3A4LA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
250
structure length
236
Chain Sequence
b'DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 99
structure length 236
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4lA01
1PVOA 5IK2A 2PEYA 2VP4A 2OCBA 4TSFD 1AS0A 5JWOA 1JNYA 4A6PA 5TMPA 4TYYA 1LY1A 3B9QA 4MYTA 3X1YA 3L82B 3ZYCA 4RD2A 1KI4A 2KBFA 3AF4A 3KQHA 2ZR7A 5JEEA 2F43A 3C5HA 1FMLA 3PG5A 4CDGA 1EWQA 1XDBA 1L8QA 1WMSA 1AQUA 3DMNA 5HCIA 1IJFA 5DI3A 3W3ZB 4B6FA 1G17A 4BZPA 2X1VA 1Z0KA 1G8HA 1CULC 3BOSA 3THYA 3A4NA 4OKSA 1GVNB 1Z2CA 4BZQA 2GAAA 1I2MA 2YC2C 4HZUB 2CEAA 2J7KA 3WHLA 4QJ4A 1QG4A 4B6EA 1WXQA 4JJZA 5H70A 4BFXA 2AFIE 2OILA 5EJEA 3RS7A 2RGCA 4MRVA 3FKSD 1Z0FA 2OXCA 3JVVA 4KXFB 3NC1C 3H4MA 3K0EA 4ASUD 1JJ7A 1GSIA 3EIQA 3Q3JB 4ERNA 5JCPA 4POAA 3VX3A 4PPGA 2IX3A 1VCIA 2CL7X 2AR7A 3RRNA 3ZZTA 5AR1A 1T8UA 2OT3B 3DOFA 3EAQA 2ZXUA 1ZUIA 1Q22A 4LJ4A 4LGMA 3RS0A 3ADKA 1FUUA 3SHFA 4P4SB 2DB3A 5CB6A 1E9SA 3TW8B 3OF5A 4DVGA 4KITB 1A7JA 5JBQA 2IYVA 1G7RA 1S1MA 2FH5B 4G5GA 2JLUA 1G3QA 2DWQA 4ZV4A 2G3YA 1P3JA 1YKSA 3DPUA 4IDOA 4KYIB 2BCJQ 4LV5B 1DAEA 3IHLA 4MGZR 1PJRA 1R0WA 2QGNA 4M0LA 2C9YA 3ETLA 3OZXA 4JBWA 2GEDA 4JS0A 5A4JA 2QI9C 5F2EA 1FL9A 3SR0A 1VIAA 4W5JA 2FMXA 3GD7A 4KFUA 5DISB 3NBZC 3UKDA 2IXEA 1AIPA 1JECA 3KB2A 1SXJE 3CRW1 1P5ZB 2DCUA 2DR3A 2J46A 2I1VB 1QHGA 4FW9A 1VMAA 1KIMA 1OV4A 1K5DA 4HDCA 3PITA 4PZZA 4Q4LA 4AI6A 1RFLA 1XMIA 2AKAB 1M7HA 2HV8A 4AG5A 2R6CA 3L0OA 4H1UA 1T91A 5DO9A 4IOMA 3SDZA 3RC3A 4G01B 3N2IA 521PA 1ZNYA 4FCWA 3K09A 4ARZB 4DB2A 3O8RA 1Z3IX 4MKFA 3DL0A 4KBGA 3ADBA 2HT1A 4GFDA 1DARA 2QN6A 4LHYA 4AYWA 4DEYA 1GL6A 1X3SA 1Y63A 4LX0A 4I99A 2IXFA 2KI5A 2R8RA 4FD2A 4US0R 3GLIA 1M34E 5HZKA 1NY6A 5TV2A 4OHVA 4I1VA 2MMGA 1Q44A 4KFTA 2IUUA 1OXSC 4OHZA 4Z1MA 1G1MA 2JJ2A 3OESA 3RS2A 3RS5A 1XU4A 3PEVA 3SZRA 1GKIA 2CNWA 4H1VA 4P4UA 4YMTA 2YNMA 1OFUX 1TU4A 5FUVA 3KTAB 1KO8A 4RCZA 3TLXA 1T6NA 2GBLC 1JEEA 2IWHA 4MKIA 1A2BA 3LRPA 1IY2A 1OW3B 1HURA 5DN6A 4L15A 3QUSA 4QJ5A 1CIPA 2J0UA 3R7WA 1WDTA 2D7CA 3PUZA 1VCNA 5FTNA 1ZW6A 4LBVA 5E7MA 3GJ7A 3ZVNA 3K70C 3KKOA 1E1QA 4HI0E 1DEKA 2IUSA 2XZPA 3HR8A 1SGWA 4HLQB 2G0NA 3BC1A 3I92A 3NDPA 5A5GA 2RKOA 1OYWA 3T06B 1NVUQ 1FQKA 3K0AA 1E0KA 3OIWA 3THOA 3X1XA 4LRWA 4B75A 4Z1MD 1WB9A 2JJ2D 3R9WA 4QNRA 2FNAA 2CNWD 1QHHB 2JCSA 4RD6A 4NZYA 5AJZA 4CEIB 4TL8A 4II7A 1LFDB 1JJVA 1G7TA 3W5JA 1E9RA 1SVKA 1QHXA 2VPPA 2GCOA 2JJ8A 1P2TA 3BJIC 1M74A 2NO1A 1AM4D 3FMIA 4AD8A 3T1VA 1U9IC 4C30A 4DLXA 3KQUA 5DN6D 2QM8A 3CNLA 2O8BA 3CB4A 1E2FA 3EWAA 4PQRA 3ZIAA 2R65A 4NONA 4L8GA 1XPRA 4U02A 4NYMQ 2YOGA 5EUQB 6Q21A 5J4HA 2IA5A 1DAFA 2ATXA 2W58A 1N6RA 2BBWA 1OXXK 3MD0A 3TK1A 5HE9A 1Z6YA 2GJSA 1SQ5A 2WWHA 2VHTA 3TVTA 2QRNA 3D31A 3SE0A 3FE2A 3KJEA 4AYTA 1MV5A 1XMJA 2J87A 1M1YE 4ZDKA 3EPLA 1YRAA 5CDFA 1II8B 2DFNA 4IEEA 5GVSA 2MSCB 1C4OA 4M1KA 1CBUA 1KAOA 1JXOA 1F2TB 3HYRA 3BFVA 5DLQC 1XTRA 2ERXA 4TLEA 2A3RA 1BO6A 1MT0A 1W5SA 1I4LD 4JLPA 5C2JB 3H86A 1G3UA 3KXIA 2V55B 4JMPA 4JVLA 5CM9C 4Q4JB 3SFZA 4AURA 3AF2A 3LLMA 2J1LA 4M1OA 2VP6A 1XFAA 1S1CA 2JLRA 4DCVA 2IS6A 3R9XA 3TVDA 2F9MA 4HUQB 3TUIC 3EZ2A 3HJNA 4LOAA 3FDIA 1U8ZA 2ZJBA 3D3QA 2JLWA 4Q1CA 4B44A 1OYYA 4TWZA 2Z0MA 4ZCMA 1CXZA 1J8MF 4TN1A 2X2EA 2QEQA 4Q7LA 5GJBA 1CF4A 4Q02A 1Z63A 3ZVRA 1KK2A 1NN1A 5JECA 4M2LA 4EKDA 4DEXA 3LA6A 3AVTA 3A1UA 3IBYA 1GRRA 2W2VA 3B8HA 2EU8A 1XEWY 2Q0HA 3G5UA 3NEYA 3K0FB 3ADDA 1HT2E 3P32A 3AUXA 3X1WA 5KDDA 3RABA 1E2MA 4PAMA 2OBLA 3KFXA 1KDPA 1NG1A 2ZRGA 4TZ0A 3K1JA 1E9FA 2GKSA 3TAUA 1YR6A 3B5JA 3J81k 1KJWA 3GEIA 1XNJA 2P5TB 2G1JA 3BH0A 3QKSA 5L3SA 1IN8A 4FN5A 4KAXA 2O52A 4D2IA 2JEOA 3MWJA 2PT7A 4A2WA 1ZD9A 2ZE6A 2P5SA 3VQTA 1W0JA 2Y8EA 2FF7A 1P9RA 1DG3A 2ZJOA 2DWOA 4NU0A 4QGFA 1E69A 2QENA 4OQMA 4WA7A 5C18A 2CLCX 3AVOA 1GL7A 4G5OA 5CJ2A 1CR2A 2EFCB 2CHVA 2D2EA 1W4CA 2W00A 4RCYA 1Z6AA 4LPKA 5L3QA 3QF4B 1LTQA 2Z4RA 4HAVA 4AC9A 4BFZA 1YRBA 2XJ9A 1RIFA 1QBKC 4LY6A 5EE0A 1VHTA 4G3XA 3DZ8A 2DY1A 1RRGA 4QFMA 3LQQA 4Q1BA 1ZD8A 2CJWB 3BRWD 5KDLA 4CIDA 4Q01A 2EWVA 3TAHA 4Q03A 4Q5IA 1E2HA 1RC8A 4ABYA 2FA9A 4KJZA 3IGFA 3IBGA 3HWSA 3AVUA 1PV4A 1PLJA 4LZZA 1US8A 4DSUA 1W0JD 4TLBA 1E2QA 3TR0A 1D5CA 2AL7A 1G5PA 1ZYUA 3Q5DA 1QRAA 2G83A 1F6BA 3CWQA 5BN5A 3ND9A 4OYHA 3AP1A 1CP2A 3A36A 3CRRA 3I1FA 4M1TA 3GFTA 4MUAA 4Q1FA 2FZLA 5FOWA 2ZSBA 2VHJA 4F4CA 3FMPB 4IHQA 1KK0A 2Z4SA 1IY1A 4PSVA 1YZLA 3U4QB 3THWB 1IOZA 1M6NA 2XSZD 1NF3A 2MMCA 4LJAA 3KX2A 1NVXQ 4JKIA 4WXPA 5KPJA 2ZIAA 5JRZA 4UNNA 1KSJA 3W9YA 1ZAKA 4KVGA 4PTLA 5C1BA 2WTUA 1HYQA 3L0PA 4A0FA 2W0SA 3OEEA 1HE8B 3VR1A 2F43B 2GRJA 3BH7A 4PHFA 4QBFA 4CW7A 5JI3E 4Q1DA 4Q4HA 1Q12A 1VKJA 1RKBA 5TARA 2GA8A 4BUJA 4DUGA 4PHTA 2FFQA 1T8TA 5DI3B 2AFHE 2I4IA 3X1DA 1ZM9A 1NRJB 4P32A 4TMKA 4ZIRA 5CYOA 1EFTA 4EPYA 3P4XA 3THYB 3LX8A 4GMXA 2AN9A 2QMUA 2QTVB 3SYLA 2OFOA 3QNUA 1JPNA 4B48A 2GWHA 5GADl 1UAAA 3QPWA 4GMDA 1YVDA 1Q3HA 1YJ5A 1ZNZA 4R2IA 4UKDA 1DAKA 4UNQA 5EXTA 3TMKA 1XZPA 2BM1A 3U3RA 4F91B 1UBFA 2LWIA 2ZRPA 2J41A 3CBQA 2PEZA 1XXHA 3V00A 3GEEA 4E03A 2VF7A 3NTUA 4J0QA 3I72A 3KQLA 4F4IA 4JLNA 4QBGB 5FBLB 1P7CA 2G6BA 2C78A 1N5IA 4S35A 1R5OA 3F3YA 3U3JA 2FJUA 4D0GA 4PO1A 1H8HD 2ZUCA 1L2TA 2ZJ8A 5EP4A 4C4PA 2ZI9A 4QM7A 3OEED 1Z6TA 3IPYA 4HLUC 5E95A 1OKKA 1Z83A 5BN4A 3AGQA 2CCKA 4DSTA 1FQJA 5KO2A 4DUGD 5G3YA 4DIDA 1AKEA 4M1MA 1FTNA 3LO5A 3KJGA 4AIIA 3BBPA 3QPUA 1VCMA 2AKYA 2WPDA 5DNYB 2FPKA 3UK6A 4YMSA 2RHMA 1OXVA 1S9DA 1TF5A 2J7PA 1DG1G 2OSBA 2NGRA 4URZR 3VX4A 3C41J 1ZD1A 2WIAA 1Z06A 5FBQB 4MH0R 2R6AA 1XWIA 3ZS9A 4B76A 3QSYA 4DLUA 3EZ9A 3KB1A 4HDQB 4DSNA 2HCJB 2ODEA 1Z0AA 4D4KA 2DYKA 3BH6A 1AK2A 3WP1B 4D26A 4TYWA 4OK3A 1DBSA 3KJIA 2BHRA 2NIPA 3EA0A 4NCNA 3AUYA 3NDBB 3W34A 2GHIA 1OKKD 3SI7A 1E94E 1NN3A 1R6BX 2E87A 2R9VA 3NBFA 2MSDB 3VU9A 1IHUA 2IYXA 4ZPXA 2IS4A 2QAGA 5AWFC 5JMTA 5J4KA 2ORVA 3IUYA 4M1YA 4BFSA 2ZI6A 1MO4A 3GFPA 5LPNA 1E2JA 1CU1A 1OH8A 2ZAMA 3BGWA 4MKGA 1VHLA 1X1SA 2WPDD 4CGZA 3DHWC 2QY9A 4IKEA 1SVWA 1NLFA 5DGXA 2GJ9A 121PA 4QJ3A 5JSZB 3GLIB 3B9PA 3GJ6A 3MFYA 3SYKA 3FOZA 2J7PD 2X8AA 3LDAA 3EX7C 4C0BA 1U81A 1KI6A 2GXUA 1F60A 5C46F 2R6DA 2WKPA 4URWR 2NO7A 1K8RA 3CR7A 4B47A 4BRUA 4RD4A 3KUDA 1X8LA 4LBYA 4WOPA 1PLLA 1QHYA 1U0LA 3VR3A 1DAMA 3RS4A 3EPKA 4V02A 1G3MA 1R5NA 5IRCD 4JLMA 2J0UB 1Z8FA 2ZEJA 3GLHA 5FUYA 3R7WB 4HB2A 2ZRMA 4O0MA 1QVAA 5D3MA 5DHAA 2FDCA 4UXJA 2GTPA 1RE0A 1XEFA 5CIQA 3MWYW 1TQDA 5BYJA 4G1UC 3AKDA 1NL3A 3RS3A 1E2KA 1J90A 1N0VC 1ESMA 3W5IA 3RRZA 4Q4AA 5JJLA 2JLZA 4CEJB 3ZQ6A 1KI2A 4DXAA 2OE2A 3JZAA 4PANA 5EXSA 2JJ1D 1DTSA 1G8YA 1W4AA 1NN5A 2FWRA 4JIMA 4M53A 1N5JA 2L0XA 3L0IB 4ILEA 1G8FA 4QM6A 2LKCA 4M1SA 2A2ZA 3LAWA 1NBMA 3LX5A 2GCOB 3OIUA 4GSYA 4NBSA 4B3GA 4P0TA 1MABA 1YR8A 2O8BB 2ZJ5A 5EXPA 1IN4A 4Q00A 4NYJR 5HE8A 2J45A 1XJQA 1N6IA 1P60A 1KZGB 3W6PA 5JWHA 1AN0A 3SFVA 4XVUA 2YHSA 1WBDA 4XD7A 1K5GA 1Z2AA 5FOUA 1GTVA 4X8LA 1JR3E 4M9XA 1IN6A 3K9LA 4U7DA 1E32A 1XEXA 2QAGC 2CE7A 1GITA 1TX4B 2FZ4A 1R5BA 3KDSE 3R8CA 1IBRA 4Q7KA 1E96A 4N0EA 2ZU6A 3K53A 1FP7A 3T12A 4DCSA 4W5WA 1GILA 5FL3A 2H5EA 1KDOA 1IM2A 4PC2A 1L4YA 2V8OA 4BLQA 1ELOA 4C0AC 1NSFA 1S2MA 5DE3A 3F5FA 4FCTA 1T0HB 1U98A 4BRWA 4DLTA 1FFHA 3AKCA 1VYUA 1G7CA 4ESHA 5BQ5A 1NBMD 4GOXA 3AB3A 4YMWA 2O5VA 1OFTA 1NVVQ 2KJQA 2BBOA 2OFWA 2W83A 4LJYA 4EPTA 1T4GA 2ZRKA 3RWOA 2QUZA 4YMUA 4MA4A 3B78A 4OK5A 4BLPA 2NG1A 1W7AA 3C14C 4XD7D 4DSOA 1HEIA 4EPVA 3K9NA 4BEBA 3DO6A 2WJIA 3TKLA 3THXA 5G41A 3EG5A 2RGGA 5FUWA 4GNKA 4OJKA 1UEJA 4P3YA 3SC3A 3U3OA 2ERYA 2P3SA 3IIKA 1DO2A 1T5IA 2H18A 1GRQA 2W2XA 4KLNA 4BFWA 3LBHA 2VA8A 3PCRB 1PZNA 2VSFA 3OAAA 4DLYA 4RD3A 3IKJA 4KFRA 1EFUA 3C8UA 5ELXA 4QGGA 1HQYE 2O8FA 3WP0A 2WSMA 1RZ3A 2ZQ5A 5CLLA 1KK3A 3MG9A 4B3FX 2XAUA 1NG9A 2V9PA 2RGNA 4EPWA 2GVDC 4JT2A 5FPYA 4ZDIA 4AKEA 4LK2A 5DYIA 2ZJZA 3QKSB 5L3SB 1H65A 5CYPA 2V1UA 4IJMA 5ANRB 1P9WA 3LW8A 4FWIB 1E2LA 5KPDA 3CUEF 3Q7PA 4FMDF 4ZDWA 1Z0JA 2I3BA 1XP8A 3B1ZA 4TYNA 4TT3D 1NN0A 3TUZC 3PFIA 1J8YF 1CJKC 3SEAA 2IYUA 2AWOA 3GLGE 1ZIOA 2IYLD 1XCMA 5B30A 3G82C 3T1QA 1ZUNB 4LUCA 1KY2A 4JBYA 5JEDA 2J5XA 4C0KA 2GVZC 5L3QB 3UATA 1S9HA 2ZAOA 1ESNA 3OAAD 1MRSA 1OFHA 4NYJQ 4TL9A 5IK2D 2O8EA 1R7RA 3GEHA 1HH4A 3EIHA 1VYTA 5JZVA 5LD2B 3DZDA 2CBZA 5CJPA 2F3TA 2WAXA 5FUXA 1ZVQA 2IXGA 1NKSA 1W48A 2OCYC 3NH6A 1N25A 2QT0A 3FVQA 1N6PA 1ZC3A 3LNCA 1Z0IA 2CLDX 2ZJYA 5DIFA 2ZU0C 3WYAA 4DBLC 2GJAA 4XOIA 4RFSA 2GJKA 4QHSA 4IVRA 5FPTA 3NIBA 1TQ6A 4OK6A 1CR4A 3Q7QA 1US8B 2XEXA 3CWZA 4NYMR 2ZRIA 5DSZA 1EX6A 4TQAA 4HEJA 4UNPA 1IY0A 3M1IA 3CPHA 3EARA 1D6JA 1L4UA 4TZ6A 3W8NA 1M8PA 5G3ZA 4AWXA 1WRBA 4XIGS 4LHZA 1KYIA 4PHHA 2Q3HA 3ZJYA 2GXQA 1CR0A 3ZLJA 3HU1A 3F0TA 3GLFE 2SHKA 1EWRA 4ESVA 4PC6A 1JBKA 1WQ1R 2F1HA 1MOZA 2PMDA 2HJGA 5FI0B 2ZRAA 3QG1A 3BK7A 2B6HA 4KLZA 4A36A 3AP2A 1G19A 3D8BA 3H2YA 2CHQA 1A1VA 1II9A 4WZAE 5F9HA 4Q4HB 1OLOA 1N3BA 1IN5A 3P26A 1I4TD 5JRJA 1QHIA 2IS1A 2IK8A 4HLCA 5AJWA 2ZRFA 2RB4A 4B71A 3PVSA 4CT4B 4ZIRB 3B13B 2F3RA 2RMKA 1E2GA 2YYZA 3SN6A 2O8DA 1UM8A 2V6IA 2B21A 4OQFA 1ANKA 2XJ4A 1HA3A 2YV5A 4FINA 1KMQA 4LYAA 4R98A 1G41A 1G5TA 2FFBA 2QBYA 3PUYA 4BECA 1XXHB 3FGNA 4RY2A 1LV7A 2JASA 1G8PA 2PMKA 5LB2A 2ZS7A 2BMFA 1GZSA 2HT6A 1YZUA 1Z08A 3PUVA 3GQBA 2NMVA 2D62A 3CRVA 3LV8A 2C99A 2ZR0A 3M0EA 2B92A 3QY0A 4LJ8A 3WNBA 5KNDA 4JLAA 3IO3A 1XZQA 1KOFA 4IXNA 2YWEA 5FL7A 1GL9B 2WIBA 1KJZA 2YINC 3B6EA 5J40A 1OFIA 2WWFA 4QBIA 3QBVA 2GJ8A 2P67A 1VG8A 1CKEA 2GK6A 1OSNA 4DWJA 4EPXA 4RJLA 5KSZA 3KUCA 2WWWA 2QPTA 4DRZA 2JLYA 2DFLA 2PJRA 3IEVA 5AJYA 4CZ2A 2QG6A 5L3RA 1EGAA 4GPTA 3DM5A 4JLJA 4QXAA 1ONBA 4TLAA 4XVQA 2CLSA 2Q3FA 4HATA 3IDQA 4RZ2A 1G5RA 2PLFA 5GJWC 3RWMB 5FOXA 1BKDR 4PX9A 1RVDA 3ZVLA 2J0QA 3LVRE 4HUTA 1RW4A 4B43A 1E9DA 1P62B 2VRWA 4NH0A 1QVRA 4GOJA 1UADA 2BMJA 4GZMA 4BE7B 5K8IA 2V7QA 2WOOA 1G3IA 2RAPA 3ASZA 3K09C 5FL7D 2FSFA 3VU9B 1JAHA 4W5HA 2QAGB 2A30A 2TMKA 1E1QD 1OH6A 1CTQA 2BC9A 2ASEA 5HKKA 2CXXA 2OESA 3ICEA 2GZHA 2QTHA 4PQFA 4QNMA 4FMDB 2FN4A 4HB0A 5F98A 2BEJA 5AJVB 2BOVA 2AXPA 2ZJAA 4LHVA 2QP3A 5IF9A 1Z6XA 4DLSA 1F48A 1P72A 2CCGA 1KI6B 4B2LA 3I32A 3E2IA 2N1BA 5JHGB 3PEYA 1MRNA 1HTWA 1ZM3A 3K0CA 4IOLA 1JI0A 1SULA 2NZJA 2QMOA 3BFXA 2GK7A 3VMFA 4DLWA 4M21A 2PL3A 3LXXA 3ZIAD 1N0UA 1EFCA 3CNNA 3UIEA 5JI2E 1W4BA 3NC0C 1II0A 3NG1A 2EFEB 3KKPA 1D2NA 5HZHA 3IHWA 3I73A 4NCIA 1VECA 4ZO4A 2V7QD 4A2QA 3GLHB 5TDHA 1RRCA 4D81A 2OFXA 5D3MB 1DOAA 3BFKA 2IYYA 4DT1A 4IDNA 4XTRA 3LWNA 2YWHA 3IEUA 3RHFA 4LJ7A 4KSCA 2K5UA 821PA 2HXYA 1COWA 2NTYC 3SJAA 1U8AA 4Q4AB 4JBXA 1SXJA 2IYRA 5JCZA 1TL7C 4JJKA 4G0NA 2BIFA 3A1WA 3A4LA 2IYSA 2OCAA 5LBIA 2AK2A 2C9OA 3NXSA 4QL3A 1XRJA 2QL6A 1GOTA 1ZU5A 2WVJA 1DELA 2VO1A 1YR9A 3A37A 2VSOA 4GZLA 5FR2A 1EESA 2EYQA 4DKXA 2VP2A 2JLSA 1T3SA 3EW9A 5CB8A 1MABB 1R2QA 4KO8A 5A0FA 5FH9A 1A2KC 1XD8A 1KTVA 1N2CE 1FX0A 4AKHA 3CF2A 1GRNA 3ZDQA 1KNXA 1N6LA 3HR7A 2UZIR 2VHCA 5AUOB 4JLOA 4Q1EA 2GESA 3A1SA 2BVNA 3IIMA 1U2RA 5HR5A 4GP6A 1XEXB 3CZPA 2PX3A 4MGKR 1COWD 221PA 4QRHA 4O2RA 1SKYB 3LXRA 1AZTA 5E3HA 5CK4A 1SXJD 4PC3A 4L9SA 3VR2A 1UDXA 4L9WA 1UJ2A 3WYGA 3U44A 4L5BA 2FEMA 1X8JA 3GJ0A 2ANBA 2OZEA 1JEDA 4HZUA 5FR1A 4I1SA 2FU5C 3MLEA 3S1AA 4RZXA 2GXAA 3X1ZA 4B3XA 1ZCAA 1XTQA 2Q9CA 3CM0A 3BWDD 1GWNA 4MQBA 3K9HA 4XWAA 2KE5A 2ZSFA 1N6OA 3I8XA 4EAQA 1XCGB 2IF2A 4JVNA 2A7QA 3HDTA 4WXRA 2OBMA 3BXZA 1E0SA 4JSYA 1FOEB 3RRMA 3U60B 1G64A 4AG6A 1T0JB 4MDEA 1MO5A 3AVWA 2BKEA 5FFMA 2JA1A 4RKEA 1SHKA 3HU2A 3GCGA 2PJZA 3QXHA 2QMHA 4I4LA 2WHXA 2ORWA 1AS3A 3THXB 1DVRA 2CVHA 4XJXA 4C0QC 4LWZA 1SVLA 4UNRA 3H1TA 1A4RA 3TUJC 3H84A 4LYJA 4X8OA 2O8CA 1OHHA 4TMTA 4HAXA 4D80A 3MGCA 2FSIA 4CF7A 3QVVA 4JLDA 3QEOA 4ACBA 3MJRA 4WVFA 4E09A 1UBEA 3EASA 2IW3A 2C5LA 3VFDA 1DO0A 4A8JA 4D0LB 4XWOA 2O8FB 4IDQA 3QVUA 5HPYB 1A5TA 2VYFA 4E07A 1Q1BA 4S2EA 4MUBA 3UMRA 1MKYA 2VP0A 3PR1A 3K9GA 2NPIA 1TADA 3RAPR 4WBSA 3HPQA 3KFVA 4UQOA 2ZRDA 1OB5A 3L0SA 3T5DA 2FV8A 721PA 4OQXA 1E2EA 3BB3A 5FI1B 3LBIA 2A5FA 4QHTA 4BLOA 1R4AA 1DPFA 3OEHA 1FW6A 3TW4A 4PQYA 1CEEA 5KOYA 1XCPA 5FBRB 3D6TB 4AY2A 2J0VA 2WZQA 4JYBA 1UKZA 2W0MA 3TNFA 2FPLA 1JQJC 2WBLC 4ARZA 3C5CA 2F9LA 1X86B 2WKQA 2ZRLA 4Q47A 3ASYA 4QG7A 3T1OA 1OHHD 4Y0VA 1W44A 4TQUS 1G4AE 1KMHA 4V0KA 2O8EB 3AGPA 2XNSA 4D4JA 4Q7MB 2FG5A 1KNQA 4Q7JB 1OIWA 3KJHA 5LD2C 1F5NA 1KDRA 1LW7A 4WIAA 1XEWX 5K8UA 3Q8XB 5AUNB 2WOJA 4BEJA 3AH8A 5TY0A 2PH1A 2HCBA 3FFBA 4WZBE 3KTAA 1VPLA 1E1RA 5KHOC 3QOFA 5EP3A 3PEUA 3WNDA 1GM5A 1FUKA 4RFSB 4MRPA 5FOTA 3OEHD 1QHSA 4V0NA 3GJ4A 1ZMXA 3CR8A 3BS4A 1TPZA 1U8YA 3RRYA 3MWLA 4LBWA 4Z8YA 3V4RA 3RVBA 1Z22A 2G0TA 2JIZA 3U7EB 4UXIA 4C2TA 4C7OA 1E99A 4R7ZA 5P21A 3P20A 2O0KA 3ZZUA 2PCLA 4NHOA 2KB0A 1GUAA 5CM8B 1ZIPA 3U7GA 4URVR 4PC1A 5H1YA 2AHOA 2ZR9A 1S0UA 2WICA 2OAP1 2VEDA 1Y3AA 4ZI3A 4BGDA 2OO7A 2XITA 4DDUA 5IDVA 2EW1A 3VKWA 3FTQA 4OHWA 1PUJA 1BIFA 1E1RD 2A5GA 3QKUA 3A4MA 2GZDA 2NPFA 4PPNA 1XJCA 4URXR 1LF5A 3C7KA 5B64A 1NVVR 1XTIA 2BMEA 1G7SA 3B2EA 4DDWA 1OE0A 2QQEA 1R0XA 3CRMA 3KQNA 1MH1A 2D3WA 1YZGA 3TBKA 1L7VC 8OHMA 1N6HA 2F1IA 2REBA 3BORA 4TTRA 2ATVA 4GP7A 3W6OA 3SOPA 1T5LA 2JIZD 2OV2A 3WXMA 4QC2A 4MYUA 1NJFA 1H8EA 1LVGA 2IS2A 3QQ5A 2ZYTX 4AYXA 2O8DB 1M7BA 4FCVA 421PA 4EJSA 1OH5A 4US1R 2WWIA 2P0EA 5EUMA 1EX7A 2ZE7A 4RKFA 2XGJA 1X1RA 3QBTA 3P1JA 4LSGA 2V4ZA 3CIOA 2QBYB 2QP4A 1XTJA 4UXHA 1X6VA 3ND8A 3T35A 4B74A 1W46A 5SZHB 4PR0A 4KV9A 4B35A 2QP9X 1GNPA 1W2GA 3SBDA 2JATA 3KXLA 4IFBA 1G8GA 3FPAA 2C96A 1D2EA 1JXMA 2CE2X 3GJ8A 1P2VA 2HXSA 4AKIA 2Q9AA 3JZMA 3LVQE 2JLQA 4NDZA 1KK1A 3EPHA 3QXJA 1V43A 4XSGA 2DBYA 3R8FA 1Q1QA 3SJZA 1MO6A 4MYHA 4DLVA 4TLDA 4M9SA 1ODFA 2R44A 3OFNA 2QE7A 4K46A 2UZ3A 2P6UA 3K0AB 1NIJA 3B1WA 3KKQA 4OQNA 4PSKA 4OBEA 4WAUA 5SZIA 4EFNA 3QKRA 2YJTD 4FI3C 1I2DA 2AD1A 1UF9A 1TF7A 2QA5A 4IDHA 1UKVY 4GT1A 4M9QA 4NCKA 2C95A 2RGAA 2O0HA 1KI3A 5UKDA 5SZKB 3AV0B 1DADA 4G5SA 2VSXA 3QE0A 4HAUA 1VIYA 3HYTA 4GRAA 3PQCA 2NQ2C 4LI0A 3AKEA 4PFSA 1FNNA 2I1QA 2YOHA 2ZE8A 5KU1A 2YVUA 1TTTA 2FX3A 2WAYA 4KHZA 3ZS8A 2ONJA 2H17A 5KSYA 4F92B 1XMSA 4YQFA 2ZI7A 3BB4A 4DHEA 5CLQA 2GXSA 2WSSA 4QGAA 4MGIR 4UNSA 3QPVA 4TMZA 2ZRNA 2ZUDA 1NY5A 3OHMA 4RVCA 1W36B 2V3CC 3OFND 2QE7D 3CPJB 4DLRA 1XTSA 4H9GA 5BN3A 2WJVA 3KZ1E 4OI1A 2PLRA 2NOAA 1UBCA 3VR5A 1W0KA 5LDDC 4ZKEA 1CJUC 4KYUA 4LC0A 3WNCA 3VNUA 1E98A 5EE3A 4KU4A 1RJ9A 3CLVA 2ZROA 3LBNA 4F4JA 3ZVMA 4A82A 1HQCA 3GLIE 2A5JA 2CL0X 4B32A 1R8SA 3SQXA 1UDWA 2WJJA 3MJHA 4UJ5A 2Q9BA 4URUR 2WWXA 2P2LA 3N2EA 3QF4A 2UKDA 2ZRHA 2IWRA 1NKTA 1D9XA 2EVWX 2OHFA 1XTKA 3AF0A 2ZE5A 3CH4B 3NH9A 5JFGA 1KO1A 3AVXA 2QNRA 5IT5A 2GF0A 4OI2A 4TLCA 4JLKA 4LJ9A 3TRFA 3LW7A 3I3SR 2IYQA 4BLRA 3CX6A 2NO9A 4MITA 3ECCA 2F1JA 3CX8A 5JWRA 1UFQA 4D6PA 2R6FA 2YZ2A 3GJXC 1R8QA 2IT1A 3PUWA 4DT1B 1FMJA 1IN7A 4QGHA 3WMGA 2D06A 4PPFA 2QSZA 2IBMA 1W0KD 1BH2A 1HV8A 4URYR 3ZH9B 2ZANA 5B2ZA 4HZIA 4A2PA 3FYHA 1SXJB 3OIYA 3IPXA 5CITA 4ZCIA 3SU8A 5TVKA 3SYNA 4HB3A 2BMDA 2QORA 2HF8A 3LH5A 2RGDA 1S96A 2AX4A 1N6KA 5EQTA 4D0NA 1J7KA 3SJBA 3JVUA 1GFIA 3VTKA 3MMPA 3R9IA 2V1XA 3FKSA 4V03A 5KSOA 5FTKA 2XXAA 2QAJA 5LB4A 1WCV1 2FOLA 3AP3A 2HUPA 4Q9LA 4F93B 1QHNA 3T34A 3VR6A 5JHHB 1BMFA 4EDHA 3PENA 2IUTA 2G77B 1NNEA 1FX0B 5BYKA 4Z51A 4A9AA 2YC4C 1Q3TA 1EFRA 4RFVA 3DKPA 3DKVA 5C4MA 3ZD7A 3VKHA 2Z43A 2D2FA 1Z07A 4FIDA 4GOKA 4HYYA 3EZ7A 3L2OB 4ZKDA 5F3WB 4BFYA 1K6MA 2VP5A 1YR7A 1OT3A 3DEFA 1LS6A 2IL1A 2WV9A 3ONWA 2P6RA 2ODWA 4MRNA 1FNMA 1ZCBA 3U44B 5CDFE 3B1XA 3U5ZB 1G16A 4JL5A 1NLZA 2YWFA 3MRSA 1Q1ZA 4PSAA 5B57C 5B58C 1QF9A 1M7GA 3S1AB 4AKGA 4OI0A 2BCGY 1Q57A 3WRXC 3Q72A 3W3AA 1P6XA 4N1AA 2GBLA 4JLBA 4B34A 1BMFD 1E2DA 4LDJA 4XSHA 3K0SA 4NL4H 1YZKA 2A5DA 4YDHB 1UKYA 1EFRD 1FP6A 2F1RA 1E4VA 3IQWA 3P27A 4RZUA 2UVQA 4QHYA 2OAQ1 1E2IA 3DMDA 4V0OA 2XB4A 3WY9A 1BYUA 1WA5A 1ZM4A 4B3DA 5FPHA 3C16C 4YDSA 3O8DA 1Z47A 2JAQA 2CCJA 2OXRA 3QG5A 1G3RA 3ZQJA 1VG1A 4CVNA 1TNDA 4MYCA 3BE4A 4LC1A 2O8CB 1E0JA 2VHUA 1B0UA 4CEHA 4Q21A 4Q9JA 2ZI3A 4DCUA 1XMVA 1G20E 3PV0A 2ODBA 1AS2A 5D3QA 5BWMA 2ANCA 4Q9IA 4A8JB 2XOKA 1AQYA 3MAAC 5J47A 1XD2A 1BYIA 2KWIA 2OLKA 2FSHA 4QKQA 4YONB 2BDTA 1AKYA 2ZTSA 2RGNC 4O2LA 2A78A 2HEIA 1U9IA 1YZTA 2NZ8A 4TL6A 1YQTA 1SZPA 2REXB 4YC7A 5JS7A 3FHCB 2PCJA 1JR3A 2JGNA 2XTMA 2N42A 4D82A 2VIIA 2FFHA 3I5YA 1TUEA 2IYWA 1ZRHA 3KKMA 2W6JA 1SHZA 5SZJA 4JVMA 1E9EA 1KI8A 1T9HA 2BV3A 4L16A 1GNQA 3LQRA 4V0ME 1PUIA 1OIVA 3K70D 2ZYVX 1NMZA 2Z5FA 1HE1C 4C0JA 2IEYA 4BFUA 3NEJA 3C15C 3DDCA 4IDPA 2RCNA 1FZQA 1DAGA 4A0GA 3PIRA 1KMHB 1P61B 5JSZA 4US2R 1TQ4A 2OCPA 5E7IA 4TTQA 2J3EA 4CRWB 3Q5EA 4IFEA 4JLVA 1N6NA 2XOKD 3WRYC 3ADCA 3A1VA 4OQLA 1S8FA 4JL6A 4PZYA 3GFOA 3Q9LA 1KI1A 1A82A 3I5XA 1KO4A 4MRSA 1AZSC 2H57A 2JDIA 3N70A 2QGZA 2CL6X 1DAHA 1E2PA 3A8TA 4Q9HA 3UXMA 1JR3D 1XF9A 2J9RA 3FFAA 3NHBA 4PO9A 4NCJA 5L8VA 3T61A 5EXXA 3TSWA 4EIWA 3O8CA 2Q21A 2W6JD 1YHNA 5AK0A 1QZXA 2N46A 4NYIR 3DOEA 2WJGA 5DYGA 4DCNA 4CT5A 2XX3A 2ZSEA 1XPUA 1WF3A 3SQWA 3REFA 1OPXA 2GCPA 3DM9B 1G4UR 3CPEA 4C7OB 3AKYA 3L8YA 1IONA 2BJVA 3Q85A 2EFHB 4O25A 5C4GB 4IEIA 1UBGA 2ZJ2A 4BLTA 1DE0A 5KTYA 1WP9A 1OXTA 4HAWA 5GJVC 1W49A 3QXXA 1EFHA 2GZAA 2RH5A 4CEJA 1MR3F 2F55A 3UMFA 5EZ5A 3WYFA 4Z54A 1GIAA 3GPLA 2FEOA 3AF3A 1NSTA 2VH5R 2JDID 1NP6A 4NCHA 1F2UA 2AK3A 4FMBB 4LV6A 2VQSA 1S3SA 4HB4A 2VL7A 4GDFA 1KKMA 1G21E 3O47A 1E4YA 1P75A 1QDEA 1TU3A 3RDPA 2IYTA 3CONA 4DC9A 3G0HA 1R0ZA 3HP1A 2CMKA 4GL2A 4B2IA 2G1KA 3GLGA 3QENA 1R0YA 3PJRA 2OEPA 3UG7A 2IYZA 1KSFX 1PLKA 1N0WA 2WJHA 4RSGA 1LF0A 1KAGA 3RSOA 3U3KA 3UANA 1O87A 1CJTC 3QXCA 4IRUB 4TQ9A 1CS4C 3BD9A 3GJ5A 3E70C 4TMWA 3IQXA 2QTFA 3AVPA 4PAOA 4EJSB 4XVRA 4ON9A 3LLUA 3CH5A 2W6IA 2ZVPX 5EE5B 4DLZA 5L3VA 3RC8A 4EQ6A 2GEUA 1T3HA 2OG2A 4PO8A 3GP8A 1C9KA 2ZYUX 2HYDA 2B7BA 2BBTA 2ECKA 4K8OA 4BQSA 1S4QA 1XXHE 5DHFA 4RZ3A 4WW0A 3E5HA 4G5RA 4M22A 4NP6A 2V6JA 4DIEA 2OM2A 1W36D 1AJEA 1P2UA 5HKKD 2CHGA 2C2HA 4EPRA 5JS8A 3U61B 4E5UA 2IC5A 2VLIA 2WMNB 3KL4A 4X8MA 1W2HA 1E9BA 1G6HA 1KHTA 4V0LA 3TGPA 2BKUA 4TL7A 1WE2A 1UKEA 2FSGA 4TMVA 3BAFA 4W9MC 2BEKA 3EC2A 1MO3A 3D7MA 1RPZA 3WMFA 1ZC4A 3QKRB 3GLFA 4I81A 4JL8A 1JB1A 2H92A 1NI3A 2HDNB 3IO5A 1Q1EA 4HAYA 2W6ID 4CYMA 3VAAA 2DFTA 3V4FA 1TF2A 5AUQA 3CRQA 3TJZA 3NBXX 5J4YA 1ETUA 1G9XA 3IIJA 4NKRA 3T15A 3SBEA 5EP2A 4NYIQ 3B60A 3F8TA 2QRZA 3C4JA 4BASA 2CK3A 4XTCS 1IAQA 1CJVC 1E6CA 3T5GA 3UWKA 3FMOB 1Q20A 3ZGXA 4B3BA 1J70A 4ITRC 1ZINA 2QSYA 1TEXA 4C3ZA 1RYFA 3WBKA 1D2MA 4IVQA 4N0DA 3TQCA 2ZREA 2PT5A 4A0HA 1W36C 2EFGA 1CRPA 3FKQA 2IHYA 4PZLA 4Q66C 2YOFA 4V0MA 4I1OA 5JJIA 4EFLA 2P65A 1LS1A 3CO5A 2RGBA 5TB5A 1VG0B 1W4RA 5J4VA 1W5TA 4HSEA 3QEJA 3W90A 5J5CA 2E9SA 4B3CA 1RJ9B 4IXMA 2IF0A 1GAJA 2IHBA 4FMCF 2PZFA 5FBWB 1VDZA 2GCNA 2REOA 3K0CC 4C2UA 2WMOB 4D4MA 2AWNA 4IOJA 1F3OA 4KSBA 4B33A 1J2JA 2OBNA 3KKNA 4DJTA 3H0KA 1RRFA 2F7SA 3WBJA 2QQ0A 2HJVA 3CNOA 4LJ5A 2XSZA 5K8LA 2CK3D 2Z83A 5E7JA 3TE6A 2A5YB 1JALA 1LB1B 4YLGA 1TUIA 1LNZA 4OHXA 3RNLA 1ZP6A 4JT4A 4HLUA 3CX7A 2XTNA 3FMFA 5FOVA 4I1UA 1RYHA 4P4SA 3B85A 1VTKA 2QPAA 2Z6VA 4HDOB 4F7WA 1SVSA 3MCAA 2KSQA 3EZ6A 2A9KA 2P6NA 2H1LA 3GLHE 3A6PC 3WMEA 2XB2A 1U0JA 3E1SA 3FWYA 1GG2A 4ZDJA 2ZPTX 3NVAA 1SVMA 1ZNWA 2X2FA 2IEZA 2XNDA 1CJMA 5KUTA 2X19A 1SXJC 1JR6A 5AJXA 1Z29A 4L4UA 2BJWA 3TSOA 1NIPA 1ZJ6A 4R71A 1TEVA 4MRRA 4UJ3A 1XPOA 2PZGA 2O0JA 3MSXA 4PPQA 2C77A 2WWGA 1KZ7B 2WJYA 1NVWQ 3FHOA 3OIVA 2KBEA 4KI0A 4F38A 3R20A 1JAIA 4M1WA 3A58B 2YKGA 2XXAB 2D7DA 5EZ6B 3KXKA 3BIFA 1IJEA 1BOFA 2C04A 4Q19A 2R62A 4OJQA 1SVIA 5M04A 3T1TA 4FWTA 1NBME 3DVLA 5KSPA 5H68A 3VHXA 2QM7A 2ZS8A 3VHLB 1Z6GA 4JSTA 2EFDB 1H8HA 4ACAA 3B82A 1VYVA 1AGPA 4IOKA 3EZFA 2FGJA 1QG2A 3RYTC 2XNDD 3V9PA 1AGRA 1C1YA 3QJYA 2B8WA 2FGKA 1V5WA 1UPTA 2GDJA 2QMEA 3P4YA 1ZNXA 3VNVA 3VKGA 2RGXA 1SKYE 4A92A 2AD5A 3MWKA 4LHXA 2ZS9A 4TYQA 3CKLA 3RLFA 2ZITA 5FPSA 1FPMA 2B8TA 4NE2A 2PBRA 3PEWA 2ODNA 4XH9B 5G53C 2CVFA 2HLDA 2DFKB 1ZUHA 1Z5ZA 4ZCLA 3W6NA 4DZZA 1VG9B 2J0SA 2W2TA 2ZRJA 1NMYA 2C9CA 2H7VA 2NO0A 2ORIA 3NBYC 4MGYR 5G40A 1HY3A 4JVSB 3W8RA 1NMXA 5GVRA 2Q6TA 4QBHA 4EUNA 2LCFA 4P4TA 1OF1A 3LFUA 4IW3B 4BFTA 4BZXA 2MSEB 3EIEA 2G9NA 5DI9A 4W7SA 5F9FA 3SJCA 4QOSA 1J99A 3K70B 3CF0A 2EWWA 4M9ZA 2PX0A 621PA 1R10A 1N5LA 1KI7A 3QKTA 4Y0AA 4DDVA 3U2QA 1GKUB 1KO7A 4DDTA 2V54A 4KBFA 4CEHB 1JQLB 3TQFA 1ZM2A 2XZOA 1E3MA 1QHHA 1O3YA 4DCTA 1Q0UA 2GAOA 4CEIA 4A8JC 1P4SA 4E22A 2HLDD 2H16A 2ZSDA 1Z28A 1XD2B 2BBSA 3HPRA 1KGDA 1RRPA 2GF9A 4U5XA 3U6KA 1YZQA 4GBMA 1OH7A 2XZLA 3NHAA 4AK9A 1IXZA 2G88A 1CLUA 4YXWA 4LPSA 2EQBA 2QU8A 5KYKA 1NLYA 1YZNA 1B23P 4BFVA 3AVQA 3UMSA 4BPBA 4LYHA 4RD1A 5FTLA 2ZUBA 5EE9A 1FTSA 5KNCA 3L8ZA 3QF7A 2R2AA 2BWJA 2VBCA 1E9CA 2EYUA 1U94A 1GDDA 2ZETA 4MKHA 5EE1A 3EC1A 1II8A 4C0SA 4PXAA 4JYCA 1IXRC 3A1TA 2F6RA 3MUFA 1U90A 5JLJA 4ZI2A 1F2TA 2AXNA 4PAQA 1XB2A 2GILA 2VF8A 1TQ2A 2YWGA 1U99A 3FHTA 2C98A 2NO6A 4K81B 5DH9A 3M6AA 2XTZA 2C8VA 4P31A 1ZM7A 1I4DD 1TAGA 1XBTA 4FMCB 2HYIC 4D4LA 4Q4JA 1VCOA 2ZRCA 5H8WA 2JLXA 2JJ1A 3AVVA 4D25A 3M4YA 3QXSA 3AQ4A 2WKRA 4TMXA 4C0HA 1GP2A 2X77A 1D8TA 2E1RA 4NTZA 2ONKA 2JLVA 1OIXA 4YXWD 1W1WA 4HUQA 1UEIA 1HUQA 1ZBDA 2ZSAA 4A6XA 4YMVA 3UG6A 1GNRA 1DS6A 3AEZA 3QIAA 4NMMA 4Q1AA 5TXGA 4A4DA 5JJKA 4PHGA 4LYFA 4C0LA 1H8ED 2QT1A 1G291 2QROA 4XWKA 3I61A 2RGEA 4DB4A 4GI7A 1KO5A 1KI9A 2FE4A 4RD0A 3TIFA 4R9UC 1EXMA 1P73A 1KSHA 1Z0DA 2ZYWX 2ZM5A 1GKYA 4C9BA 1WBBA 1EG7A 1M2OB 4P33A 1SVOA 4R2HA 1KSGA 2RHDA 3N5CA 2D4HA 4Q9KA 4BLSA 3U7FB 4A1FA 4KCGA 5FOSA 3K0FA 1E79A 4HAZA 2Q3MA 4NPHA 4WZ6A 4EFMA 1S3GA 1XD9A 4A15A 3WHKA 2BM0A 3GMTA 2ZI5A 5FTMA 1CRQA 3RSLA 4X8HA 4B2PA 5KDOA 3IILA 2PZEA 4LJ6A 1F2UB 3NWJA 1G6OA 2R6GA 3X2SA 3B1VA 3I4LA 4JZKA 2DWPA 3K8YA 1KY3A 1IXSB 4LBZA 1NJGA 1OJLA 2DHRA 3NKVA 4HLDA 3SNHA 1HT1E 3ICQB 5BXQC 4Q48A 1YU9A 3EWSA 3ZZ0A 1P2SA 4BWYA 3GLGB 2QZ4A 2FPMA 4OL0A 1OXUA 4KODA 2VTKA 1DAIA 2LKDA 4B73A 3LD9A 4OHYA 1E9AA 2HF9A 2VP9A 2OUKA 3BERA 5AUPB 3REGA 2DPXA 4EJSC 4IVPA 4MDFA 2ZVQX 4O3MA 4OI4A 3B1YA 3SS8A 5FTJA 2GEVA 3CZQA 3AM1A 3UPUA 3CF6R 4Q18A 1JPJA 3SHWA 2OLJA 3CW2A 1E79D 5IHPA 2VHQA 3OE7A 2QPOA 5KNBA 5BW8A 2H8KA 3L43A 4EQ6B 1Q21A 1KJYA 1E0AA 5EP1A 3O8BA 3TSZA 3HU3A 3ZD6A 5FPKA 2CJWA 4M8NE 4PC7A 2WSSD 4N3NA 4LHWA 1XJ0A 1N5KA 4TSFA 4Z8XA 4A0RA 3PUXA 1SKQA 1AA9A 2J59A 5J4LA 3EPJA 5K8TA 1YE8A 3B7GA 5CIWA 1OB2A 1EK0A 2CDNA 3U3MA 3LY5A 3PXGA 2ZRBA 1T3LA 1TMKA 1P9NA 1XX6A 3FB4A 3QI2A 4LV8B 1ZU4A 1D9ZA 3EA5A 4TTPA 5CK5A 3UWOA 3BB1A 1KDTA 3GJ3A 5HCNA 1CR1A 2WM9B 3AVYA 4U00A 2GETA 3TH5A 2C03A 3TR5A 2B7CA 2ZI4A 1U0HC 3I8SA 1W47A 5GJCA 3VR4A 2WWYA 2GNOA 3GLFB 1KKLA 5FBVB 1G18A 4LCBA 2D74A 4FXPA 4TT3A 1X8KA 4M4SA 3OE7D 3U4QA 3THWA 3AF1A 1E2NA 4G5QA 3RANA 3U6BA 3U7HB 4TYPA 1IQPA 5HTKA 3I62A 3EXAA 1BS1A 4JKYA 4KFSA 5E4FA 4ASUA 2FFAA 3KQKA 4KVAA
chains in the Genus database with same CATH superfamily
4HNVA 4GXNA 5IAGA 1FU8A 5FTWA 2IUYA 1NF9A 2OCBA 4ZAXA 3LP8A 3CLUC 1MJGM 4ZO8A 4TYYA 1LY1A 4MYTA 2CFOA 5C3UA 3L82B 2PU5A 2JBHA 1A5ZA 2W4MA 1VLQA 3CEAA 3F9IA 3O74A 4QDOA 4BVKA 2HO4A 2PKRA 2B5OA 1R0CA 1YRLA 3C5HA 3EVCA 1FMLA 4R3WA 3ULKA 4CJXA 2D2IA 3EODA 4DYHA 1L8QA 3JQ7A 1AQUA 3DMNA 3ZZMA 2PKEA 2REQB 4RM3A 2C7VA 5C7IO 1K6IA 1QE5A 3DVAA 3QEAZ 3RIHA 5ALOA 3ZE9A 3EGDA 5GWXA 2PH5A 1G8HA 2OWEA 5CX1A 5EY5B 3A1CA 1CULC 3IIIA 3NHKA 5JLAA 1GVNB 2PYDA 4MR7A 4OV6B 1CDDA 1CVRA 3WJ2A 2DBVO 1YCGA 3VR4D 4CI0B 3VKVA 5KKCA 3ZDAA 1XQ1A 2CEAA 2J7KA 1TVKA 5I9TA 3WHLA 1A8PA 1IRIA 4BTVA 1XP5A 5HQ3B 1WXQA 3N2NA 3GOQA 5H70A 3RU3A 1ORVA 4PICA 4TXHA 4MRVA 1KC3A 9MHTA 2FRXA 5HIKA 2OXCA 1U7TA 4KXFB 3NC1C 1IL0A 3D7KA 3H4MA 2XKBA 1JJ7A 2V7GA 5AVOA 5DP2A 4KO4S 1OAOA 2OCLA 1AKUA 1M33A 3FSEA 2HZBA 4POAA 4TS3A 1ZITA 5AI5A 2CL7X 2EJVA 5C7OO 1EUDA 1GPNA 3RFXA 4WBNF 2OT3B 3DOFA 3WFZA 2GAFA 1Q22A 2CXRA 2BE9A 3FBGA 5DFAA 3RS0A 3ADKA 4MOUA 2YMMA 2ZJ1A 4M98A 4P4SB 3RTCA 4PFJA 2XMGA 3SHFA 3KYDA 3T54A 1LK7A 5JBQA 4DJEC 3F49S 4E5SA 3HDYA 2Q1UA 4EG8A 3L06A 2IPXA 2W9XA 4FMPA 4XB1A 4DIOA 4IDOA 3NIDB 1DAEA 1I4EB 2HY7A 4I4ZA 1WJGA 2JVJA 4JJFA 1SY7A 4M0LA 3OZXA 1I30A 5A4JA 4XPIA 5F2EA 4BX0A 1RHUA 2OKCA 4BB6A 5KSWB 3CA8A 4NV1A 1VIAA 4W5JA 4KFUA 2ZZMA 4UE3S 3JZDA 4P5PA 5CFOA 5I9LA 1AIPA 2O06A 2XECA 3O83A 1SXJE 3CRW1 5A3VA 2J46A 2DR3A 2QLJA 3FM9A 2I1VB 4MW9A 3EFBA 2V58A 3NHRA 1KIMA 3GDGA 4HDCA 4PZZA 1JKMA 1UFRA 1R74A 1WNFA 3VSEA 3BMQA 4DLAA 4FFNA 1D7AA 2Q5IA 1NE7A 3KR0A 3NUQA 3AHHA 5HRUA 1XMIA 2AKAB 3KTFA 1N0IA 4D9IA 1LJUA 2F4VB 3L0OA 3DF7A 3VTFA 1R0RE 4W7HA 1QOPB 4XYLA 2BGWA 1O7JA 3V1MA 3SPXA 4G01B 3N2IA 4IV0A 5JDIC 1ZNYA 1U0NA 2XUHA 4FB5A 4MHTA 1FA9A 1XKTA 4BN5A 3BHIA 1XO1A 3HV0A 3A7DA 4MJ7A 3DL0A 3WLQA 4MR9B 1ZSVA 1G8MA 4KBGA 4XEHA 1YDWA 3H0CA 4X1KB 4LHYA 3DFFA 1DKPA 1PQPA 1J25A 1GL6A 2ZSHA 4IMJB 4UCFA 1RTTA 2A0YA 2LGJA 3BMXA 1DCMA 4FFWA 1VE7A 2KI5A 1GGMA 4FD2A 1ZDMA 3GLIA 4F96A 2AKEA 1X80B 3ML1A 5K6AC 4ER3A 3IP5A 3GXOA 2MMGA 1EHIA 3O21A 1SUIA 2IUUA 3RS2A 3H2SA 2JJ2A 2C4UA 2OCGA 2J9FA 3GGGA 3OESA 1P1HA 3GNTA 4OUDB 3KVYA 4CPDA 3HKDB 1KOGA 3PRJA 5C31A 1U1EA 2HPAA 2ZBUA 4FKZA 4GX0A 2OHIA 7REQA 2DLNA 3HJBA 3SJUA 3GIDA 4YMTA 4XLZA 3KTAB 4F06A 4OKIA 4BKUA 1U31A 1T6NA 2IWHA 4MKIA 4UEOA 1PGJA 2BF7A 4LOKA 3HEBA 3AY3A 4MVJF 3AR6A 1Z2EA 1ZCFA 2WTXA 3QUSA 5FJJA 1KE2A 3KOYA 1CIPA 3D3WA 4CV2A 1FLDA 1NJ6A 1THTA 2H1OA 2XYVA 1WDTA 3L3BA 2C3MA 2D7CA 5CNIA 2IY7A 4B4KA 5FTNA 1ZW6A 5J59A 3ZVNA 5HP4A 3G2QA 1TC2A 3VJKA 4J49A 1SK8A 3U3ZA 2WF5A 4MV6A 4HI0E 1DEKA 2XZPA 2IH2A 4KMSA 4AJ2A 5DNCA 1N78A 3VAYA 3KOMA 4FYWA 2EHDA 4PRKA 4V1CI 1NVUQ 5LYJB 4Z4GA 3GRZA 3OMXA 4OHBA 3WLLA 4WCFC 1KJJA 2HGSA 3NZEA 3ITKA 3PQ4A 3TLZA 5AW7A 2VCYA 2ZULA 3DB1A 3MD9A 1LVHA 1QHHB 3PFCA 2JGDB 2P2YA 5FBKA 1USWA 3VU0A 2JCSA 1E7SA 2R11A 3IP9A 1RXVA 2NNWB 4TL8A 3AUSA 1EXNA 2F00A 1A9YA 2UUBB 4II7A 5AJTA 3W5JA 1C29B 2I7VA 1V39A 2YCBA 1SVKA 3HYLA 1NDQA 2ZUVA 2WIFA 1N2CB 2JJ8A 2XQKA 1JR4A 1L7DA 3GUVA 3TZEA 2NO1A 4B79A 1AM4D 3FMIA 4IIFA 1O03A 2YFKA 4BNXA 4E2WA 5JROA 2QM8A 1S7CA 3CT6A 3UFBA 4PQRA 3ZIAA 4JB8A 1XPRA 4U02A 2PUDA 5EHIA 5E6SA 3VBCA 1Y81A 1NBEA 3BN3A 5J4HA 2W58A 1N6RA 1F8XA 4JITA 2PGLA 1SCQA 1Z6YA 2GJSA 2QTBA 3IUPA 2JCVA 4LRSB 4LXTA 3N6VA 5I7UA 5KTPA 4Z86A 3WR5A 3SE0A 3B6KA 1XK6A 2C59A 4M7WA 4N5DA 3K0HA 2P1DA 5EGSA 2R751 4WNYA 3EQ8A 5FYDA 2C4VA 4ZDKA 1ADCA 5A62A 3EPLA 1VL8A 1YRAA 1BG6A 4MDHA 1TJPB 1ND5A 5FNVB 5KWIA 5AVUA 3FKJA 1USIA 2MSCB 3LOUA 4M1KA 1E7MA 4FGSA 4PQGA 3WRVA 1SU6A 3FI9A 4KN8A 2GPNA 2YJ6A 2Q1WA 3P0RA 4YIHA 1LD3A 2VDPB 1Y80A 4BVAA 1W5SA 4MI1A 2H7YA 2YIVX 1LSJA 2GN1A 1ISRA 3Q11A 3ZY6A 1W581 1FSFA 4PGMA 2B20A 3AF2A 3LHKA 4LXGA 3EGXB 2J1LA 3GA5A 1X3LA 4MTCA 4LIPD 3AM4A 2VP6A 2WFZA 4J90A 3ZGXA 1S1CA 4ITUA 2Q3LA 4CLRA 4Y1RB 3IDOA 4DCVA 4F71A 3R9XA 5BPHA 2IS6A 3GDFA 3TVDA 4FHDA 4K9QA 3OJLA 3HJNA 1NZJA 4L0DA 2ZJBA 5B7GA 2HSDA 4ZEWA 1T9ZA 4YALA 2GASA 2ZB7A 3KO8A 1YQ9A 4ZCMA 1CXZA 1OZHA 5HF6A 4G5HA 3P9IA 4TN1A 3I2IA 4JUIA 1G63A 2Z98A 4I1RA 2J0EA 3UAXA 3QE2A 3PGLA 4GMKA 1NULA 5GM2A 4CMGA 3NHMA 5KEIA 4IS2A 2Z09A 3ZVRA 3CVWA 3K6SA 1Z63A 1YBAA 2V7XA 4QEDA 4WEQA 1ZJYA 2J9YB 3IBYA 5KTNA 1AKNA 1J1IA 3SXJA 3ZHXA 1QP4A 2I3DA 1CDOA 4FM9A 3B8HA 4KPYA 3C0KA 3G5UA 5EKSA 1R8YA 4D3FA 3ADDA 3P0FA 1HT2E 2A6PA 2FMUA 1ISIA 3WB9A 1FVFA 1M2GA 2QV0A 3RSZA 4WQMA 1Y4AE 4QDXA 2WT4A 3GARA 3RABA 3DWEX 4PAMA 1JHQA 3BRWA 2R1TB 4DMMA 3L4JA 3TI9A 1J2TA 4AF7A 2EEPA 2OBLA 1KDPA 4I52A 4KR6A 3E9CA 5EHQA 3V8PA 1RHQA 3K1JA 1E9FA 3PI7A 1M1NA 1NUHA 5KCZA 3BIJA 3TOZA 1YR6A 1I32A 3K9WA 1KJWA 3GEIA 1PDVA 1XNJA 3GH3A 1JA0A 1VKRA 4JGGA 4KN9S 1N7JA 3SBOA 3HJUA 4MHOA 5CEFA 4RULA 1IN8A 1YL6A 4ZVNA 3HXTA 2WHRA 3PWZA 4D2IA 5JFTA 4GKKB 2PT7A 4F56A 3IR5A 1ZD9A 4PXSA 1FFEA 2JAUA 1R9NA 3ADPA 3Q1LA 2W4QA 1VE6A 2OP1A 3MINB 1FDSA 2ZBVA 5EJAA 2DWOA 3U37A 3Q6MA 5C5EA 4NU0A 4FDMA 4OQMA 4LXXA 2H06A 3T41A 4UU1A 3IAM6 1CR2A 1TGYA 2EFCB 2IITA 4ZRMA 5K5EA 2XDWA 1SBYA 1Z6AA 2PTGA 3A3OA 1A9TA 4F46A 4LPKA 5L3QA 1TCAA 3ECSA 3R9TA 3QF4B 1LTQA 3EAGA 2EGUA 2WNIA 2Z4RA 3FJ1A 4J4BA 5KTSA 4NQRA 1N3LA 1RIFA 2I1LA 2XJ9A 4RANA 1QBKC 5A1TA 5I3ZA 2PXHA 3N8IA 4PYOA 3RG2A 3HSKA 2XUOA 2HA6A 1RRGA 4P2BA 1R64A 3L8EA 3HZOA 2CJWB 1ECBA 1CNFA 4MS3B 2BLLA 4CIDA 3SQLA 2C1XA 3AI1A 3ETJA 3CUVA 4INAA 1DT3A 1V37A 3GBSA 1AB5A 2R5NA 4Y9UA 1JFRA 1PFKA 1DMRA 1N2BA 2NT4A 3IGFA 3GQVA 3HDVA 1JG7A 4BVBA 1Z13A 1PLJA 2HM7A 3AI2A 4OLQA 1T5SA 1FX1A 1LRJA 1E61A 1OBVA 1US8A 4DSUA 1F0YA 2JGIA 4TLBA 1UDCA 3WKEA 4UAJA 2QJTA 2ESRA 3N9IA 2I4OA 1C1XB 2G83A 1LDGA 2VRCD 1GN8A 4BNIA 1WD7A 1DTEA 1PR6A 4OYHA 1XNHA 2V4UA 3AP1A 3IUNA 4CQMA 1HDCA 5ITWA 4Q1FA 3ZCSA 4UEKA 1EGVB 4QFBA 3ZTWA 4YYZA 3CCFA 4XUCA 1Y5LA 4C14A 5KTTA 2ZSBA 2VHJA 3O9ZA 1JPVA 3FMPB 2Z4SA 4OP3A 5AI0A 4J2HA 4JFRA 4R9VA 2QN1A 1UMKA 1YZLA 3K4HA 4GXQA 4ZT7A 2QD2A 2QYHA 4ZZ1A 4RETA 1AD2A 2PDAA 1JEYA 1PD1A 4GOLD 2G1PA 1J0EA 4TMYA 2ISQA 3NOXA 5HDBB 3HFGA 2N1MA 2LCQA 4JNCA 2JBAB 4UNNA 4Z4QA 3NKLA 1DDOA 3W9SA 1BXKA 1EFPA 1P4RA 1CUUA 1DEAA 3LOQA 3REQA 4F72A 1CQIA 5C1BA 4BO3A 3ZGLA 3AOEA 4H27A 4U3JB 3OEEA 4A0FA 4OG1A 1JYEA 2KMLA 2DXIA 4D79A 4MK4A 1VBMA 4CW7A 1CB0A 1RKBA 2R87A 5F2OA 1EVKA 2BGJA 4ZEMA 4OHFA 1M0SA 2Z1MA 3O1IC 4J03A 5DI3B 2D2VA 3S29A 5I5GA 4AN1A 2GUGA 4P32A 4MQFA 3VC1A 1GZ4A 4ZIRA 5CYOA 1PG2A 3A6FA 4PSDA 3THYB 5AVVA 2AN9A 3SYLA 2Q27A 2YX1A 3OJCA 4PSUA 1R0BA 2QLLA 5BR1A 3THSA 3WICA 2HU7A 2WVAA 1KYZA 3HGTA 2XOXA 1RXUA 3QPWA 4OHUA 4YRQA 1YJ5A 1ZNZA 3UFXA 4MIEA 3TMKA 4B81A 4ZI2A 3GAAA 2BM1A 2R25B 1SB9A 1VJ5A 3NBUA 1UBFA 2J3DA 3B3FA 4FZ3A 2YXPX 3KB6A 1VMIA 4W1PA 3QVGA 4OHKA 1X39A 3PZBA 4JLNA 4QBGB 4OYYA 4L5IA 5FBLB 1VJRA 2C78A 2MYTA 3CUSA 1KF0A 1KRHA 1C2TA 1IG3A 1SBIA 1SHTX 2J33A 2XHEA 4XDGA 2C7BA 2FJUA 4D0GA 4BQQA 5C5DA 2ZAYA 1H8HD 1E6EA 2ZUCA 1Z4PX 3JQDA 5EP4A 4UHFA 4F4DA 1QANA 1Q6ZA 2IVFA 5E95A 1OKKA 1U8XX 4N4AA 3SMQA 1T5OA 4WY5A 4P83A 4UHBA 4XDZA 3AGQA 4RXUA 4D4IA 2LCIA 2H00A 4AP6A 5KO2A 4PO3X 2VWHA 3AESA 4DABA 1PZHA 1EVZA 4U39A 5G3YA 4DIDA 4DOMA 2PBPA 1KJNA 1KZHA 4D96A 1IK4A 3MTGA 5IC5A 3BBPA 2OQ2A 2AKYA 3IMEA 3LU1A 4FX5A 3RIYA 2E82A 2WPDA 2XODA 1UANA 2WFLA 5EKUA 2R7LA 2HSGA 2J4DA 1WV1A 2IH4A 1UQTA 2IZ0A 2BFFA 1QR6A 4P3XA 3F2IA 1TF5A 1I7DA 3LG2A 2OSBA 2H2HA 4URZR 2IQ5A 4BXOA 3VX4A 4GLJA 1M2VB 3C41J 2VK8A 3QUAA 1Z2DA 4TVBA 2ZT6A 4TKUB 4B76A 3QSYA 1XWIA 1WMAA 2J30A 4KZKA 4Q3KA 3DHYA 1O94C 1U7HA 2IJGX 3NHUA 2ODEA 5BSVA 4E32A 4OK3A 1ORHA 3KJIA 4JEMA 2BHRA 5IJAA 3W4KA 5MN5A 1MJGA 4JEUA 1MEJA 3AETB 3LDFA 3W34A 5EJ7A 1L5OA 3ZGZA 3SI7A 4GD3Q 1NW3A 1RHKA 3BEOA 3TZQA 2SCUA 3NBFA 4LQLA 3RT7A 1IHUA 2K7ZA 4ZPXA 4B45A 4ELSA 1TO2E 1P39A 5J4KA 2ORVA 3IUYA 4R81A 5EMHA 3WO0A 4BYGA 3GJSA 3OQMA 5CB4F 3G0BA 4RKWA 1VZ2A 2ZAMA 3BK2A 1PNVA 4HC4A 4DQKA 3DHWC 2G07A 2QY9A 4IKEA 1CG6A 4QJ3A 2GJ9A 4C4SA 1N7GA 3D81A 3IEPA 3FOZA 4ZCPA 2HX1A 3P5SA 3QM1A 1TT7A 2V5UA 3WL3A 4C0BA 1A5AB 2NVBA 4BMVA 4C4TA 1WP4A 3NTXA 1BXRA 3ZQ4A 3F5DA 3B2QA 3CSUA 5JAHA 2NO7A 1K8RA 1PZMA 2A92A 1JKXA 2YWCA 3T7KA 1YI8A 4RD4A 3KUDA 1TYZA 3FDZB 2A4KA 3JQQA 4FDTA 2D6FA 3NT4A 5F4ZA 1PLLA 1U0LA 1IIRA 2YWXA 2D1RA 1U5BB 1SUBA 1XZHA 2XWBF 5F33A 3TTUA 4V02A 1U3WA 3P7MA 1YB6A 5IRCD 2WTNA 4LDZA 1LFAA 2OPBA 3KS9A 3QVMA 2ZYHA 3DC2A 4RX1A 4LS3A 3KSMA 4LZLA 4BNUA 4COKA 3E3AA 3R7WB 3EH1A 1ONSA 1YIAA 1WHTA 1CCWA 1OX4B 5D3MA 4MW7A 1XZFA 4K9DA 3DLTA 4F5WA 2FDCA 1C4KA 1S3FA 1A8UA 4D6XA 1RE0A 5CIQA 1OTHA 4RJKA 4OXIA 4M54A 1PFQA 5CLGA 4WJLA 1ULZA 5HKOA 2O5EA 3KT6A 1NL3A 4RKRA 1PZFA 4KR2A 4IJWA 5B53A 2QS9A 1E2KA 4IV5A 2MR6A 2FP4B 4CIAA 3F98A 5JSHA 4Q4AA 3QLUA 2RC6A 1T9GS 1YJXA 4AP9A 2JLZA 3FZQA 3N8KA 3KSBC 5FUBA 3JQRA 4R1OA 2AFRA 4WFKA 4UPDA 3BTUA 4KGDA 4DXAA 1XMPA 4DV5B 1K7SN 1W88B 2XXJA 4NOLA 5DHSA 3DMTC 3GR6A 4L4XA 5CBKA 2GHTA 1YUMA 4FFBB 1BX0A 4ILEA 1YQEA 2WUFA 4M1SA 2N75A 1WMFA 4C3OB 2A2ZA 2D5AA 3KZXA 4JUCA 2C20A 5EWJA 2HLHA 1GXSA 4GSYA 2NO5A 3USZA 3W7VA 4DBLC 2Q45A 3LTEA 2W6QA 5REQA 2AUNA 3I9JA 4Q00A 4AJEA 2WPNA 2JIBA 5A02A 3VPHA 5I5EA 5JCOC 4HBZA 1U7XA 1U5AA 2J45A 3BWBA 2FQWA 1SH7A 2ZTHA 3CT4A 3D8HA 2BGUA 3DGEC 1UR5A 1AN0A 1LLUA 4QECA 1JHAA 1MT3A 3WNZA 5KINB 4G81A 1IBCA 1K5GA 4QOJA 3G0CA 2XWSA 3INRA 3L1KA 5HXAA 2G5PA 3ONVA 3TLKA 1LWNA 1E32A 1XEXA 1GITA 2PO5A 2ZJ7A 5DGHA 3KDSE 4RZQA 4CF6A 3MHPA 3FPBA 1I5OA 2EG9A 4KV7A 4Q7KA 1BX1A 1CJSA 3IVXA 1CPYA 5JAMA 3GBPA 1E6KA 2AOTA 2ZU6A 3K53A 4K28A 1KPIA 2RHWA 3A9UA 2R47A 5T6BA 3RLIA 3EMDA 4RHTA 2ENUA 2V8OA 2ZWPA 5AKLA 2JEYA 4PBRA 1Y5MA 2I4LA 4MS1A 4EYEA 5FAXA 2H2DA 2Q6KA 4L0CA 3Q8KA 3K20A 3UJ3X 4I1IA 3M6UA 2JH3A 3TSAA 4C1NA 1K98A 2VXCA 3GJTA 1TW3A 1QXSA 3DL2A 1Z4NA 2AOWA 5SZHB 1SD5A 1SCUA 5DMXA 4DNOA 4N3BA 1HKUA 3AB3A 3OI7A 2I2FA 1RKQA 3KC2A 1FXWF 1TO1E 2B4YA 4RQTA 3SSMA 1NVVQ 2KJQA 1L7XA 4B3TB 2OFWA 4TV9F 2Z8ZA 3NNSA 4Z6KA 2BY4A 3R0XA 4MRMB 4UC0A 1DINA 2OM6A 2VXYA 2A14A 1ETHA 2QUZA 1CZUA 4QUAA 3OE5A 4FTWA 3RO7A 2AXEA 4KXNA 4MA4A 1TUBB 2WE7A 3FCEA 3GEMA 3KR2A 4OK5A 2NV0A 4XX1A 1SEPA 1SRRA 2JGAA 4XD7D 2LE0A 4DSOA 2OZPA 2Q1SA 3DZIA 4Q39A 1HLPA 4UARA 2YV1A 3K9NA 2FWAA 3LL4A 1MVOA 5I47A 1NLUA 3EG5A 2ZCJA 3SWXA 2UXDB 3DOUA 3RNOA 4A6DA 5KC8A 4IIJF 4D8WA 5JNWA 3H7AA 4IDAA 1M75A 3CNHA 3Q88A 3SC3A 1FNCA 1HO3A 3U3OA 3T9DA 1YF3A 4UU8A 5KNBD 3FYDA 2VJYA 1VRVA 1V3VA 2DFPA 4NV0A 1C7QA 4C76A 3FYUC 1GRQA 1UXIA 2Q5LA 1VBFA 1XZDA 2PUEA 2IP2A 3I6BA 3KYIB 1TZBA 4WKCA 5IM4A 3AOGA 2C4TA 1EUYA 2HU8A 4ETIA 3FOCA 3IKJA 1RMYA 1DJNA 2ZYSA 9LDBA 4QGGA 1HQYE 5DBFA 3PNLA 2WIKA 3NS7A 3VI3B 1E66A 3CLTD 4ZTZB 2O8FA 2ODQA 4KR3A 4AJJA 1Z73A 3MG9A 4MVJD 4NZ9A 4A7PA 3IURA 2JFXA 1A0OA 5CDTA 2RGNA 2ZCUA 2OP0A 1ZOOA 3PF9A 4BS9A 2GVDC 4C3UA 4JT2A 5BNZA 1L7PA 1DMSA 1EDBA 2V74B 4LK2A 1E3IA 4E2ZA 1RYZA 2ZJZA 2GO7A 4R68A 3QKSB 4K7JA 5LXTB 1H65A 3ZY4A 3L41A 2HLPA 2V1UA 5DCLA 3PHHA 1NVTA 1K6XA 3BJMA 5A3SA 1KERA 2CLOB 2P9GA 5ABPA 5L6MB 3MTEA 3V33A 4ZDWA 1D2HA 3N87A 5KHAA 3QJ5A 2I3BA 2IHNA 4BQNA 2NXJA 2XUGA 3PFIA 1JDVA 5EUBA 1WHSB 1ZBQA 4I42A 3SEAA 4OQPA 2O7RA 1ZIOA 4TROA 1QRUA 2JLCA 3HO8A 4JJ7A 1ZUNB 2P4UA 3T1QA 2BM9A 2Q2VA 4JBYA 3CWCA 5BT9A 3UATA 2ZAOA 2QLTA 1HYGA 3LQ2A 3OAAD 4WA8A 5IK2D 1Q7GA 5GV8A 1R7RA 3EZNA 1Z5NA 2EKBA 1VRWA 2VDOB 3ANNA 3K5WA 3WRYA 5JZVA 5LD2B 2P4HX 1NUQA 2YVLA 2F3TA 3NHSA 1QPZA 1ZRMA 2P2DA 1L1RA 1ZK4A 3JD4A 1W48A 3TGWA 3UH1A 2XUIA 1E3EA 2AF4C 4LQ4A 4N7RA 3X43A 2BM8A 3U09A 1Z0IA 2ZJYA 4ICIA 1TKBA 4ONEA 4XOIA 5IXSA 2ZUEA 1PJQA 1NXVA 1JU9A 4CFSA 3C3CA 4KJXA 3QPDA 5SICE 2Z5LA 3K2QA 5AKHA 3DFZA 4O29A 1K68A 2ZKIA 1AZLA 3GPBA 4HEJA 5J58A 4MAFA 4RTJA 1IM5A 3M1IA 5HIMA 4NU5A 3U3XA 1UZNA 3T8YA 1DWQA 3UQZA 1KFEB 3FH0A 1L4UA 5AKZA 2W2LA 4BO7A 5BN5B 1SXHA 4WRRA 3UVEA 3W8NA 1U0BB 4JFCA 2E5WA 3OQNA 1N8NA 3WGNA 2IPNA 5CXXA 3LMKA 4XR4A 5ITZB 1M10A 2AMFA 1X74A 2Q3HA 2Y4NA 1XXLA 3H9QA 3IOMA 1DL5A 4ZU2A 4LYGA 3PNOA 4HYEA 1CYDA 3F0TA 4RLSA 2SHKA 3WOVA 5E6RA 3GLFE 2HHHB 4ESVA 3FJOA 3TLEA 2GM3A 5C9ZA 1E7YA 1UZLA 3GU3A 1WQ1R 1IDOA 1W6RA 4XGKA 1RLUA 1F06A 1SC4A 4YASA 3DL4A 1G21B 1MOZA 2XUFA 4WK4B 3IEIA 1WZEA 5FI0B 2PZJA 2X8JA 4DKJA 1WCIB 3ZE6A 4K5QA 3TRKA 4L8WB 5JS6A 3LQ1A 2OD7A 5LOVB 2G5CA 5J2UF 1KFCB 1II9A 2J32A 4WZAE 1O89A 4Q4HB 4ZVLA 2C88A 3P9XA 3VU8A 5JRJA 3JWJA 2ACEA 5AJWA 4B71A 2ZRFA 3U9TA 2ADFA 3EVDA 3EQ9A 1WEHA 3L6CA 2ICAA 4RQUA 2O7NA 2HWKA 3EWNA 2VTVA 3H13A 1Q7RA 4FBGA 4YRCA 2DETA 2XKJE 3SN6A 1Y9EA 2PZLA 1AZWA 1VSUA 3HXKA 3MQ4A 4MTLA 5H59A 3TKYA 1DX6A 1UM8A 2VF4X 4OQFA 3MT9A 3C98A 4I3FA 2YV5A 1J0BA 4FINA 4R2KA 4JI2B 2YJGA 1PZEA 3EMBA 1JEQA 4R98A 2ABWA 2QUKA 3GZ4A 3RT9A 3W7BA 4E15A 1OXMA 4YRGA 5IPFA 3USCS 1XXHB 1OAOC 3U7RA 1Z4MA 1MEEA 3BXPA 4LHSA 2ZS7A 2BMFA 2BGNA 3QVSA 1LBEA 4GI1A 5GTDA 1Z8HA 2FPOA 1TCVA 5IKXA 1Y4UA 2PXXA 3BHJA 3ZWNA 2NMVA 1C7JA 4F5ZA 3UAGA 3RKRA 1M76A 4B9EA 5LN1A 1KAHA 3M0EA 2B92A 4HQ6A 5BN4B 5KNDA 1F4PA 4HS9A 5F77A 4NATA 3WRWA 3H6GA 2VZEA 4MCAA 4E30A 2C2XA 5T8KA 1GL9B 3AJRA 1KJZA 5J40A 3RSGA 4C6TB 1OFIA 3RI3A 3QBVA 2ACKA 1JIUA 4XQ0A 2VTBA 3EDQA 1NOKA 1PJLA 5AI9A 3UKJA 4DWJA 4Z3DA 2WWWA 5HFNA 3FF4A 3BMOB 2QPTA 2BF4A 4Q82A 4JJ4A 4CM4A 3GT0A 2M6SA 4ZQBA 2PJRA 2DFLA 2OZKA 1K66A 3QWHA 4H16A 4CZ2A 4KW7A 1HTTA 4XYEA 4ZI7A 1EGAA 4GPTA 4YRPA 1Q1AA 2QRGA 3M4ZA 5F1OA 5KX5B 2FZ5A 2H1CA 3D6VA 3BXGA 3NM6B 4XVQA 2CUNA 3O94A 2EKQA 4NHEA 1GNVA 1ZN8A 2ZP1A 1P7PA 1U1FA 1ZA1A 3HN2A 3RWMB 1BKDR 4H7HA 4PX9A 1RVDA 2X9QA 3ZVLA 4WZZA 2J0QA 4DWVA 4JELA 1W9MA 4HUTA 3CF4A 4B43A 2C2MA 5JH7B 5JY6A 1ZMOA 2BFWA 4GZMA 4Z9AA 3HR4A 1TB4A 1C0PA 1WB6A 4XM0A 5K8IA 1EH5A 1ULAA 2IP4A 3VU9B 1Z5OA 1CZNA 4FLFA 2FSFA 3ENVA 2QAGB 5F52A 2TMKA 1E1QD 2RHGB 5AIBA 2BP7A 1GT91 2C3UA 4E6EA 5C3MA 3UKOA 1PF7E 5HKKA 1WCWA 2OESA 3N8GA 3RCBA 3PX7A 3MM4A 4R8KA 1ZLXA 4YAUA 2XIQA 3RRJA 1QONA 2BOVA 1GTZA 3ELDA 4LHVA 4CNQA 4DAEA 4XUEA 1FFAA 5ECGC 3MGGA 3IJPA 3NHLA 1YRYE 2G9RA 1LRKA 3AW8A 1KI6B 4U2KA 3I32A 3QU7A 2N1BA 1JJIA 3SLLA 1MRNA 2E0IA 3K0CA 4JBHA 4LF6B 4X1YB 1NNSA 1MLDA 3BFXA 3VMFA 4DLWA 1SPBS 2PL3A 3PJDA 3RSCA 3BTSA 4YUVA 1EFCA 5KAMA 4M8KA 4WBNB 4X71A 3AR3A 3NC0C 3QLEA 2OXEA 3VO2A 4PLVA 2WJ3A 3DHVA 3DO5A 3VVBA 4AJNA 3I73A 3AJ9A 1VECA 3C7TA 4EKEA 4ZO4A 4A2QA 1JAYA 7ABPA 3GLHB 5L7YA 1RRCA 4LKOA 1CS0A 2OFXA 1N4AA 1IUOA 1L5LA 3PPXA 2GWRA 5KYXB 1USKA 4FDUA 3EHDA 4O08A 2W8BB 4DT1A 2RBEA 2E4VA 4BE9A 2V96A 3NM4A 1D8AA 5M3BA 3LWNA 3H2KA 1B2RA 1JWBB 4FX2A 4KSCA 2BJHA 1ABFA 3OHSX 5KJ1A 4LY9A 2IP1A 1U8AA 2JAWA 1KEKA 2FWNA 1XN1A 2G63A 1U8EA 4FEYA 1I36A 5JCZA 1TL7C 4G0NA 3TIGA 3CLRC 3VR5H 1NLMA 1P17A 3BKXA 4KLAA 4Q15A 4GUDA 1Y8QA 2EKPA 1LVUA 2O19A 1BGWA 4AO6A 4P81A 4DTIA 5HYVA 1Z45A 1XRJA 3OX3A 4IQGA 4Z0TA 4XGNA 5CDUA 3OURA 4AX8A 3IH5A 4PN7A 1YR9A 3A37A 4GZLA 5I7RA 1EESA 1Y1TA 2VR1A 1X1CA 5IJWA 4RLQA 3EW9A 4IJVA 3MJ4A 4Y18A 1MABB 3FNBA 1EVQA 1R2QA 2V5AA 4JP1A 2I4RA 4KO8A 3JD3A 3H8SA 4WMLA 3M5DA 1OQAA 3DKKA 1M0WA 1XQXA 3OBBA 4DVJA 5B55A 5MFPA 2ZYDA 4MKRA 4Y6LA 2JD1A 4P5EA 4J75A 1J9ZA 1MOQA 1ZD3A 2IEIA 4GVXA 1KNXA 4UE6A 1MQ9A 1DLJA 3ODPA 3FIUA 4H17A 3DXFA 3WWCA 4JLOA 1GUBA 1K6EA 4HQFA 4LMBA 4YCDA 4J7XA 1SBNE 4K6MA 3I37X 3V42A 3VPDA 4FLEA 4E33A 4E7PA 4B7UA 3SYMA 1R4NA 4EUSA 4YMLA 3UMMA 4KQ6A 2UYOA 1AZTA 3Q41A 2WAMA 4PGGA 1SXJD 3G7NA 4FLMA 3E81A 1JGTA 1UDXA 5ALLA 1YGPA 3WYGA 1DKUA 5LQAA 4P0QB 1PKEA 4JXKA 4M7PA 5EYPB 1X8JA 1SD2A 4DA7A 2ANBA 3AXSA 3L8JA 3PHBE 4D9GA 4I1SA 4NS4A 2GM9A 4UHHA 2BCEA 4DCJA 5CVJA 3MLEA 4MULA 1RQPA 3NDJA 2BKAA 3MW8A 5IAAA 5ER9A 4FCCA 1EZ4A 1ZCAA 1M1XB 4GH5A 4HG2A 2RJ3A 4XWAA 2BFDB 3JQAA 5LXTF 1LK0A 4DCOA 4HWKA 4MR8B 4LY0A 1JLKA 2A7QA 3HDTA 3PLRA 2C82A 4K40A 2OBMA 5KKNB 1E0SA 3CXRA 1G64A 1X7DA 1AUVA 2H2AA 1EP1B 2I1WA 3KPVA 1WCXA 4F3NA 5G1NA 1MXHA 2DC1A 3HU2A 3B6MA 2CNOA 3QXHA 3UJDA 1RADA 5E3IA 2B1RA 1KGSA 3THXB 3FUCA 3ME5A 4NY1A 1L5VA 4UHJA 3VSCA 4PZDA 5CH3A 3VNSA 3LIPA 1W34A 2FSUA 2SKEA 4DJ5X 1LDYA 1CZOA 4H3VA 4LYJA 4BNKA 1U3VA 4X8OA 2A0FA 3N3BC 3OX4A 5D84A 5I3CA 1B7GO 3IE1A 1SOUA 3RS9A 1SUWA 4HAXA 2ASVA 1V2HE 3CTMA 3ITNA 4LGVA 3QEOA 4MUEA 2J48A 2E7ZA 3KJZA 3FRHA 4I9GA 4XWWA 3FOFC 4TKLA 3TVYA 1LSOA 1XLVA 3KZMA 4POOA 5CRIA 3SX4A 2INGX 3FSRA 4L6CA 3ND5A 2QHXA 3PUKA 3PNBA 1ZCJA 4A8JA 4ZHQB 1A5TA 3HCAA 1H5NA 4RW0A 4DARA 1Q1BA 1QYRA 1DQRA 3DNFA 1XR3A 3MT0A 4ITVA 4MUBA 3G8CA 3GJZA 5DB4A 3UMRA 3PR1A 3OCWA 4UCQA 4WBSA 1E6MA 1QCCA 1ZMRA 2BFNA 2HMTA 1GLGA 3HPQA 3V8QA 2EP8A 1JLHA 3L0SA 3WGYA 5HMMA 3EVFA 4F47A 1AXGA 3RVPA 1CZRA 1GG9A 4M99A 1ISMA 1CUGA 1A98A 4BLOA 4L50A 1H93A 2AOVA 3KYBA 1FW6A 2UV8A 4MGHA 1AK9A 3C3JA 1BQ4A 2HA0A 2RIRA 2QXUA 3K1TA 4DV0B 2HQSA 5LUBA 5DIZA 2R1VA 3ZE8A 1PEDA 4JYBA 1CV2A 1UKZA 3OU7A 1B26A 4AY2A 1VLZA 2F9LA 3ABRB 4D3SA 1L7EA 1YFLA 1H2HA 4M83A 2WKQA 2ZRLA 3KP1A 4RVSA 4HVCA 6CHYA 5CDGA 4YV2A 3L0YA 1OHHD 2Q0SA 3I01A 4OQYA 2YMQA 4MWEA 1S8AA 4CMJA 3ESRA 2NVUB 3BXOA 2O8EB 4EY5A 3R3HA 1KNQA 2V3VA 3I9OA 4K26A 3LCRA 3CSDA 3ZCPA 1OIWA 4ZWNA 4DMGA 3ZK9A 3F7MA 2ZIXA 3QPCA 4V38A 3M4JA 4JLSA 5EIOA 4WOKA 3TINA 1XEWX 5I8WA 1GZ3A 3GAFA 3RK1A 2WOJA 3L4BC 4BEJA 5TY0A 2PH1A 1PU2A 3FFBA 1R00A 3CR3C 3D5EA 3KTAA 5AYVA 3ZY2A 3S8YA 3QOFA 3GHYA 3HN6A 4P22A 1IVSA 4BGVA 1FUKA 1X7XA 1ACLA 1SXPA 3FSJX 1H3FA 2IEBA 5FOTA 1O8CA 3NM5A 4BDSA 4KZPA 3DTVA 5I6DA 3GJ4A 3HABA 4HH0A 1HE5A 4KX5A 1XNRB 2YXBA 3K8QA 3BVPA 3I9KA 1TVEA 3HRIA 1ABEA 2E37A 4P84A 1U8YA 3SSNA 4RK1A 2WG1A 2L42A 4GZ6A 1KMCA 4X1IB 1KZ1A 1P3DA 4EY4A 2WWVD 3WSVA 2Y27A 1NHGA 4TSRA 1GG8A 1E99A 1NYTA 3VDRA 1SUFA 3H9EO 5P21A 2HSWA 5B1DA 5FOQA 2M6LA 3NQ41 2ZZNA 1CRZA 3EN0A 3RUEA 1MUUA 1CDZA 1C3JA 4RAQA 2XUKA 2FWMX 4CGYA 1ITZA 3JQPA 4RDIA 1ZH2A 2QN8A 2IPAB 4PC1A 3TFOA 2J6BA 2AHOA 1S0UA 1Y3CE 2OAP1 3BSFA 1F9AA 1TM2A 2PTHA 3T9BA 3LWBA 5F23A 4DDUA 5FAKA 4FS3A 1EUCA 3E3LA 2OOSA 2FRDA 2AMYA 1GSAA 3C7CB 4CU5A 4RTMA 3AOEC 3STWA 2BAGA 3QKUA 5G4KB 3C6BA 1NW4A 3N05A 4BVGA 5ICEA 4MB0A 3IP8A 5FWXB 3AF6A 4FZWA 4TT8A 1PJ2A 2H2WA 1UDAA 4OHMA 5ALFA 2W6PA 2ZIEA 4RF3A 1OE0A 3DE7X 1R0XA 3HVIA 4K9LA 3R4VA