 2WJIA 3GQBA 3JVVA 5A4JA 4A15A 2QZ4A 2N1BA 1KYIA 2VP4A 2OXCA 4TQ9A 2IUUA 3RS3A 3A37A 4Q1FA 3VR2A 4YMVA 2FFHA 2XJ4A 5IRCD 2ZRNA 4L4UA 4YMUA 5EP3A 3X1XA 4QGFA 3WYAA 3MWYW 1R4AA 3ZZ0A 3SYLA 2YWHA 2F9MA 3DZDA 4U00A 3RHFA 1FOEB 1IN6A 2YWEA 1XRJA 3DHWC 4RD6A 5D3MA 3AVVA 2FA9A 1ZVQA 4PZZA 2O8DA 4BFUA 3CRMA 1N0WA 2J3EA 2BIFA 3DDCA 3RWOA 4P31A 3MMPA 4C3ZA 3TQCA 1OLOA 3EZ6A 4C30A 1E2FA 2QNRA 3OESA 3LWNA 1UBGA 3BBPA 2CL0X 3T15A 1MO4A 2ZANA 2QMHA 3NG1A 3CNLA 3O47A 3HDTA 2NO0A 4HAVA 2VF7A 4JZKA 3AVPA 3SR0A 4OKSA 3W3ZB 2J0QA 3U7EB 4XSHA 4JJZA 1DADA 2QI9C 1HT2E 1JXOA 1E69A 1P60A 4IDOA 2OILA 2IC5A 4ASUA 2GJ8A 2UKDA 2JLVA 1SKYE 2GNOA 3HYTA 2EU8A 5EUMA 1DAHA 3UG7A 1RRPA 3BAFA 4D6PA 3AVOA 4URZR 4Q9IA 2NMVA 1L4UA 2J9RA 4JKIA 4O25A 4BLPA 1RW4A 1ELOA 2RGXA 1KJZA 1K8RA 4LHZA 1I2DA 4Q7KA 2DHRA 1N6NA 3QKSA 1D6JA 3CNNA 3WNDA 3MRSA 4JIMA 4XD7D 4NCJA 4YLGA 2C78A 1Q1EA 4ZCLA 1G7TA 1FTNA 1XTSA 3EPKA 4RFSA 1FQJA 4IEIA 3WXMA 4XWOA 1ZD8A 1JXMA 5L3SA 4GDFA 4KSBA 3QSYA 2D3WA 4Q4LA 1BOFA 1CJMA 1P2SA 3U4QB 4KBFA 1RC8A 5CIWA 2YINC 4BZQA 2VSOA 2AL7A 1E2QA 1TF5A 2NO9A 3Q3JB 2ZJZA 4LSGA 5H68A 1ZD9A 4AC9A 2GF0A 3LXRA 2ZJ8A 3NKVA 1E2NA 1GTVA 1OKKA 1UPTA 1NMYA 2J87A 3CRRA 4HAYA 4PPNA 4QJ4A 3F5FA 4LUCA 2YOHA 1IM2A 1KI6A 3CBQA 3HU3A 2G83A 2QP9X 4FINA 4GPTA 4LOAA 4D80A 1I4DD 3GFPA 2ZJAA 2XOKD 1S3GA 2QAGA 1W5TA 3OFNA 4EPYA 4LPKA 1M74A 2A5GA 4A8JA 2H92A 3V4RA 4KCGA 5AWFC 2GESA 4BFYA 4DDVA 3AF3A 2CHQA 4HLQB 1Z63A 1L7VC 3W8NA 1YHNA 4BFXA 2CJWA 5KSPA 4TSFD 3JVUA 4NYJQ 1BH2A 4LJ6A 4MDEA 3AH8A 2J7PD 5P21A 2FU5C 1GG2A 5AJVB 4YDHB 4M1MA 2IYWA 2Z4RA 1GILA 1AJEA 1E3MA 3KB2A 4BPBA 1ZINA 3ZLJA 4CT5A 1RKBA 3QG1A 3KKNA 3THXB 4GNKA 4H1UA 4GP6A 1TNDA 2IF0A 3VNUA 2W6JA 1J8YF 4TZ0A 2ZYWX 1NLZA 4B44A 4XVUA 1XX6A 1NY5A 2OZEA 2ZYVX 3NHAA 3P1JA 4DSOA 4DB4A 4IVQA 1HQYE 1M1YE 2Z0MA 2JJ1A 3LQRA 3FGNA 1BKDR 1HQCA 1WQ1R 2O8FB 4I99A 1C9KA 4NPHA 4IOLA 2GCPA 2GZDA 2IYVA 3QF7A 2YZ2A 1E2LA 1F5NA 2QQEA 3LNCA 2ZS7A 3LX8A 5IDVA 3SFVA 2Z4SA 3SN6A 4EDHA 5CIQA 1E4YA 2ZRFA 2WV9A 4Q02A 4I81A 3BIFA 3GLGE 5JWRA 2EQBA 1E32A 2FMXA 3NVAA 4M9XA 1AS0A 2WSSA 1WA5A 3O8BA 4KO8A 1CF4A 5KDDA 3HYRA 4PO8A 5BW8A 1QHXA 2VP2A 4OQFA 1ZCAA 4B3BA 2JLUA 2O8BB 1DARA 5FTKA 5KPJA 1TQ2A 1KNXA 1CXZA 4KYUA 2B21A 2W2VA 2AK2A 5M04A 3GJ7A 1VG1A 3CLVA 3CF2A 2BEKA 2R6DA 2ZRBA 3GLFE 1TADA 1Z6GA 4OQNA 4CIDA 3SJAA 2YC2C 2ZYTX 3LV8A 1G19A 2JATA 2IS2A 4FMCB 1WF3A 5KNBA 3GLIE 4JSTA 2JLZA 4IHQA 1S3SA 2A78A 1EWQA 3I62A 1JAHA 1XMIA 2BWJA 4PAOA 3TW8B 4D81A 4Q1AA 2CHVA 5AJWA 2CL6X 5BYKA 1RE0A 1N6PA 3QVUA 2A9KA 4JBWA 5L3RA 4JLNA 3CKLA 1P2UA 4AK9A 3GLIA 2C03A 2FFBA 2OV2A 2PT7A 4Q4HA 4NU0A 3WP1B 2YC4C 3QKTA 3GJ8A 2VIIA 1W48A 3RS2A 3Q7QA 3PV0A 3P4YA 2BBOA 2QUZA 4NCHA 2XXAB 3SHFA 2L0XA 5ANRB 5CDFE 2VF8A 2OBNA 1E9EA 5EZ5A 5F9HA 1IHUA 2YV5A 4D4MA 1W36C 3AF2A 2ZJ2A 2EFCB 4M1KA 2ERYA 2ZVPX 1RYHA 4IXNA 4DWJA 4JLPA 4W5WA 2R8RA 4DLTA 4V0KA 4URVR 3TUZC 1P62B 1OH6A 4GMXA 2G0NA 4P33A 1EG7A 5CDFA 2VQSA 3FKQA 1GM5A 4X8HA 2HJVA 2ORVA 3IEVA 2G77B 2ZI9A 3B2EA 4LC1A 3UWKA 3OZXA 1JR6A 521PA 4ARZB 1AS2A 4XD7A 1F6BA 1YZKA 4DSNA 1XXHE 1SGWA 1W0JD 2GETA 3GJ5A 1KMHB 2B8TA 4TYYA 3AKYA 1N6KA 2D74A 3VKWA 3W6OA 2PCLA 4M9SA 3U3OA 2JLWA 4CW7A 1CLUA 3K0FB 4G3XA 3QPVA 3CPHA 1XXHA 4A0RA 1WBBA 1T9HA 1G5TA 4LC0A 4OBEA 1UAAA 2OUKA 1SVLA 3AVWA 5FBQB 2BCJQ 5L3QB 4RZ3A 3K09A 1ZYUA 2Q9CA 4IDQA 4DSTA 3AGQA 3TIFA 4MYHA 1Z22A 4OQMA 2PJZA 1W36B 1XTQA 2PMKA 5GVRA 1W49A 2JLXA 4DLUA 3FHOA 3PVSA 2XSZD 3AUYA 4MH0R 2C9YA 1DG1G 1ZM4A 3A1UA 3RDPA 4AI6A 2XOKA 1T3SA 3KDSE 2GXQA 3T1OA 1X3SA 1LF0A 3P32A 4PSKA 3BD9A 3T35A 1D2NA 3SHWA 3T06B 4YXWD 2R6CA 4OHZA 4D26A 1LW7A 4QGGA 3EIQA 3LA6A 1CJTC 3KXKA 3GJ6A 3W6NA 2K5UA 4JLJA 4KVGA 3ZS9A 2W2XA 1M7HA 5EJEA 3SU8A 2FJUA 3BXZA 3IO5A 2R65A 1JNYA 3K9GA 1AS3A 2QENA 1RJ9B 5JSZA 1XD9A 2EYQA 3EXAA 2ODBA 1FZQA 3HWSA 2FFAA 4O2LA 1VTKA 1OW3B 2A5YB 2J1LA 4JSYA 1GL9B 3TAHA 4G5OA 2PX0A 3B85A 1DELA 2FV8A 2BJWA 4BE7B 2EWVA 1XJ0A 1KI8A 1US8A 5L8VA 2ZS9A 1KK1A 1Y63A 4JLVA 2RGGA 1Z28A 4D25A 5FTNA 3ICQB 4PAMA 1G8FA 2QT0A 2GJKA 3AF4A 1DO2A 4KJZA 5EE1A 3A8TA 2F3RA 3R9IA 3C7KA 3KFVA 3LLMA 4XWKA 2Q3HA 2JIZA 3QOFA 2V6JA 1XD8A 4CEHB 4DDUA 3NC1C 1VHTA 1YZQA 3CM0A 4ESVA 4JVNA 4TYQA 4DIEA 2H16A 1YE8A 5EP1A 1AA9A 1OXSC 3KQKA 2O8EA 3KL4A 2REXB 1WRBA 1KSFX 3D6TB 2ZE6A 4XTRA 4OI1A 4X8LA 4DVGA 3EIEA 3Q5DA 4BQSA 2A5JA 2QQ0A 1NVVR 1J99A 4A0HA 4URYR 1ODFA 1PZNA 1RFLA 1KO5A 1KSJA 1U90A 3PJRA 2IYTA 4BECA 2ODWA 5EZ6B 3BE4A 2Q3MA 3F0TA 3VX3A 4ACBA 1K6MA 2WKQA 4EFMA 1EFRA 2MSDB 1VYUA 2HT6A 2CL7X 2C9OA 1EESA 3MD0A 4I1UA 2XB2A 1G7SA 3VU9B 2QM8A 1D8TA 1GUAA 5LB4A 1W0KD 2W00A 2ZUCA 3ADCA 1DS6A 1QRAA 4WXPA 1DAGA 1N6OA 1KO7A 4C0AC 3BK7A 3DMDA 2VP0A 3E70C 2ZIAA 3T5DA 5KNCA 1HV8A 4PC6A 4HB0A 4URWR 2EW1A 3R9WA 5FL3A 2B8WA 1D2EA 1CR4A 1FW6A 4C4PA 1M6NA 4Q21A 2AHOA 1OFTA 2CLCX 4ZDJA 621PA 1OIVA 1XNJA 4JT2A 2ZE7A 2ZJBA 3R9XA 3SYNA 3CX8A 4JL6A 1H8HD 2CK3D 1FQKA 2OAQ1 3Q85A 1AN0A 3K70B 1C4OA 4US0R 2IT1A 3NWJA 4MGIR 2WWGA 1H8ED 4GSYA 5KOYA 3K0CA 2R6FA 3UPUA 3ZD6A 4PC3A 2ZR0A 2R9VA 1W4CA 1KI2A 4URXR 4CEIB 2GA8A 1P9RA 5KPDA 5JS8A 1P2TA 4G5SA 1NG1A 4RSGA 4TL7A 3K70D 3MFYA 3KKQA 3NXSA 4DLXA 2O0KA 3ZD7A 4S2EA 3QXJA 2YOFA 2ZI7A 4PPFA 2OCYC 4UJ5A 3EG5A 2CNWA 4Z51A 4A6XA 4F93B 1NIPA 4RD1A 1ZIOA 3A4LA 3TSZA 1G291 4EUNA 1KMQA 3N70A 1N3BA 2P2LA 3P4XA 5FPTA 4YDSA 4OHWA 2EVWX 1T8TA 3AP2A 3L2OB 4JL8A 3RS5A 3LO5A 5D3MB 4LX0A 4Q9KA 5F9FA 1RZ3A 1KK2A 1GSIA 4LHYA 2O8DB 3WHKA 4MYCA 2IS6A 3SNHA 2F1JA 2WOOA 1UKZA 2X1VA 3N2IA 1GRQA 3B1XA 2CVFA 4LYJA 4DLSA 1AK2A 5AJYA 3IEUA 4DIDA 2RGNA 1TU4A 2XSZA 3QEOA 4NCKA 5DHFA 1NKTA 1A1VA 2A5DA 1G3UA 1XPUA 1SXJD 2DFNA 5TMPA 5DH9A 2QSYA 4ZPXA 3FDIA 1P3JA 4HLUA 2GK7A 3PITA 4YXWA 1IJFA 4S35A 1J70A 4V0ME 1G8PA 2HLDA 4EKDA 5C2JB 4RD4A 3EX7C 1W47A 1XJCA 5FPHA 3TRFA 3I72A 4B2PA 3KJHA 5AUQA 4ASUD 3U60B 2FNAA 1N6IA 3I73A 1QZXA 4PANA 1N0VC 3SJCA 4DCVA 4I1VA 1G3MA 2OCAA 2QAGC 2J0SA 1CRPA 4KFTA 3FHTA 5FUVA 4V0MA 4A8JC 1NL3A 1GNPA 1TQ6A 1ZBDA 3HJNA 5E7IA 3OAAD 4QGAA 3CX6A 4KYIB 2OHFA 2IHBA 3QKSB 5D3QA 5HR5A 3WHLA 2RAPA 3AVQA 2JLRA 3A1TA 3RANA 1X8JA 4LHVA 3T5GA 3TSWA 3EA0A 2ZRHA 2MSCB 3H2YA 4RFSB 4DBLC 3PUXA 4CVNA 4LBZA 121PA 4JS0A 4QGHA 4XTCS 5L3SB 2V7QA 3B1WA 4B76A 4OHXA 3N2EA 4F4CA 1IOZA 2DYKA 4NYIQ 5FUXA 3R8FA 3CR7A 1OSNA 3NDBB 4P4SA 2Q9AA 4RD0A 2QBYA 1ZD1A 3TLXA 3FMOB 3CO5A 4UXJA 4HLDA 4P3YA 1TTTA 4EPRA 3AEZA 2WTUA 1AQUA 2VH5R 4C0BA 1XEWY 2N46A 4JKYA 2AWNA 2FEMA 4TYNA 2BBSA 4EFNA 1AZTA 2QAJA 2D2FA 4M2LA 1Z2AA 5TARA 2RGBA 1F2UA 3WP0A 2GVZC 3QG5A 3VTKA 1KI6B 3TNFA 2ZR9A 3LX5A 3QE0A 4HYYA 2RHMA 4C0SA 2QAGB 2WHXA 2C2HA 4KLZA 4A8JB 3R7WB 3V4FA 2F1IA 4GOKA 1G16A 4C7OA 4GP7A 2R2AA 1WMSA 3FVQA 2BC9A 4DLZA 1MV5A 3QF4A 4TYPA 5JHGB 3OFND 2BV3A 4M4SA 2CJWB 2MMGA 3MWJA 4HZIA 4N3NA 1U8ZA 5DHAA 3WMFA 3ZQJA 1ZUNB 1I4TD 4RVCA 5CYPA 4Q7JB 3DOEA 2HT1A 3EPLA 1W0KA 4PQRA 721PA 4UNQA 1E0JA 4JBYA 3DPUA 1SVWA 4Q48A 5KDOA 2XEXA 5JLJA 5JJKA 3B6EA 1Z0FA 3BB1A 2FSGA 3B82A 3LXXA 4JYBA 4LBWA 5FPYA 1MO3A 3FPAA 1XPOA 4M1YA 2Z43A 3U5ZB 3B78A 1R0YA 4JLBA 1JQJC 1KDRA 2CK3A 1FL9A 1ETUA 1NMXA 4FMDF 5JI3E 3U3JA 4KV9A 4LI0A 1ESNA 1H8EA 1ANKA 4IDPA 5H1YA 2PT5A 2GWHA 3T12A 1LB1B 2VP5A 3KXLA 1FFHA 5BYJA 1G9XA 1KI1A 2PX3A 5BWMA 3EA5A 2OXRA 1SVKA 3ECCA 5K8LA 2ZM5A 4EQ6A 3DVLA 3OEHD 4B3XA 4RZXA 2WBLC 4F92B 1OJLA 2X8AA 3LBNA 2QTFA 4E09A 2GTPA 3IQWA 4Q03A 4G5RA 1XB2A 1ZNYA 3B1VA 4WW0A 4M53A 2B6HA 1JQLB 3W90A 3DM9B 1LVGA 1UBCA 2VTKA 1TL7C 5BXQC 1XCPA 2HUPA 2WSMA 1XEFA 4NCIA 5DI3A 3WBKA 4ZI3A 4R71A 3K0EA 3MAAC 2WM9B 1SXJE 4LYFA 5H70A 3PEWA 2FGJA 4FWIB 3TUIC 3PUWA 2PCJA 4TTRA 3RRNA 2ATXA 4L9WA 1LS1A 2IYUA 2J45A 4TLEA 4B3GA 5HCIA 4PC7A 2HF8A 3A1SA 4IVPA 3O8RA 1QHGA 3GLIB 2W0SA 2ODEA 5J5CA 4AYXA 1SXJA 4Q4HB 3CWZA 4D4JA 3OEED 1E9FA 2PLRA 2WKRA 5FL7A 2FG5A 3TE6A 3SI7A 2R44A 2J0VA 2WWIA 2OCPA 1KZGB 2RH5A 4ZDIA 2IXFA 2VP6A 2NG1A 2ORIA 4V0NA 1KKMA 1DVRA 3MUFA 1PV4A 4LPSA 4B32A 1DPFA 5HKKD 4E03A 3I5XA 1UBFA 2GKSA 1AGPA 2ZSAA 3EWAA 1J2JA 2QPAA 3TAUA 1E0AA 3OIYA 1XCMA 4Q9LA 3JZAA 4AD8A 3PUZA 4WIAA 2BMDA 3BH7A 2G88A 4ACAA 2EFEB 4CDGA 1XZPA 3OAAA 3REFA 2OLJA 2X19A 3I8SA 5J4YA 4QBHA 4JVMA 1AIPA 1MRNA 4C9BA 1LS6A 3WMGA 2ZRLA 3EZ9A 3S1AA 1OH8A 1N6RA 2D62A 3FMFA 3NEJA 2C98A 2NZ8A 1E0KA 1S1MA 3CH4B 5JCPA 5DSZA 1T91A 3I32A 3C4JA 3QQ5A 2BMFA 4HEJA 2AD1A 3P20A 3QKRA 3PUVA 1W44A 2KBFA 5DNYB 1XXHB 2RMKA 4P32A 1U0JA 3FKSD 4Q47A 4QXAA 1SKQA 3ASYA 1QG2A 1X8LA 2CHGA 4HZUA 4OQLA 3GMTA 1DBSA 4KFSA 2KSQA 2QN6A 1E9BA 1E1RD 2P5SA 3SQWA 5E95A 1RYFA 1XMJA 2Y8EA 3K53A 4TTQA 4KI0A 3AP1A 1EXMA 1GNRA 2OG2A 2ZS8A 2WVJA 2I1QA 4BWYA 5HCNA 1X6VA 4K8OA 1HA3A 3IHLA 1P73A 3RLFA 2W83A 2QTHA 4DUGD 1OB5A 1Z06A 4LHXA 4WZAE 4JMPA 2P5TB 4HB4A 5FR1A 3TH5A 3AVTA 1A5TA 4GFDA 5K8TA 1OHHD 2JCSA 3GEIA 3I1FA 1KSGA 4LJ7A 2KE5A 2BVNA 2PBRA 3OIWA 2IEYA 2PH1A 3ZGXA 4DCSA 4RKEA 5CB8A 2JAQA 1EX6A 2G1JA 4DLYA 2NIPA 1WBDA 5JJIA 2BJVA 1R0ZA 4XJXA 3AF0A 4ZKDA 4NYMQ 5AUNB 1OXUA 4V0LA 3H84A 2V8OA 3CPJB 3EW9A 1EGAA 1F2TB 1F3OA 1FMJA 4TMVA 4XVRA 3VKHA 1VYTA 1HURA 2I3BA 4QJ5A 4E5UA 2GEUA 2QPOA 5JSZB 1X1RA 2IYXA 5A5GA 4AKIA 2JLQA 1U98A 3WNCA 2X77A 2XB4A 3RAPR 1UDWA 3BORA 1PLLA 2C8VA 2JASA 3FFAA 3RSOA 1U9IA 4Q1EA 1I2MA 1BIFA 5TY0A 3DMNA 4QL3A 1LFDB 4LCBA 1XEXA 3UMRA 3ASZA 2QPTA 1US8B 1X1SA 3EC1A 2BM1A 3M4YA 2Z5FA 2B7CA 2V3CC 3KQLA 2P0EA 2W58A 3ZIAD 3PCRB 3VX4A 1Z08A 5FUWA 4BFZA 1X8KA 3RS0A 4QNRA 3K0AA 4XSGA 421PA 4M1TA 5FOXA 5TB5A 2CCGA 4PX9A 4QHYA 1CIPA 1FX0A 2ZE5A 3KXIA 3LW7A 1ZCBA 1ZNXA 2ZJ5A 2DWOA 3OEHA 4B74A 4HB2A 5J4LA 2RKOA 4K81B 4AIIA 1CBUA 1OE0A 2JIZD 3X1DA 4C0LA 4LJ5A 2DBYA 3AGPA 4MRSA 3RABA 4GOJA 3ZVMA 3K0CC 4TMKA 3TVTA 3ZVNA 1G3IA 2FEOA 5B58C 2Q9BA 1ZAKA 3KKOA 4NL4H 4TL8A 5CK4A 4RJLA 2FSIA 3GLGA 4B35A 1COWD 2PZFA 1JJVA 4R2HA 2VEDA 4PPGA 3EASA 4E22A 2RCNA 1JI0A 1ONBA 2GXUA 5SZJA 1P75A 5HE8A 1Q20A 5JEDA 4C0JA 3RNLA 2WIAA 4TL6A 1Z29A 2G3YA 1FNMA 2RGDA 2ZI6A 3U7GA 1GNQA 2EFHB 1V43A 4N0EA 2ZRAA 4M9QA 1KO1A 3G5UA 3BB4A 4JLMA 4B3FX 3OF5A 3D7MA 1J90A 3NBFA 2PL3A 1PVOA 3ZVLA 2IS1A 5G3YA 2ZSDA 3KQNA 2OEPA 1EFRD 1NI3A 1Q22A 3KJEA 4LZZA 4PHGA 4E07A 4R7ZA 1CTQA 2UZ3A 3GLFA 3OEEA 2AKAB 2WAXA 3OIVA 1KO8A 4RKFA 1KY2A 2GZAA 3KZ1E 4M21A 1D5CA 4TYWA 1CJVC 3H0KA 5J4VA 3I92A 2BOVA 3KKMA 3TW4A 4LRWA 3FHCB 3QENA 1NNEA 2GILA 2KJQA 1G18A 2NZJA 4OYHA 3SBDA 5HKKA 5JMTA 1GITA 3BH6A 4HLCA 1NSFA 2IF2A 1J8MF 1IXZA 2FWRA 2IHYA 2PMDA 4U5XA 3ZJYA 1QHSA 4LBVA 2F3TA 1XEWX 2IA5A 2C04A 1T8UA 4MRNA 1AKYA 1TX4B 3W5IA 4RD2A 4HLUC 1VCMA 3W3AA 2B7BA 2ZITA 4BLOA 4LJ9A 4X8MA 1DO0A 1XTJA 1N25A 3ADBA 4TLCA 4W7SA 4PO9A 3T1VA 2JJ2D 3BC1A 4LGMA 2OM2A 1Q0UA 4GI7A 1GKIA 2LWIA 2ZRGA 1TPZA 3QI2A 1TU3A 1KI9A 4FD2A 1P6XA 4Q4JA 5KNDA 4IDNA 1UF9A 2CNWD 3FKSA 3U61B 3SE0A 4A0GA 5E7JA 1O87A 1HH4A 2CDNA 4WOPA 1E1RA 4WZBE 4JLAA 4OJKA 5TXGA 4CEJA 3IBGA 2IYZA 5IK2D 1YU9A 2QRNA 4HAWA 1XF9A 1S96A 3T34A 4L5BA 4W5JA 3GJ3A 1T0HB 4DUGA 1DOAA 3MLEA 1NN5A 5HZHA 1JR3E 1QDEA 2IWHA 2GHIA 5C46F 5HTKA 1OHHA 1HY3A 3A4NA 1ZU4A 4NMMA 3KUCA 2WJHA 4PPQA 4D4KA 1EFTA 1TEVA 3H86A 1GP2A 1GFIA 1ZC4A 1TF7A 4NHOA 1OH5A 1XZQA 5JS7A 3TGPA 3AVUA 2WJGA 1QHHB 5CJPA 2G6BA 4MRRA 4QJ3A 2WWFA 3I3SR 2R62A 2CE2X 1UEIA 1G64A 2CLDX 1ZUHA 2HLDD 2OO7A 3GD7A 1KK3A 3LDAA 4D0GA 2ZREA 3J81k 2X2EA 3ZVRA 1G4UR 1G1MA 3CF0A 4XOIA 3WYGA 4Q19A 4L16A 5KTYA 1FPMA 3THWA 1QHNA 3QXCA 4Q7MB 4AWXA 4DZZA 4EJSA 2W0MA 4C0KA 2AN9A 2VL7A 2QP4A 4PQFA 2WMOB 2DY1A 2B92A 2FH5B 2HCBA 3LQQA 4BEJA 4OJQA 4OI0A 3EZ7A 2FN4A 1BS1A 2ZU6A 5IHPA 2AXPA 2KI5A 3TR0A 1AZSC 1OXTA 4ZIRB 3LBHA 1C1YA 1JAIA 2QBYB 4XH9B 3IIKA 3ZIAA 3AKEA 4B48A 2QORA 3EWSA 4Q01A 2C5LA 2V7QD 2A30A 2CCJA 5G53C 2F43A 5LDDC 1E9DA 4NH0A 1P4SA 2YYZA 2PEYA 4TN1A 1BO6A 4TLDA 5CLQA 3NBXX 2ZPTX 3GFTA 1F2UB 3UG6A 5JEEA 4HUQB 4B75A 4A92A 1R8SA 5FOWA 3JZMA 1IONA 3C16C 4BGDA 3A58B 3THXA 4QRHA 3IIJA 1E9RA 4WZ6A 1XTIA 1V5WA 2VA8A 1CR1A 1COWA 1G5RA 4L15A 4YMTA 3K70C 4FWTA 4C7OB 2VYFA 2QGZA 5C4MA 1U81A 1RPZA 3QF4B 1ZC3A 1QHIA 2O8FA 2YHSA 3EZFA 3SJBA 4KFUA 4PC1A 1CULC 3H1TA 2C95A 2O8CA 3H4MA 1NLYA 2LKDA 1KI7A 3U44A 1HT1E 4FN5A 4M9ZA 3RWMB 4V02A 1ZP6A 4DXAA 1M7GA 3FFBA 1L8QA 2BBWA 3ZH9B 5AUOB 1OF1A 1RRFA 3CZPA 4Y0VA 2DFLA 4CYMA 3OHMA 4DLWA 4QBIA 2HDNB 4MKIA 1XP8A 2HV8A 4Z8XA 3R8CA 4C2TA 3RYTC 5BQ5A 2ONJA 1IN4A 1S0UA 4QC2A 2FE4A 5EE3A 1NIJA 5L3VA 2O8BA 2JDID 3PFIA 1G7CA 5K8IA 1LTQA 1I4LD 3UK6A 4V0OA 3Q5EA 1T3HA 2D2EA 3BFVA 2H7VA 1DE0A 4TLBA 4LYAA 3U3RA 1SXJC 1OYYA 3WNBA 4OI4A 2JA1A 3HPQA 3B60A 4EIWA 4WVFA 1P9WA 2F7SA 1KDPA 1HE1C 4MKFA 4NONA 4IFBA 5FFMA 2DFKB 4Q00A 4EQ6B 1PUJA 3VR5A 2CE7A 2JJ2A 1NP6A 1G5PA 1YQTA 4OK5A 3AV0B 4I4LA 3ZZUA 4P0TA 4YONB 4XVQA 2VBCA 5KUTA 4HI0E 1ZM9A 1VECA 4LHWA 4LK2A 1G8YA 2IUSA 4FMCF 4KAXA 2ZR7A 3WRYC 2WICA 2ZAMA 4KXFB 4DSUA 1CU1A 5HZKA 3BWDD 4B34A 2H8KA 2R6AA 1OIWA 1OPXA 3VAAA 1YRBA 1L4YA 1OFHA 1E2KA 2JEOA 5IK2A 4JT4A 4P4TA 5EE9A 4NKRA 1NVVQ 2ZYUX 3LD9A 3MWKA 4NDZA 5C4GB 1Q1BA 1TQDA 2PZEA 3AB3A 2P65A 3CW2A 4JLOA 4BLTA 1SXJB 2A3RA 2ZI4A 4IW3B 1E2MA 4ARZA 3D3QA 4TLAA 3C5CA 1IBRA 2BEJA 2H1LA 3A1WA 3ETLA 2ZJOA 2ZU0C 5FOUA 5JHHB 1R8QA 3DL0A 2XTMA 2NPIA 3BERA 4W5HA 1Z07A 2EWWA 4LDJA 5FL7D 2E9SA 4PHTA 2ZEJA 5TVKA 3MJHA 1CJKC 1T3LA 3WMEA 3QVVA 1ZRHA 1Z0AA 1KI4A 1T4GA 3K0FA 3KUDA 5LB2A 3ZDQA 3B1ZA 1SQ5A 3NC0C 3K9HA 4IOMA 5SZHB 2ZRIA 2ZQ5A 4MGYR 4LYHA 3IQXA 4XIGS 4ERNA 2CMKA 4N0DA 2SHKA 1YR6A 3IILA 4G01B 1YZNA 2WJJA 2F1RA 1XTRA 4B43A 1SKYB 4Q18A 1UBEA 4TL9A 1A82A 3VNVA 4G1UC 3S1AB 1FMLA 2E87A 1E1QA 3AUXA 3DO6A 3I61A 2XTZA 5GADl 1H65A 1BYIA 4UNSA 5CM8B 5E7MA 2VHUA 2BBTA 3RS7A 2FPKA 3T61A 1WCV1 3B5JA 3TUJC 1Z2CA 4DCNA 1A4RA 3LVQE 2WPDD 3QKRB 4YC7A 4UNPA 1MT0A 2Q0HA 1UKYA 2P6UA 4AY2A 5JECA 1YZTA 1U8YA 2FGKA 2FZ4A 3VR1A 2ZRJA 1OYWA 5EXXA 4AG6A 1U9IC 4A2WA 1K5DA 2NO1A 2BKUA 2QMOA 4HZUB 2YJTD 4KODA 4DB2A 1GVNB 4LV5B 1MKYA 3BOSA 5B64A 1OXXK 8OHMA 2VRWA 4ILEA 3ZQ6A 3TSOA 2LCFA 3THOA 3UANA 1WDTA 4CT4B 2XX3A 1XWIA 2AD5A 1IXSB 3P27A 4KHZA 1D2MA 3KTAA 4TWZA 4W9MC 4D2IA 1Z5ZA 4LWZA 1T5IA 3ND8A 2VSFA 5KSZA 2H57A 2DB3A 1XJQA 3CX7A 4NTZA 1F60A 1Z47A 1T0JB 1Q44A 2W6ID 4PAQA 4DT1A 4IVRA 5DLQC 5SZIA 2RB4A 4XWAA 5DISB 2QGNA 2HEIA 2ORWA 3GLHE 1DAKA 3AKDA 3WY9A 5B30A 3RRZA 4DCUA 4O3MA 1EFUA 4HDCA 5B2ZA 4IOJA 3IKJA 4A2QA 3K0SA 3KKPA 4TT3D 3RVBA 2P67A 5CLLA 2V9PA 2OE2A 3KJIA 5FOTA 4Q1CA 2GXAA 2J0UA 4PHHA 2IL1A 3R20A 5LD2C 3GLHA 1PLKA 1VIAA 3U6BA 3T1TA 2JDIA 4Q9JA 1XEXB 5GJVC 2IK8A 5ELXA 4QOSA 4Q1DA 1XD2A 1GAJA 4IFEA 4RD3A 1G21E 1II9A 4U7DA 2LKCA 1E2EA 1TUEA 1FUUA 1NVXQ 3HPRA 3NBZC 4Q4AA 2GCOA 4KITB 1MO5A 1QVAA 1U8AA 1Z3IX 3U3KA 4HAZA 1JALA 1XTKA 5JI2E 3K0AB 2QE7A 3PUYA 2FX3A 4B6EA 4AYTA 2YKGA 3NH9A 2PJRA 2MMCA 1M34E 3CPEA 1FX0B 3EARA 3K1JA 2GEVA 1M2OB 2A7QA 4FIDA 3VU9A 4YQFA 5E4FA 4BZPA 3IHWA 4GRAA 1Z0DA 3W9YA 2C77A 4IRUB 3UMFA 4EPTA 2QG6A 1S8FA 2KBEA 3FMIA 3CB4A 4NP6A 4PQYA 1TMKA 3KJGA 1ZM3A 4MKGA 4FI3C 4ZDKA 4JVLA 2HJGA 1E4VA 3A1VA 3GLGB 1IAQA 3VKGA 4MRPA 4DDTA 4LV6A 2YWFA 2AWOA 2GDJA 2XTNA 3WRXC 4K46A 4TMTA 5LD2B 3DEFA 1QF9A 4QG7A 1N5IA 4P4UA 1SZPA 4MQBA 4D0NA 4LJYA 3KX2A 3OE7A 4Q5IA 2RHDA 3CZQA 4MDFA 3HP1A 3FYHA 3L8YA 5DI9A 3GLFB 3SYKA 4US1R 1QVRA 5C18A 4H1VA 4JVSB 2JLSA 5EE0A 5H8WA 4PSAA 4HDQB 2BKEA 2BMEA 1Q3TA 2ODNA 2EFGA 4NZYA 5AR1A 2FPMA 3QJYA 4M1OA 3X2SA 2ERXA 4A0FA 3PEYA 2P3SA 5JCZA 4Z54A 1NG9A 2OAP1 3L0IB 1VG9B 3CRQA 1MABA 1G4AE 3K09C 3QUSA 3UATA 3PR1A 3AVYA 2O8EB 2CVHA 3SDZA 1R7RA 4A36A 1ESMA 2KB0A 1KJWA 5GJWC 2REBA 2ZETA 5HE9A 4AKEA 5J4KA 3DM5A 4BASA 1R5BA 4C0HA 3SC3A 2ANCA 2GRJA 4GBMA 2CEAA 2IEZA 2Q3FA 2QT1A 1YZUA 3FMPB 2QROA 4BFSA 1AKEA 4F38A 1P5ZB 1B0UA 1A2KC 2MSEB 2Q21A 4G5QA 1XMSA 4EPXA 5KHOC 4WA7A 2BMJA 4RY2A 1G3QA 2I1VB 4EAQA 2GVDC 1SVSA 4NBSA 4OK6A 2P6NA 3W5JA 3A36A 2HYIC 2W2TA 2O0HA 3E1SA 2P6RA 1RIFA 4NYMR 4FCVA 3GPLA 2PZGA 1JBKA 1Z0JA 2GF9A 2ZE8A 3M1IA 4TMZA 5AUPB 4NYJR 1U0LA 2OT3B 2WPDA 4QNMA 3Q9LA 4Q4JB 4JLDA 5KU1A 2HCJB 1BMFD 1X86B 1KOFA 4EJSC 4A6PA 1W7AA 4R2IA 3GJXC 3W8RA 5JZVA 4MUAA 3C41J 1CEEA 1S1CA 2GEDA 1Q1ZA 4CEJB 5A0FA 4WBSA 1WXQA 1P72A 1E2PA 2NPFA 1P2VA 1GKYA 1S9DA 3O8CA 1S4QA 221PA 3K9NA 3M6AA 3B13B 4PTLA 5JFGA 1D9ZA 5J40A 1PUIA 2FPLA 1YR9A 2XZPA 4BEBA 4B47A 3VR6A 5EXSA 2V4ZA 2GAOA 1IN8A 1N0UA 1QBKC 3BFKA 2D7DA 2OLKA 1B23P 2GCNA 2FOLA 2PEZA 5FOVA 3LRPA 4M0LA 3FWYA 3RRMA 4DKXA 3KB1A 1KY3A 1SVMA 4QHSA 4R98A 1NN1A 2W6IA 2GXSA 5BN4A 1AGRA 4QHTA 2DWQA 4A82A 5FBVB 3THYA 5BN5A 1N2CE 2IYLD 4D82A 4OL0A 4MKHA 4DLRA 4IOKA 1VIYA 4MYUA 4TT3A 1N6LA 4RZUA 1VCNA 3WBJA 1JR3D 1Z6AA 1OIXA 4G0NA 2GJSA 4OHYA 3I5YA 2ONKA 3GJ4A 3THWB 2O5VA 3CNOA 2XNDD 3K9LA 2FF7A 4EJSB 3QBVA 1MOZA 4FW9A 5HPYB 5J4HA 1CP2A 1OT3A 2C99A 4AG5A 3Q8XB 5KO2A 2HYDA 5KSYA 1GL7A 3GP8A 3MSXA 4CF7A 5FTJA 4ESHA 5CB6A 3R7WA 5FBWB 1Z8FA 1CJUC 2CCKA 5FR2A 3TQFA 3U2QA 1HEIA 4LBYA 1UM8A 2F43B 4URUR 3M0EA 3NTUA 3W6PA 3EZ2A 3QPUA 4LV8B 2KWIA 3CONA 5JWOA 1E2HA 4PSVA 2WOJA 1P7CA 3RC8A 3C15C 5KDLA 4B71A 4X8OA 1II8A 1SVIA 4TQUS 3EPHA 1KTVA 3ND9A 2IWRA 5FI0B 4PXAA 5F2EA 4UXHA 2VSXA 4II7A 2ZAOA 2IW3A 1W4RA 2QRZA 4ZDWA 1MH1A 3F3YA 2GK6A 1GKUB 4D0LB 1O3YA 4TMWA 3EC2A 1KIMA 2ZSBA 4M22A 3IPYA 2QSZA 2G9NA 4TZ6A 3BFXA 5DN6D 2N42A 5GJBA 1XDBA 4EPWA 5FI1B 3LH5A 3QNUA 3NHBA 3BH0A 4QM7A 1E79A 3CWQA 3U3MA 4A4DA 1WB9A 2O8CB 3FTQA 1IJEA 4PZLA 3V9PA 3U44B 4MGKR 3X1ZA 1NN3A 1KSHA 4LJ8A 5CM9C 5AJZA 3VR3A 1RRGA 1GL6A 1IY1A 1EK0A 2AFIE 1Z6TA 3SOPA 5BN3A 3HU2A 1W4BA 2XNSA 1DEKA 2CXXA 2IUTA 2ZRMA 2CBZA 2AK3A 1E2GA 3L0PA 3QXXA 3SEAA 1RVDA 1WE2A 1Q1QA 4JYCA 1E2JA 1CS4C 1R6BX 4F91B 2H5EA 4L9SA 5GJCA 2WJYA 2VHQA 1E6CA 4QKQA 4KBGA 4M8NE 2BM0A 5JRJA 1SVOA 4LJAA 2R6GA 4A9AA 5FTLA 3NH6A 1KHTA 3B8HA 2GBLA 3UXMA 3UWOA 4BLSA 2XZLA 2RGNC 4HUTA 1NBMD 3CH5A 3VQTA 1G7RA 4TMXA 2AKYA 1OXVA 4FXPA 5FBRB 3L82B 1UKEA 1GZSA 4NCNA 4A1FA 4LJ4A 2H18A 2PLFA 2NTYC 2ZUDA 3IGFA 4KFRA 5EQTA 5G3ZA 1PJRA 3B1YA 1JPNA 5FBLB 5FPKA 4RCYA 1OFIA 2WJVA 4BFVA 2ZRPA 3GJ0A 1NY6A 1ZM2A 2IS4A 1EX7A 1ZNZA 1NJGA 2NQ2C 1W2HA 2ATVA 4QBGB 4FMBB 3CUEF 5EUQB 2CLSA 3QY0A 3TBKA 4YMWA 1J7KA 1T5LA 2VHJA 4ON9A 3LY5A 2ZSEA 3VHXA 4B6FA 1BMFA 4A2PA 2OCBA 1ZUIA 1GOTA 2XAUA 2XGJA 4RZ2A 5CJ2A 5K8UA 3FE2A 1VKJA 2WZQA 1IN5A 1YRAA 1CKEA 4PO1A 5DO9A 1MRSA 2C96A 4O0MA 5AK0A 1DAIA 2NO7A 5F98A 4F4IA 2ZI5A 5B57C 2GZHA 4QM6A 821PA 3PQCA 1NVUQ 1DG3A 4Z1MD 1JEEA 4ABYA 4ZCMA 5CITA 4Q1BA 2QEQA 3MCAA 3RSLA 3PIRA 4BLQA 2A2ZA 3GCGA 3TVDA 2VP9A 3LVRE 3U6KA 1N5LA 3BRWD 3UIEA 2O52A 3E5HA 5DYGA 4MA4A 1EWRA 4JJKA 3AQ4A 2J7KA 1NF3A 2WMNB 4QBFA 1VCIA 1Z83A 5SZKB 2DFTA 1XMVA 1LY1A 3GEHA 3TR5A 3DKVA 2Z83A 1KK0A 1ZW6A 2D7CA 3ZS8A 1GRRA 2GJ9A 4IXMA 3U4QA 1JR3A 3EAQA 2NOAA 3SJZA 2HXYA 2VHCA 1L2TA 1T6NA 1KKLA 3IBYA 4KU4A 2F6RA 2XNDA 4BRWA 3VHLB 3L0OA 4QFMA 5AJXA 2VLIA
chains in the Genus database with same CATH superfamily
5DCWA 2D8MA 4WXRA 4CMKA 1DAEA 5JXJA 1ZXBA 1A4UA 2JEZA 1MB4A 1J56A 3TW0A 5CAEA 1EDOA 4E15A 2RHTA 1TA4A 4LYDA 1XDDA 4QNNA 5A7FA 4W1QA 3V8BA 1MO6A 5TV2A 3IALA 1YJ5A 4PV7A 4PSCA 4RPCA 4LFCB 4X85A 1NW7A 3E2PA 3RS4A 3RSZA 3TIXB 2RIRA 1AKTA 3CUYA 2P9YA 3CQ9A 3ZHQA 1WPQA 3HA2A 2H17A 4DQVA 4TSFA 3L43A 1ONPA 2W8BA 1HZZC 1W4AA 4CXMA 2EJTA 2J7PA 2MIIA 4B7AA 3UHJA 1XPRA 3CMMA 5GONA 4XB2A 2Q5OA 4Z4QA 4EY7A 4PICA 1P31A 4D3FA 2OZKA 1A2BA 1DUBA 1JR2A 1ZH8A 4I4TA 4RTOA 1FP4B 2GAAA 1F2TA 1FNDA 2XE8A 3QLTA 2QTLA 4FPXA 4MEAA 4RDIA 1CDOA 4O3FA 4PYOA 2VLBA 5B1DA 5L3ZA 4BNVA 5AKHA 5ESRA 3DOFA 3HE3A 3F1LA 3JZIA 4JGBA 4BQOA 3IKVA 1VPVA 2X2FA 1P2DA 1C5KA 3FM9A 3RM3A 3KTAB 5BSUA 2XBLA 3ORFA 1VL2A 4RVFA 3AF5A 5BMVF 3BB3A 2R2GA 3FCUB 3TX2A 4Z8YA 1SCIA 3MOSA 1G5QA 4GIBA 3B9QA 3X1YA 1F4LA 3UW3A 5K6AA 5FPPA 5F2NA 2LCQA 1XU7A 4L3OA 1N9KA 1LSOA 3NBYC 1KDOA 4C14A 3AHGA 5BSEA 2GJ4A 5CB4B 4MVJF 3NFRA 3PUJA 1SC9A 4ITRC 1V1MB 1BJRE 2RSLA 2JFXA 1GRNA 1N75A 4ZYYA 3QVMA 4KLNA 5CFOA 3CR3C 4BZXA 1QF6A 4LI3X 3NHWA 3EMKA 2GD2A 2GM4A 3V7FA 3WJ1A 5H83A 2X2OA 5KSWB 2VPZA 2W7TA 3F78A 4RQTA 5HUJA 5DGXA 1G6KA 1UDXA 2ZJYA 3GLHB 1IRXA 3PLRA 1QFZA 1UK7A 5EP4A 5AD1A 3COPA 5LOVA 3R5TA 2DM6A 1R9NA 2A5LA 3EVZA 5BWBA 3GQVA 1OFGA 2WSYB 2YQZA 3CLTC 4WERA 1SXQA 1U7XA 2BEWB 1T5SA 3KSZO 3NHRA 2YFYA 3UYKA 1G20E 1GQRA 5JXIA 5M2QA 1C30B 1F0YA 3CRZA 4KNYA 2AYZA 4MGZR 4FB5A 4MYSA 5ADHA 4FK8A 4WOCA 4Y6GB 3OP1A 2YWCA 2NUBA 2W2KA 3NHKA 4LWOA 2DJ5A 1MZPA 3U80A 3N5CA 1M8KA 5JBWA 1XRLA 3QIAA 5JADA 2QD2A 2UYYA 1MP0A 3FVTA 4WINA 1G20A 4IDHA 4F4JA 3C3JA 3MGBA 2DR3A 4YMGA 3LHFA 4UBMA 3H9BA 1NJFA 3NB0A 3TW8A 1FVOA 3EWIA 5JBXA 3E58A 2QMEA 1SIWA 5H81A 3SEFA 4GWKA 5KX5B 1EFCA 3IVXA 2ZXUA 2Q50A 3NMUF 5BVGA 2JLYA 3Q7PA 4N5DA 1U2RA 4B8YA 1N5KA 1ZMXA 1NXQA 2ATCA 5JH7B 1RXVA 1O4VA 4X94A 1Q12A 4JQSA 1SUFA 4YCBA 1YZGA 1ADGA 4P36A 4EPVA 3KYDA 2VQFB 1N36B 1Z0IA 1PRYA 3LJKA 5J2UA 2JI6A 2W8ZA 4HB3A 5KJ1A 3NRCA 4JL5A 5JWHA 3JAKA 1KBZA 1SD5A 2OOKA 5F21A 2HXSA 3SDBA 2BFEB 1L1RA 3GFOA 1V11B 1YRYE 1U9CA 3W5UA 3R24A 1AKVA 4MA0A 1W75A 2P77A 3WJ7A 2P62A 4AJPA 1SHZA 3ACDA 1XTBA 1CHDA 4YB8A 3DEAA 1DKMA 1QRSA 3RF6A 1IPFA 3USES 4PVCA 5E3IA 2XYVA 2GCEA 2JGDA 3LWBA 4X3OA 1WAMA 4FFNA 4I55B 1DINA 3CLHA 3ETCA 4NOLA 4R9UC 1IY0A 3OSZA 4O4LA 1FDSA 2AMJA 3EOAI 3QITA 1Q1AA 3K5WA 4UVIA 5F7ZA 1VG8A 3AETA 1M8JA 3ZCTA 2C7BA 2D5AA 3QXSA 5EWMB 1K0UA 1F48A 1QYDA 3PUIA 4N1AA 4UXIA 5JBQA 3ICWA 5KI6A 3HFJA 3P19A 4JJFA 2WD7B 5CTJA 3LY9A 5JDIA 1LNZA 1MC8A 2VAWA 1YB2A 4HBGA 2X1MA 5JFTA 4U02A 1AQNA 5C34B 1QLJA 3JARB 4CETA 1NQOA 1ATZA 3DBVO 3IPLA 3LFUA 1H5QA 4RCZA 4DGQA 2YH2A 3UICA 2CBGA 4AURA 3PNPA 1GXSB 4OYLA 4Q7LA 2QQ5A 4RFVA 3W7VA 4F0JA 5T4EA 1XU4A 4P7KA 1FDUA 5ENDA 2PUHA 4AN1A 5JXHA 4BMPB 2R1TA 3KVNA 5CDTA 3LUHA 3AL2A 4MMZB 3KQHA 2WIBA 1QYCA 3MGCA 3VMFA 3TFQA 1G3RA 2OKGA 5EZYF 5JCJD 1N8TA 1XRSB 3KEOA 1MAWA 1XFDA 1JDZA 3AKZA 4JYPA 1ZN8A 5EE5B 1N7GA 3FI0A 4I14A 3D54D 2ZM6B 1EP2B 1ZXXA 1FLNA 3A27A 1JDJA 2FMIA 1I01A 3I39X 2BGGA 3VZCA 2YXNA 2YHIB 2RGEA 3PDIB 1E96A 2F3QA 1T8YA 2O2XA 1D7AA 4XFKA 5DM60 4C4AA 2FYTA 3VFDA 3PZKA 4FCTA 1D1PA 3HK2A 2V54A 3WGZA 2I9PA 2GN9A 1QHHA 2X0RA 4DJAA 3F3SA 1WUKS 3LIPA 4LDAA 2AN1A 1Y8QB 2X5OA 3B9PA 2QM7A 1XAIA 1B1AA 2RK6A 1GWNA 1PNVA 2DOKA 3DLCA 3I5MA 3IQDB 3QMMA 4PHFA 4P4GA 2PLNA 5C8VA 5SYAA 2Q6TA 1D0VA 1S7GA 1L8OA 1DG9A 2ZRDA 1RRCA 1UJ2A 2XNCA 1M2JA 3WGIA 1ACJA 3UJHA 3STWA 3OKAA 5GPBA 2QRGA 3FLAA 3WFIA 2Y1DA 1JHUA 1C14A 4DYHA 3MT7A 1NI4A 1ZRSA 2Z6VA 3NNNA 3L8IA 2NW6A 3NJ4A 1H6DA 5J47A 4DIMA 2ZXFA 1E2DA 2Q7XA 3TMKA 4DW8A 4G0UA 4AUMA 5C8YF 2XVYA 5JAPA 3KQUA 4IMRA 4MYTA 3TRJA 3V3TA 4I50F 4N0QA 4OHVA 4KR0A 4CGZA 5AFSA 5JMOA 2JFPA 1C1DB 3L8ZA 4NR0A 5IVIA 2WUWE 1UBUS 2F1HA 4OI2A 3A3PA 1XF1A 2VDWA 4BB9A 3NUZA 4M54A 3C7AA 1OQAA 4RLQA 5G41A 1H2EA 4WACA 3LBIA 4R2JA 1JBQA 1JLKA 3C74A 4W82A 2Q5QA 1CB0A 1GUYA 4FSHA 4QASA 3G82C 1XMPA 4D0RA 4WKPA 3UK0A 1JEYA 3KZCA 1HE8B 4EFKA 3CY6A 3MOIA 3L7AA 3OHPA 2G5GX 2WVHA 3HVHA 1DQYA 3BUSA 2JHCA 4A8PA 4CTMA 1I0IA 1A7JA 1P9NA 1HYQA 3ZHZA 4IEEA 3F97A 1OKKD 2G0TA 1U1DA 1FUKA 2ZT7A 4DRYA 1QKKA 1E6UA 1HUQA 4FIZA 1ZNWA 3LP5A 1NBOA 4KVAA 4ARVA 4EG8A 1D1TA 1UFQA 4ZO4A 4F8YA 2PUFA 2A9JA 4Z7QB 4EF5A 1BCSB 3QV2A 1CV2A 1FU4A 5HKAA 3VVMA 4LQCA 5FBHA 1N9ZA 1YZLA 3IUYA 1RI5A 2DUNA 3ZK9A 5K6RA 3FPGA 4ZCRA 3ESRA 1ZJ6A 4PZYA 3TTSA 2V1UA 4NDAA 2RBKA 3X1WA 3DGFC 4YV1A 1XHLA 4P9NA 1U2EA 4FZJA 3D4IA 3WL6A 4BO1A 2NGRA 3ISJA 4IIGA 1OBFO 3IMGA 5REQB 1S2NA 4DE5A 4CMEC 1LLQA 3PEVA 2OG1A 4CG3A 4LE2A 2QZZA 3HO1A 3PC8C 2D0OB 3Q7RA 3U7RA 2MTBA 1ZK3A 3GFQA 1E0SA 3OQBA 5THKA 4C0QC 2POCA 1BN7A 1T2DA 2Q2VA 2XE6A 4WI1A 4R01A 5ECGC 1QYRA 2XB8A 4PFSA 4F5DA 1G8HA 1RRKA 2HO5A 2JJQA 4GZLA 4MS1B 3GLQA 4F6CA 4UJ3A 2AXEA 3H16A 3HR8A 3IHKA 2W6JD 3OWHA 2KM1A 3HA7A 2QU8A 2H4ZA 1SVUA 2IY8A 1PT9A 3OX3A 1MR3F 2A4MA 4HFJA 4RSMA 1DV1A 3OOEA 3AJRA 1R2QA 2OFFA 1A8IA 1Q3HA 3HP7A 2H1OA 1Q1NA 5FOQA 1GTSA 1T2UA 2H5JA 2EGHA 3ZW7A 3MT0A 3BDVA 1DAFA 2VWQA 2MSWA 2OL4A 4W5OA 5JRDS 1LW6E 2PS0A 4TTPA 3LLUA 4EF6A 4A5OA 2OCGA 4Z3OA 4N39A 2GPNA 3T1QA 3ZGVA 1JA9A 1ZONA 2H1VA 1W6UA 5B1HA 2HGZA 2IIVA 5TPZD 3ST7A 3LW8A 3R5KA 2Y1FA 1DPGA 1U2GC 3UH1A 3HMQA 1KO4A 3GT4A 1Y3FE 3OCWA 4TXJA 4E32A 3OURA 3QNWA 2AZMA 2XCSB 1Q21A 1D04A 2B4TO 1Q92A 3AF1A 4B33A 3JATA 2UVQA 2WSSD 3GQBA 1K3UB 5A4JA 4PG4A 1OAOA 4K2NA 1X1AA 2QZ4A 5ECYA 3H81A 1GQOA 2I65A 2N1BA 4UHFA 3U39A 5LNK6 1KYIA 4TQ9A 2X41A 4Q1FA 5BOSA 2E18A 1W5EA 3K4PA 1X70A 4QPPA 5E1OA 2XJ4A 1GFWA 1VJTA 1V45E 3U0BA 5EP3A 3QWAA 3L7DA 5CA0A 5BSHA 4I1RA 1R4AA 3H75A 2ISQA 3PC3A 3SYLA 2YWHA 2XWJI 5JZOA 3O4FA 1SPBS 1UBHS 4Z4CA 2Q6KA 4U00A 3RHFA 1FOEB 3DHWC 3TIVA 4H4EA 4HEA6 2Q6IA 4EBFA 5C1DA 1M2VA 4BFUA 7REQB 2UUCB 1N0WA 3DDCA 4FFRA 3Q0JA 4P31A 1JXZA 3MMPA 3D81A 2FR8A 2XW6A 4KXVA 1OLOA 1A3CA 4IV5A 4ZREA 4L8VA 3HCFA 3LWNA 2H63A 5KVQA 4J1TC 5TRTA 3ANTA 3T15A 1C0IA 3ZWDA 1MO4A 1YOVA 2YZ7A 2ZANA 3CNLA 1WXDA 3OZSA 2IEBA 3WZLA 3SKYA 4OKSA 2MINB 5EWJA 1EJBA 2J0QA 4HFRA 2H3HA 3A2KA 1HT2E 1YKFA 3LTEA 5CG1A 3ABRB 4OHKA 1RBZA 4QQRA 2BDEA 4QOJA 4ASUA 4GLFA 2GJ8A 1LPNA 3FFXA 4G5HA 2YY5A 1E7YA 4EJ2A 2JLVA 1SKYE 4LHSA 2GNOA 3K7EA 3KJNA 5HQTA 2VCHA 4HVAA 5EUMA 1P81A 3F67A 2PKCA 2VDNB 1ZD3A 1DAHA 1TYEB 3WNZA 4YPVA 2Z1NA 1RM3A 1U28C 1Z2OX 2HU2A 2VHEA 2Z8XA 3AVOA 2NMVA 4S1OA 4MWCA 2HTEA 2J9RA 3NOQA 1O5IA 2RHLA 1YHYA 3DCYA 3P94A 5LZ7A 4BLPA 2EKPA 4TRRA 8MHTA 1QMGA 2F3SA 1VE6A 2GPTA 1OTHA 2C4NA 1NUUA 1OV6A 1Y48E 1SWVA 1K8RA 4PQGA 4CLEA 2P9EA 2Q1YA 1T8PA 1O57A 2O6LA 2DHRA 5FWDA 3RTEA 1DKLA 3CCBA 3SSMA 4CCWA 3AVXA 1PL7A 3QKSA 4CN8A 3CFYA 4HT3B 1JT2A 1H3EA 3PD7A 2P2NA 1QV7A 2K7ZA 4HNQA 1MQAA 1EVQA 2V6BA 2I6XA 2RONA 3CZRA 4GI5A 2ZZNA 5M3BA 4GZ5A 1FTNA 3EPKA 2KPOA 3K2BA 1WPRA 4IEIA 1ZD8A 3NM5A 5L3SA 3NGLA 1PBNA 4KSBA 1H5UA 4FM9A 3LKZA 2I78A 3NHUA 3F98A 5A4MS 4K2AA 4KQ2A 2FWIA 1L7AA 5TF4A 4DWVA 3DMGA 3O2SB 2VSOA 1POWA 3OKFA 4L95C 4EOGA 2FPGA 2AL7A 3A9VA 3PQ3A 4K9RA 4ANFA 2VRNA 3C97A 2NO9A 4AC9A 2DP4E 4LSGA 1QKJA 1JFRA 3B2QA 2P3QA 3I12A 4ZZ1A 2BZSA 1E2NA 1S2DA 2XUQA 1WB9A 3NDRA 1D1QA 1P4AA 1OKKA 2CLOB 1V8FA 2EZ8A 4ZZ2A 3CRRA 4CCSA 5CAEB 4P0PB 4PPNA 4UFNA 5HJ7A 3ZDAA 3MJCA 4LUCA 3TRIA 1LLDA 2YOHA 2ZOSA 1OWNA 1RYEA 1T2AA 3MWDA 4FHCA 2BR5A 3KJZA 4LOAA 3SYRA 3ACBA 1BS2A 1VE7A 4Y1GA 3GFPA 1P5HA 3KU1A 4NULA 3FGPA 4ABTA 1W5TA 2RJ3A 3OFNA 1M1ZA 1BEEA 3E8XA 1PG2A 2A5GA 2ZB7A 2H92A 3KR1A 4U8HA 2W8BB 3DDOA 3V4RA 4NG5A 5DEIA 1W5BA 3DVAA 3NOOA 2AYXA 2NV0A 3PQ5A 3AF3A 3TLEA 5A9SA 5GONB 5MN5A 3ED5A 1OTXA 1V41E 2IPOA 1A7AA 2QRQA 3MHPA 5DTEA 3R0VA 4I4TB 1JWAB 2CJWA 3O3MB 5T3YA 2DECA 3GF4A 2PRSA 4FOPA 5KCZA 5TE9A 3D2AA 4J0EA 1GG2A 1Z8DA 3K30A 4CU2A 2EOAA 2Z4RA 1GILA 1DRWA 4QUGA 1A8SA 2ZDHA 2XGMA 3FCSB 4E2FA 3EE6A 3TNYA 1BSVA 4O4IB 1W76A 5TQJA 3THXB 4GP6A 2W6JA 4B7UA 4CQNA 5HJ5A 2XDYA 4XASA 1P4GA 2O14A 3DE3X 2OZEA 2Q5EA 4LVNA 2HA3A 3HZOA 3MUOA 4DSOA 4EUFA 4CIBA 3ZDDA 1M1YE 3FGNA 1HQCA 3A9SA 4JD5A 4KXMA 4WKOA 3DMHA 3DS8A 3WFZA 2VREA 1C9KA 1DNPA 1UQUA 2G40A 2GCPA 2IU4A 4NPHA 3NTLA 4ZAVA 5A4FS 2YZ2A 3OKPA 3MTQA 4C1BA 4GHWA 4FJWD 4ENPA 2Z4SA 3OTIA 3HVIA 5TPZA 2NU7A 4GLLA 5CIQA 1I80A 1PFWA 2B5VA 2HSWA 4FYMA 1W6RA 1M1YA 2PSJA 1FFEA 3B6KA 3OU6A 1Z45A 3BIFA 4FBGA 4WECA 2OPHA 2VWPA 4TVSA 4DXHA 2VBIA 3A9UA 4MWGA 2C54A 3NALA 5LOVB 2WSSA 3H4VA 5ARCA 1CF4A 4ZJYA 5KDDA 1JMYA 3NDIA 1C2TA 1R6TA 2Z9BA 3KSBC 3WIUA 5LLTA 3HYRA 5BW8A 4BAGA 3C1AA 1V95A 4L6CA 4B3BA 3HYNA 3B3AA 3R0XA 2JLUA 3JZDA 5KPJA 1TQ2A 3AJ9A 4RF3A 2XDQA 7GPBA 3CLVA 5M04A 4YV0A 2BEKA 4F2WA 5CXQA 1TADA 5DP2A 1OT5A 2W2KB 1KA9H 4OQNA 3SIXA 1IM5A 2JGLA 2PS3A 5IAGA 2XUHA 1EA7A 2QD3A 1F6DA 4Y30A 4YAOA 2ZYTX 3HB7A 1LSUA 4ESEA 1VKHA 2P1RA 4TM8A 2GPJA 1AHIA 5IJZA 5ICGA 5JDIC 5K8JB 4IHQA 2V0GA 3WGOA 1NE7A 1NRXA 1QIGA 1D09A 1A95A 1YCDA 3FSGD 5D3KA 5HILA 2VAMA 3F5SA 1PFKA 3TW8B 1DEXA 1KARA 3H11A 3QWFA 2H0QA 4EX7A 4CMJA 2CL6X 4QGSA 5TF0A 5BYKA 5BVGB 2FW6A 1RE0A 1N6PA 3HKBA 3QVUA 2A9KA 3QX7A 2WYWA 2FZWA 4CTOA 1UAYA 4JLNA 1A5BB 4U2GA 1ZJJA 4M83A 4Z1OA 1E5XA 1XV5A 1ZVJA 4Q4HA 1UP4A 1V8BA 4UULA 2DETA 3ZHSA 3GJ8A 2VIIA 3NQ41 2XMZA 1DLJA 3RBVA 3JAKB 3P4YA 3PD1A 4EZIA 4RACA 1PJSA 2QUZA 4RVDA 1IATA 3SHFA 2I62A 2R5WA 1DCFA 1NRIA 4M49A 5ANRB 5CDFE 4JOSA 2XF8A 4OEHA 2PUDA 1GHTA 5G1OA 1WO8A 2EFCB 3BREA 3A7EA 4DWJA 2XUAA 2ZTUA 4W5WA 2R8RA 3H9EO 4QTZA 5KAMA 3ZK8A 4BMOB 1P62B 4URVR 4BC0A 3TUZC 1OH6A 4H17A 2JGDB 2LXNA 4P33A 1IBMB 1DQPA 3W1VA 5CDFA 1EFAA 3VDMA 5IHXA 3BX1A 1XZMA 3FKQA 1OUMA 3KOUA 2ORVA 4O4LB 2ZI9A 1P1RA 3AETB 2QJWA 2VJQA 3AR4A 1GG9A 3L0YA 521PA 1JR6A 5EAIA 4LFBB 3ROQA 4S0XA 4DV2B 3ANYB 1XXHE 4DSNA 2GAJA 2J9FA 1RXUA 1WG8A 5HDQA 1M6VB 4TYYA 1ZZGA 4JJIA 3D4NA 4LOHA 4I66A 1N6KA 4HFMA 3VKWA 5B6IA 2ORYA 2XTAA 4FGWA 4CIAA 3ORRA 2DQSA 3C8ZA 2JLWA 2J5QA 3KR9A 1CLUA 2ZJ6A 2BDUA 2JAXA 3LRXA 2ZYIA 3QU5A 2QYSA 5JAQA 3WFJA 4DCGA 3U5TA 1XXHA 1E3TA 1T9HA 1G5TA 1FTQA 4U39A 3UB4A 2RH9B 3VPHA 2LZ0A 2R1TB 2AR0A 3KSRA 1W581 2XQJA 4IUDS 3K09A 1I4WA 1XTVA 2DHCA 2FEPA 3JR3A 3MMZA 4IDQA 3AGQA 4M0MA 4RIGA 3FTNA 3H2SA 1F8FA 3T1NA 2FQYA 2PJZA 1SIUA 1LJLA 1W49A 3I5UA 3IAUA 4NECA 3TIIA 2VJAA 2Z1MA 5LPNA 1UR5A 5DPMA 1GPLA 3OE1A 4BTEA 3LS2A 1R8JA 4LDQA 3QEAZ 2AMYA 3QLUA 4ENVA 1MAUA 2XYHA 3K9BA 4D92A 1ZGZA 3KDSE 2TECE 3D7NA 3T1OA 4QDZA 1X3SA 1LF0A 5DVZA 4P2BA 1GLNA 1MXHA 2FP4A 3BD9A 2DFDA 3I04M 5AI4A 3T06B 4YAEA 3A4IA 3EEOA 1KS2A 4OHZA 4KV7A 4QGGA 3LA6A 3K1AA 1WXEA 1EUCA 3GJ6A 3GEPA 4PFKA 3S6JA 1QK3A 1FSPA 3DAOA 2O2SA 3VNQA 4F3TA 5GZ6A 3EB9A 4D9KA 5IVKA 3ELWA 4LZWA 4WOBA 1JNYA 3QZUA 3GRUA 3O1IC 4LZNA 3D43A 3GIWA 3KSAC 1AS3A 1TMGE 3SHTA 4GKBA 5JSZA 3OJOA 2EYQA 5COBA 1J9GA 1B0AA 1VTKA 4ZRNA 3RSSA 2D1RA 3UUEA 4EYSA 1JX6A 4BNMA 3FROA 1ITZA 2OORC 1OW3B 2YX1A 3KU4A 3PJGA 2CJYA 5F9HA 2BF4A 4GR4A 3I6YA 1E92A 2PX0A 1FU7A 1DELA 2I3ZA 1OPRA 1JG3A 3USZA 4C78A 2BJWA 3DLTA 4BE7B 1WL8A 1T5TA 2F8LA 4L7QA 2VDWB 1US8A 4JJAA 3ROGA 2QS9A 7MDHA 5JS1A 3KHUA 2FW8A 4D25A 4MV9A 5PNTA 2R48A 3ZY3A 5F5LA 5EE1A 3PXXA 4A26A 3UK2A 1JEYB 3NRJA 5DM70 3WL4A 1UPAA 1ZS9A 2ZCUA 3KFVA 1E3IA 2Q3HA 3ZHBA 4C3VA 3QOFA 4ZYWA 4XWKA 4KRGA 2ZSUA 4DMKA 1CQZA 2QXYA 2GHTA 4UBNA 3RRBA 3E53A 4QQFA 3ZI4A 3TQIA 4D9JA 4ESVA 4JVNA 3AZQA 3F9RA 5EP1A 2JNWA 1U0TA 4MZXA 3RROA 2ZCVA 4S2UA 3G7NA 2YIMA 5LL6P 2NV6A 4IZOA 4PGHA 3RD5A 4DVGA 1Z7YA 3PNOA 3RASA 3KHKA 3EF0A 1D03A 4OXNA 2E5LB 3V80A 4KVZA 1RFLA 1V6AA 2GZ1A 4UAJA 3GI1A 2RGRA 3FYTA 3IT0A 3S55A 2ZUFA 1B8UA 2X8JA 5EZ6B 3D3NA 1OAOC 4RSRA 4QD3A 1ULBA 3KLOA 3VX3A 4KO1S 2QQFA 1ZK0A 5CGZA 2WKQA 2H5IA 3KXPA 4HFNA 4PW0A 3TM5A 4MGHA 4BBZA 2DUUA 5FJJA 3ROZA 4YAKA 4I1UA 5BRJA 3UTDA 3VU9B 2CGEA 1QJCA 5KWJA 1GUAA 1W0KD 2I54A 1VSBA 3W05A 1QRAA 3ZZ1A 1DAGA 4R6WA 1VIMA 1TCVA 4JB0A 3E70C 2VP0A 1CUUA 4NEHB 3FNGA 1TCBA 3HJTA 2OV3A 4HB0A 4RTLA 4OJTA 1UQRA 4CMIB 3C3XA 1KBOA 5FL3A 2B8WA 3E03A 1D2EA 5E6SA 1TCUA 4RJIA 4R8SA 1CR4A 4HH0A 4YECA 1JTVA 1JFFA 2RK4A 3GOHA 5KNDH 1A77A 1ML4A 1C7IA 1JQAA 1XNJA 4JT2A 4UPVA 1T34A 2I8CA 1U1CA 3NANA 4JI6B 2CK3D 1ETHA 2IEXA 3MAGA 1XXLA 4KGZA 5LR6A 4RJJA 2OHGA 2OENG 2A0FA 2IT1A 3NWJA 4FQ7A 2WWGA 1H8ED 1KVTA 4US0R 3ZX5A 5JO9A 2YJZA 1U9ZA 1W4CA 3RU3A 4L4SA 4LCEA 3PHJA 7YASA 5IJWA 4XCQA 4CTJA 5LBTA 1BX1A 3MS4A 5JS8A 3K70D 3JATB 3GQBB 4QARA 1PG0A 2I67A 1OC2A 4S2EA 3BCUA 2ZI7A 2OCYC 2WFAA 4JJGA 5BOSB 4F93B 1GTL1 4Z51A 3M1AA 1NIPA 2H52A 2PU5A 1NPDA 5JJCA 2H2GA 3JW8A 3PHCA 4GVPA 3SE7A 1W94A 3TLCA 4AW9A 1YV9A 4JP1A 3TTUA 5C52B 1PWXA 4OHWA 3AP2A 1T8TA 3EF1A 1HF3A 5KHOC 3INYA 3WAKA 2EEZA 3ULKA 1A88A 2E5FA 3MWGA 1S2OA 5BSFA 3TI7A 5F9FA 3PB3A 1RZ3A 3JAMA 1MJGA 3SHVA 2HUNA 1M2VB 2O2DA 3WHKA 3RIHA 1ECJA 1Y4AE 1UKZA 2B0JA 2C3UA 3F7OA 1P1CA 3M4NA 3ODPA 2NVWA 2CVFA 5AJYA 2Z2JA 4LE1A 1GRCA 2EZTA 2O0MA 5K03A 1NJ6A 2P9FA 4DIDA 2RGNA 1YOVB 4MHSA 3QEOA 5DHFA 1WXFA 1PEYA 3SBXA 1RWNA 3PPXA 4OBWA 1RI2A 5EWJB 2GA9A 2RHCA 2DFNA 2IYEA 2O3RA 2C2BA 3LM8A 4P3PA 5DNEA 1K4YA 1M2KA 1R0BA 2ZYDA 4H0FA 4MJ7A 3FDIA 3SSOA 3BT7A 3SK0A 2HBRA 4N82A 1J70A 4K6OA 4V0ME 2ZR8A 4EKDA 4RD4A 1E3QA 1HDCA 5K3BA 4I8XA 1OCEA 4JQYA 2PKYX 3GJSA 1JGTA 4KE9A 4KQKA 4MCHA 3TNFA 5HKOA 5AUQA 5I9IA 2AH5A 3EJ6A 3QTTA 1N6IA 4L9RA 4DCVA 4AS3A 3GO4A 2HA6A 5HMLA 2J0SA 3NHPA 3H17A 4UHCA 5DYNA 5FUVA 3FFTA 4NNJA 4V0MA 1NL3A 4IDFA 4N01A 3U26A 6ADHA 3BGDA 3HJNA 1OMOA 4WXMA 5AW4A 2E4VA 1WUYA 2Q3LA 5D3QA 2G09A 3QKSB 5U4QA 2YXPX 3CEPB 5HR5A 5ALKA 1UBOS 1SO8A 3A1TA 4GUDA 4NEQA 4OQEA 3AEYA 1QRUA 4LHVA 1D6NA 3FX2A 3GVXA 2YJ5A 5EMLA 4Z2YA 1ULSA 1GSAA 4YXFA 5BRNA 3PUXA 2C7PA 2C5HA 2XKJE 4LBZA 4XTCS 5L3SB 4MJXA 5IABA 2REQB 1Q5PA 2D1QA 4EY8A 1PBTA 4ENQA 1YZFA 1IOZA 2CD9A 4YPOA 1QU2A 3CR7A 5BN5B 3A2NA 3IUBA 3NDBB 2BE7A 4FNGA 2FPGB 1U3CA 1BXRA 1KC3A 2Q62A 2V6MA 4QYSA 4R2KA 4RD0A 5KHAA 2N0SA 3HN6A 3IXMA 4HLDA 4R1QA 1Y9EA 3UTCA 5HK9A 3LL7A 3AEZA 3NNSA 1T5BA 3SC6A 2N46A 1F17A 4PSDA 3N7AA 1EYZA 2BBSA 4OHFA 1YCHA 4QDJA 3C6YA 1BDBA 1N2CB 5TARA 1F2UA 3WP0A 2OVBA 5T8KA 5A4KA 5HYVA 3PZRA 3VTKA 2H2HA 2IX9A 3MAJA 1RQNA 4ZQGA 1V6SA 4PNZA 2PFSA 3DV9A 3N8HA 4HYYA 3VHQA 1MQ8B 2J3DA 4D9BA 1GU7A 3RKRA 2DAPA 4Q4DA 2DQYA 3R7WB 3D7RA 3IE1A 1P1BA 4K86A 3V4FA 3DVAB 4GP7A 1EINA 5A9SB 1QIFA 1WMSA 1XHFA 1MV5A 1RT9A 1ZH6A 2YRFA 3K6SB 4CV2A 3PQ2A 2CJWB 2MMGA 3MWJA 3QEKA 4N3NA 4NATA 3KKEA 1U8ZA 4JB2A 1Z4JA 3ZQJA 5DBFA 1I4TD 4PN7A 4RVCA 4L0DA 4Q7JB 3DOEA 4RPHA 1ES9A 5MN6A 3KYCA 1W0KA 1Z4IA 2CWWA 3GJQA 2BGLA 2ZB8A 2EG9A 1QLWA 3MN1A 4EYEA 2NO4A 5HOEA 4PQRA 4UNQA 1E0JA 3DZCA 3DPUA 3CN9A 4NE7A 3IYLW 4Q48A 2VYCA 5BR7A 1N57A 3QH4A 4MI9A 3TQTA 1B26A 2H2DA 3B6EA 3LPAA 2XUFA 1KAHA 2LCIA 3I4FA 1JLHA 4IQ4A 1JWLA 3D0QA 1TQHA 1LVHA 1SPXA 3HVRA 1HQKA 4BATA 1YDGA 2GN6A 1X7ZA 2J48A 2P2SA 4JLBA 5I7VA 3G9XA 4D9MA 2CK3A 1NMXA 2HQ1A 4FQ5A 4KV9A 1AUXA 1ESNA 4BB5A 1H8EA 3HFRA 1KYZA 3FUXA 3O74A 2Z2ZA 4F86A 1RIIA 1M1YB 2NVUA 2GWHA 2C5AA 3EVDA 3FUCA 4J4HA 4FB4A 3KXLA 1FFHA 2RI1A 4UVGA 4G86A 2PX3A 4BKPA 5BWMA 4QIJA 3O21A 1PW5A 1SVKA 2IV7A 4XQ9A 2AZDA 4FFBA 4OX9B 1Q84A 4WDRA 1OJLA 3EGDA 1FRZA 4RKRA 5G02A 4KQMA 3AWDA 2H7YA 2F1OA 1JA1A 1JMVA 2VT7A 1MGOA 4WW0A 3B1VA 2QE6A 2XDQB 3DULA 4M53A 1L7MA 2DG2A 4U8GA 3TLKA 1LVGA 1UBCA 4GOMD 1M0EA 1WCXA 3E8SA 3NIDB 4R51A 5B3JC 3DAGA 3VSCA 4UUOA 16PKA 1WWKA 2H5LA 2RBGA 2XMSA 2ZWPA 4NCIA 1XEFA 5ALQA 4XYLA 3WBKA 1ZVVA 4R71A 4QUDA 3BRQA 3K0EA 1OBOA 4P38A 2ZSIA 4LYFA 4EGAA 3IUSA 3KSUA 4L50A 1Q15A 1D2CA 4NWIA 4R3WA 3SXUA 5KX5F 3C8MA 1C3EA 2E6UX 3H4TA 4G81A 3H11B 1RQGA 5CCEA 4ZOEA 5JH7F 4PGFA 1X7WA 4EWLA 4G4JA 1BE1A 5IN5A 5AKKA 2R68A 1FTWA 4B3GA 1EBFA 1WZUA 3O8RA 1QHGA 1UMCA 4K9MA 4Q4HB 4PYMA 3CWZA 1ZR4A 2G5CA 2PS1A 4KQJA 1ECCA 2BSXA 4YJKA 3ZWCA 3BE5A 3N2NA 5I8ZA 2R44A 2WWIA 2CWDA 4MB0A 3F74A 4OLJA 3TNJA 1L3CA 2NG1A 1DVRA 4FJ2A 1Z8NA 2XVZA 1MF7A 2H9IA 5HKKD 5EY5B 1I5RA 2GKSA 5FT9A 4BPRA 1U2SA 1IU9A 1IB6A 3EQZA 5CPBA 3VVLA 4F3RA 1GZ5A 1HO3A 1SXHA 2HM7A 2HLNA 3QLUC 2FUG6 2F64A 3BXFA 2R1UA 4I55F 1Y4SA 4K28A 2EKDA 5SICE 3WWZA 3VV3A 3ZXIA 3JZAA 4JITA 4WIAA 3BH7A 1T2EA 1FU8A 3HJRA 3UVEA 4ACAA 1B8NA 3BZBA 1XZPA 4QU8A 2JAUA 4MI1A 4MYRA 5J4YA 4QBHA 3IEIA 3L9XA 3R4VA 3I45A 1PT7A 3ZV7A 1UM9A 1TIPA 1TO2E 5SY4A 4MVCA 4Y9RA 1Z5WA 1N6RA 2FKNA 2J9FB 2VDRB 3LQ1A 1SG9A 3TIGA 4E11A 3F3MA 4TTJA 3FMFA 5BWOA 2C98A 3KUUA 2A94A 3W5SA 1E0KA 2HJ9A 3URKA 4F1WA 1JPVA 1T91A 2WYUA 4CHTA 2XMRA 3FXAA 3NC4A 1IB0A 2AD1A 5FCDA 4P54A 2GR9A 1E1DA 1P77A 5JBIA 5DNYB 1NVBA 1XXHB 2VDPB 4JI5B 4GQBA 4BMNA 2JIRA 4J43A 4QXAA 3RIGA 3W8EA 2C1ZA 4IJ5A 5TS3A 1ORVA 1T2VA 2CFIA 4MDYA 3V6LA 3RVJA 2QDXA 1G63A 2XA9A 4KFSA 3RJTA 1NDUA 1PJ8A 2ARKA 2FUKA 2A35A 2P5SA 3M6XA 5DJ5A 3SQWA 1YJCA 3TLYA 3H05A 4DTIA 3DTVA 3AP1A 1D0SA 3IDSA 5JNVA 1GNRA 1DZIA 1X0XA 2WNSA 2IE0A 5A5DA 1I1NA 3DCIA 3LECA 4K8OA 2IIBA 5DTMA 1J8FA 3RLFA 4B3IA 3VO2A 4Q3BA 5JVDF 1F0PA 4MRMA 3RQIA 3MINA 2AUNA 4Y8VA 4BO0A 4EB0A 5FR1A 3ITNA 3TH5A 3BHJA 1G8AA 1A5TA 3G2KA 3WIVA 1YF3A 2FP4B 4GI1A 2JCSA 5K8TA 3GEIA 1XZNA 2UYQA 1NXXA 3KLPX 1YNSA 4OHMA 4X92A 4C5AA 4V0QA 4Y1FA 1U0SY 1LCIA 2PBRA 4GQAA 3CEJA 2IEYA 5JNSA 2BY4A 1JI3A 3G0DA 1KYWA 3LSYA 3K1AB 4U2CA 2JAQA 4KWIA 1EUCB 1TYDE 1U9YA 3QBJA 4MWDA 2G1JA 3V1TC 2NIPA 5LMUB 1WBDA 3RT9A 4KW7A 1GCIA 3UJNA 1XTZA 2NSJA 2XEDA 1QUEA 3MYBA 2BFCB 3CUWA 1FDOA 2P27A 3E1KA 4TV8A 4ND2A 3T3MB 3UUFA 3EW9A 4CHGA 4M55A 3ROKA 2WC1A 2VHVA 3TNLA 3RYHA 1VYTA 4E5UA 1T9GS 3G1TA 2GEUA 5JSZB 5MGBA 5EIOA 3ED1A 3U4MA 2DLDA 5A5GA 2R97A 3GUHA 1UXOA 4OGKA 2PZBA 2ZUUA 3A10A 4R9SA 2CZCA 2XB4A 1AHNA 1PLLA 2JASA 3RSOA 2B4RO 1BIFA 5TY0A 1SZCA 1TO1E 4AZ3A 2V3WA 4AKTA 4LCBA 2NU9A 1EDZA 1WS6A 3WQHA 5JIBA 1PKEA 3UMRA 4X3PA 2QPTA 1US8B 1G8JA 3ESQA 4QSHA 4DANA 2EXXA 1EKXA 1PGQA 1DDOA 3CEHA 3EC1A 3L79A 3M4YA 1AA6A 1P9LA 2D5BA 2VDKB 2P4UA 1ZGBA 2Z5FA 2V3CC 5HFAA 2J32A 5D7NA 3PFHA 3T7TA 2W58A 3ZIAD 1WVMA 1JE1A 3PCRB 5CNMA 3ZDCA 1M2GA 2H2FA 4BCDA 1ZGJA 1V7QA 1RQ7A 4BFZA 1PGPA 4QNRA 3K0AA 2QJOA 2AEMA 5FOXA 3AEKA 4HMOA 1FLDA 2XIJA 3QE4A