3A4LA

Crystal structure of archaeal o-phosphoseryl-trna(sec) kinase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
250
structure length
236
Chain Sequence
DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a tRNA-dependent kinase essential for selenocysteine decoding
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 99
structure length 236
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3a4lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a4lA01
3IIJA 1NJFA 1NNEA 4LBYA 1N6LA 6Q21A 5H8WA 4AKGA 4OQLA 4C4PA 1I2DA 1Z29A 1OFIA 3G5UA 4I1SA 2WTUA 1T3SA 1U9IA 3T5GA 2YC4C 3EARA 4ZIRB 1JR3A 3TGPA 4MGIR 2ZSEA 1KZGB 4CIDA 3K1JA 4XIGS 1DAFA 3L8YA 3T1VA 2A7QA 2C77A 2OAP1 3I8SA 4NZYA 2BBSA 5DI3B 1G3IA 4BLRA 3UWKA 1RFLA 4UQOA 2F1JA 1MV5A 2H92A 2C95A 3D3QA 5DI9A 4A6PA 4HLDA 3MFYA 1M1YE 1DAHA 1W36B 2ECKA 2OFOA 4DXAA 4B73A 1PZNA 5JCPA 4HAXA 3U4QB 3BWDD 1JALA 1E0KA 3LY5A 4G5RA 5KSOA 2QL6A 1GL6A 3TE6A 2P65A 1J70A 3TQFA 2F55A 1ZVQA 4Q4LA 2VO1A 5JSZB 3PFIA 1BOFA 4JYBA 3FKSD 4B3FX 3PUYA 2GXAA 4OI1A 3B85A 4BZQA 1YR9A 4DCTA 3R9XA 3IKJA 3LBIA 5BW8A 1TPZA 3IQXA 1VIYA 1XMIA 4DLTA 2ZRJA 3GFOA 2WBLC 1OFUX 2D62A 1W4AA 2AFIE 1DADA 2WJGA 4KCGA 4KSCA 4OJKA 4UNRA 1ZNYA 2WOJA 4KLNA 4AKHA 2XTMA 4RD0A 3KQLA 1UJ2A 2R6FA 2HXYA 4GZLA 2Z6VA 4EPWA 1Q12A 4BE7B 5JFGA 2F6RA 1Q3HA 3KXLA 1JI0A 4M1TA 1E6CA 4B43A 1KDOA 5EP1A 1Z08A 5AUPB 4OK3A 1ZMXA 3OIUA 1KO4A 5HTKA 3GFTA 3X1ZA 1N6PA 2OO7A 5DYIA 5F3WB 1G5TA 2UVQA 2XNDA 3S1AA 2GDJA 1C1YA 1U90A 1ZUIA 2JJ1D 2P6UA 3K8YA 3BBPA 1ZIPA 1Z47A 2NGRA 2E87A 2AD1A 4Q48A 3IEUA 2J0VA 4NTZA 1DARA 1UFQA 2EQBA 5JWHA 3DHWC 2OCYC 4DIEA 4LHZA 3GJ8A 3CPEA 4M1MA 3PR1A 2ODWA 4BLQA 3WMEA 2QT1A 4GOJA 5DO9A 4ZDKA 4LGMA 3F8TA 3Q72A 2IWHA 2OFXA 1NMZA 3U44A 1KI6B 3GLHE 1HTWA 4MYCA 5SZJA 2NO0A 3N2EA 3B60A 2HYIC 1DS6A 4YDSA 3BE4A 2O8FA 2CJWB 3DO6A 2YHSA 4TMZA 2MSEB 4WA7A 3RAPR 5FPKA 1UM8A 2ZI9A 3LX8A 4CT4B 2CHGA 4R7ZA 4M1YA 4LCBA 5F98A 4G01B 2QAJA 4Q1BA 4DUGD 3K0EA 3GLGA 3AUXA 3MLEA 4F93B 2VA8A 1NY5A 3B1XA 3BFVA 3DDCA 1LB1B 5E4FA 2EU8A 4NCNA 1E2KA 1QG2A 1T9HA 2JIZD 2NOAA 4JL8A 4P4TA 4ZI2A 1Z28A 3MCAA 4EJSA 3GEHA 3EC2A 4D0NA 1SVLA 2WAYA 4TTPA 1XPRA 2QRNA 3U3RA 1GWNA 3I73A 2VF8A 3UIEA 4PO1A 1L4YA 2R8RA 1RJ9B 4RSGA 4UKDA 3IO3A 2Z0MA 4Q66C 5JEDA 1W2GA 2Q3MA 3FFAA 2GTPA 1NP6A 2YC2C 1XFAA 1OXSC 4QHTA 2ZR0A 2D7DA 3E70C 2CL0X 2CNWD 3SFZA 4US2R 3NEYA 2DY1A 4LHVA 3UMSA 1KOFA 4JLAA 2NPIA 1UBFA 1SHZA 5JECA 3FHOA 4PO9A 2O5VA 4D4JA 1E4VA 2JAQA 3RDPA 1QHHA 3R8FA 3G82C 4C30A 3K0AA 3LBNA 3X1DA 3NTUA 5IHPA 4PC7A 1NVVR 2VHQA 4NCJA 3KB1A 4FINA 1US8A 2KBFA 2Q9CA 4TLCA 3ASYA 3MAAC 3QIAA 4KFSA 3RS5A 3U3KA 3ZS9A 4NCIA 3TAHA 1L7VC 2VSOA 3AF1A 1W4CA 3THXA 1Z3IX 1KI2A 3HR7A 2R62A 3ADBA 2HT1A 4M22A 4D6PA 4UNNA 3P20A 2IYRA 2OHFA 5UKDA 1U0LA 1M7BA 4HAVA 2G0TA 4M21A 1SZPA 2J7PA 3GEEA 4E09A 4HB0A 4XSHA 2FFHA 4TLBA 5EE5B 1RYFA 3UMRA 1WBDA 3REGA 1GNRA 1DAGA 1EX7A 3TIFA 1WQ1R 4RD3A 4ZCIA 4V0MA 1JNYA 5JWRA 5SZHB 3G0HA 2VF7A 3RRYA 1G8YA 2A2ZA 2EWVA 1MOZA 2ZU0C 5H68A 1NLYA 1S8FA 2OLJA 3AH8A 2ZYUX 2CK3D 4TLDA 4UJ3A 3BOSA 4CDGA 4FMCF 121PA 4IFEA 1D9XA 1E9DA 2V6JA 5FBRB 3H0KA 5LD2B 5CLLA 2PLFA 3WP1B 3TVTA 3R7WB 1R8QA 2L0XA 1OFHA 4Q4AB 3K0FB 2RCNA 1P9NA 3VKGA 2KSQA 3KKNA 2XJ9A 2CDNA 4JJZA 1FUUA 2UZIR 1W0JD 2F3RA 1XF9A 3DMNA 1X8LA 4TL6A 4TSFD 4QKQA 1K6MA 2P0EA 2QAGC 4P4UA 3SOPA 2CK3A 3SR0A 5B30A 5BYKA 1VECA 5JHHB 1WRBA 4X8OA 3AUYA 3VU9A 1JAHA 2FG5A 2OEPA 2VHUA 1MO6A 4UNQA 1Z06A 4RKFA 4WXPA 4DT1B 1COWD 1GL7A 5SZKB 2WSMA 3T5DA 2OILA 2Q6TA 1N3BA 3EIEA 2VRWA 2BEKA 3HYRA 2EFCB 1OV4A 4ZDJA 1NSFA 1DG3A 3U7FB 3JZAA 1QHNA 2BHRA 1JJVA 2H5EA 4MRVA 4G1UC 5CK5A 3I5XA 4PTLA 3R8CA 2D4HA 1MT0A 4KO8A 1VG1A 4XSGA 5EUMA 2GBLA 5K8TA 3GLGB 1T0JB 5KTYA 1EFCA 1UF9A 3RYTC 1ZAKA 2NTYC 1G8HA 1TQDA 2C8VA 4TL9A 3GJXC 1G7TA 1E9EA 4KFRA 3CRQA 1Z6AA 3EPLA 4NYIR 2PEZA 2I3BA 4QBHA 1LF0A 3A1TA 2JLUA 1G20E 1AZSC 3PIRA 4DUGA 1RKBA 3QBTA 1ESMA 1UKEA 5GADl 3EPKA 2J7KA 3AVVA 3V9PA 4FIDA 1G17A 2GEVA 4LRWA 2IL1A 1U0JA 2AHOA 2DPXA 2MSCB 3P4XA 2ZRHA 2FSHA 1U8ZA 5EE9A 1YRAA 4BFTA 3MG9A 2PJZA 4M1OA 3WMGA 1DOAA 1N6RA 1RRGA 4BASA 1E1RA 3NBZC 2ZUCA 4G5OA 1X1SA 3GCGA 3BB3A 3QXSA 1R6BX 4MKGA 2XNSA 2GRJA 4URUR 4U7DA 1XEXB 4F38A 5P21A 2CEAA 2ZU6A 3A4MA 1G8GA 2AL7A 2BWJA 3ONWA 3OIWA 4QBGB 5GJCA 3WNBA 5E7MA 3EPJA 3QXXA 4PPNA 1EWRA 1ZBDA 2NO7A 3U3JA 3C5HA 3BH0A 3HU2A 5A5GA 721PA 3IIMA 2OM2A 2EVWX 2GWHA 4L15A 2LKDA 2GXQA 4CEJA 3QPWA 2MSDB 1GRRA 2PZEA 3CNNA 4L16A 2BBOA 2ZE8A 4EPXA 4Q4HB 3A1VA 2JDID 1FMLA 5DH9A 1NBME 4MRRA 4POAA 2ATVA 4YC7A 4C9BA 1GAJA 1IXSB 1OIXA 2ZREA 4P4SB 1ZNZA 1ETUA 5JCZA 1XD2B 2XEXA 3PCRB 1FNNA 3LO5A 3GP8A 2WJIA 3AB3A 3T35A 2NQ2C 4HZUB 4X8LA 2WMNB 4OQXA 4KYUA 1R4AA 2BMEA 3QXHA 5TARA 1OLOA 2GJ8A 4JBWA 5AUNB 4V0NA 1G41A 4JLDA 2O0KA 4O2RA 2FEMA 4QBFA 3GLHA 5TY0A 4DWJA 4Q4HA 4GOXA 1NVUQ 4QG7A 2QP9X 4TMTA 1P72A 1XMSA 4ZO4A 3VR2A 2FGKA 4B35A 1E2FA 1RC8A 2BEJA 2CE2X 1LV7A 1ZM9A 4KYIB 3QXJA 1ELOA 3VQTA 3IUYA 5HKKD 3BORA 2IBMA 2E1RA 2OCAA 1G19A 4NYMQ 4Q9LA 4MITA 5HKKA 4HLUC 4EQ6A 1RRPA 4Q7JB 2HYDA 4M9QA 4B3CA 2NMVA 4QJ4A 4RZ2A 1I4TD 4GMDA 2WKPA 5DN6A 3C16C 2FA9A 2XTNA 1G3UA 2VIIA 4TMVA 1W0JA 2FX3A 1GTVA 3W6NA 2QBYA 3Q85A 2QSYA 1AKYA 1N5KA 2F1IA 4RFSA 3TSOA 1TNDA 1G6OA 4B33A 5KSYA 5D3MB 2QY9A 2W58A 5LB4A 3W6OA 2GVDC 4LBZA 4I1OA 3SDZA 1KO1A 1US8B 4IVPA 1QHSA 3VR4A 3QKTA 4QM6A 2IHYA 4EJSB 1CRQA 2FH5B 1F5NA 5FR1A 3V4FA 2RHDA 4IDHA 4F4CA 2YVUA 2GAOA 2C9CA 2FZ4A 1X86B 3B1YA 4ON9A 3LFUA 3IO5A 5DGXA 1QHHB 4CF7A 1EFTA 5J4LA 2QI9C 1ZD1A 3R7WA 1FW6A 4W9MC 3OF5A 4U00A 1WCV1 3V4RA 4RCYA 1HYQA 1AN0A 2D74A 4IKEA 2W2TA 3E2IA 1DBSA 3ZZ0A 3HJNA 1CULC 2GEDA 2W6JA 3PEYA 3IIKA 3KZ1E 2G3YA 2QROA 1NLZA 2QGNA 1AQYA 2Z4SA 1AS2A 1VDZA 5G41A 4Q01A 4EKDA 2HJVA 4KFTA 1TF2A 2ZJAA 1XPOA 1R2QA 1GNPA 1MO3A 1NN1A 3NH9A 2QQ0A 4TWZA 3QE0A 5GVRA 3SYLA 4KFUA 2BVNA 5L3SA 2D7CA 4ARZA 3QNUA 2BCGY 4ZKEA 2WIAA 2R6GA 1KK3A 2IYUA 1WP9A 2O8EA 2QPTA 3OFNA 4FMCB 1XJ0A 3AV0B 4QC2A 1UKVY 4LJAA 4WAUA 4YMVA 2EYQA 3GLIA 5EP3A 2FF7A 1KHTA 3U3MA 2IT1A 1A82A 2Q3HA 1CJKC 2ZS8A 2OCPA 5EJEA 1OHHD 4RZ3A 2AD5A 1KO8A 2QGZA 1OHHA 3K0SA 3THYA 2YV5A 2B8WA 2ORIA 1Z6TA 2ONJA 4Q7MB 2JLZA 1VG0B 5IK2D 3KTAB 1XU4A 1G4AE 2ORWA 3AGQA 5AUOB 421PA 1E94E 5JEEA 1IN6A 4XVRA 1HT1E 2CHQA 3HPRA 3LD9A 4XVQA 4Q02A 3WRXC 2Z4RA 2AWNA 4Q5IA 4Q1AA 1IN5A 2Q3FA 1XMVA 1NMYA 3LXXA 4RKEA 3D6TB 4R2HA 1J90A 2G6BA 1YZNA 5HCNA 2WWWA 1P3JA 1N6OA 1EWQA 1SKYE 3U3OA 1UBCA 5KPDA 4BFWA 1FOEB 3LA6A 2BMFA 3HPQA 3K9NA 1ZCBA 5FI0B 2CNWA 4PZLA 3FB4A 221PA 3OEHA 2EFHB 3X1YA 1IOZA 3EPHA 4WXRA 4UNPA 5D3QA 3ZVRA 3PEVA 4BLSA 1JB1A 1MRNA 2I1VB 5IT5A 1QVAA 3A4NA 2QE7A 4V03A 1ZP6A 3SJCA 3QXCA 5J4KA 3GLIB 2O0HA 3PVSA 3TSZA 4EPRA 4D4MA 3AQ4A 3AF3A 2R6CA 3M1IA 3CZPA 3B1WA 4QBIA 1EFUA 1N6HA 1E2GA 4GSYA 4E03A 1W0KA 2O8CA 5DLQC 3TW4A 1XTRA 5FBQB 1Q44A 3KTAA 3ZZTA 1XTQA 3WNDA 5JI3E 5KUTA 3QI2A 2C98A 4QRHA 2XSZA 4XJXA 2VLIA 1N0VC 2WVJA 5DSZA 4JBYA 3I5YA 5EXXA 4RFVA 1JPNA 5H1YA 2G88A 3I61A 1RJ9A 2QA5A 1Q21A 1KNXA 1T3LA 1W47A 2CXXA 4OK6A 4PFSA 4JLJA 4AKEA 2H17A 1ZNWA 2IUTA 2ZJ2A 3ZGXA 4JMPA 2A3RA 5JJKA 3GQBA 1P4SA 4DDTA 1Z0IA 1VTKA 3Q5DA 3LRPA 1VHTA 3L0PA 4XOIA 4D4KA 4DZZA 1G291 1NI3A 4MDFA 4ESHA 4JT2A 1IN7A 5L3SB 4AYTA 4PHGA 3QPUA 4GP7A 4PC1A 4MQBA 1E9FA 3A1UA 1Q22A 4PSAA 3WBJA 4CZ2A 3BJIC 2WSSA 1CR4A 5F2EA 3T06B 4NMMA 3I4LA 4DB4A 4CEHA 1G7SA 4Z1MA 1BO6A 4B6EA 4PSKA 1JEDA 2F9LA 3AKDA 4LJ7A 3TVDA 1S9HA 3LH5A 5DN6D 4E22A 4A0HA 4F7WA 2FDCA 4XD7A 2XGJA 2W00A 4Q47A 3H4MA 4CGZA 4BPBA 2RGNA 2FV8A 4XD7D 4U5XA 1Q20A 4DSTA 4M9XA 2YKGA 1N5LA 4JLBA 2JCSA 3M0EA 3RANA 2H57A 4US1R 4YDHB 5DYGA 5AR1A 4FW9A 3EZ6A 4C0KA 2OESA 5HPYB 1HUQA 3PEUA 3ZQ6A 3QQ5A 4JS0A 3RC8A 5L3QA 2HJGA 2WJYA 2ZS7A 1TX4B 3IQWA 5JJLA 1AIPA 4PAOA 2ZSFA 3PXGA 2GHIA 3LDAA 2A5GA 1YE8A 4HLCA 4ILEA 3REFA 2DFLA 2NO9A 1N6IA 1Z5ZA 1QHXA 3AP3A 1PLJA 4JIMA 4TL8A 2WWHA 2UKDA 4Z54A 1GKUB 3FMFA 3RS4A 2XNDD 4A9AA 2ZQ5A 2JLRA 1KJZA 2V8OA 5FPYA 1C9KA 1DAEA 1YZLA 3EWSA 2PT7A 3AVXA 2F1HA 3L0SA 1XMJA 4QFMA 4US0R 2A5YB 5CM8B 1XB2A 1AQUA 3W34A 3LW7A 2ZRIA 2B7BA 2I4IA 2ZUBA 4FMDF 1M6NA 1SKQA 1IQPA 1AJEA 2BJWA 4AK9A 2GJ9A 5LDDC 2PH1A 2B7CA 4OI0A 3SHFA 2PMKA 4TZ6A 3CIOA 4FWIB 2AN9A 3AEZA 4FCWA 2JATA 4QL3A 2FEOA 5EQTA 1Z0JA 1GOTA 3EASA 1KDRA 3AVPA 4B74A 4TTRA 4ACBA 5CITA 1GKYA 4NE2A 2QRZA 5EE1A 4F92B 5FTLA 1O87A 1X8JA 1Z2AA 4B75A 1Q0UA 4IW3B 3DZDA 2VSFA 3VHXA 2PCJA 4LYHA 2O8DA 1T5IA 4Q9KA 1D2NA 1E96A 1P2VA 3SFVA 4RD1A 1M34E 3W6PA 2VP6A 3CF0A 1NN5A 2YWFA 3K9GA 2XX3A 1XRJA 5EXSA 1G7CA 4JLNA 4N3NA 2TMKA 4I1VA 1GITA 3NIBA 2N46A 2ZJ8A 3PJRA 5KDDA 1TL7C 1FQKA 4ZI3A 3MWYW 2J5XA 4XTCS 1A7JA 3MJRA 1D6JA 2V1XA 1NVWQ 3B7GA 2CJWA 3BB4A 5KNBA 1HY3A 2C9YA 2R6DA 1KMHA 1LNZA 2DWPA 3SU8A 4QHYA 4QNRA 3T12A 4V0OA 3VHLB 3T61A 4PO8A 2FMXA 4WIAA 2RGAA 5C18A 1J99A 2V9PA 1R7RA 1IY2A 2LKCA 1KTVA 1P9RA 1Q1BA 1PVOA 2WWXA 3W8NA 4OQFA 4LPKA 3CR8A 1LS1A 4OBEA 3KJIA 5JI2E 2P5TB 1BH2A 2QE7D 2XITA 2KJQA 4ASUD 1AS0A 3F0TA 3OIYA 3K53A 5ANRB 5DNYB 2VEDA 5E7JA 3RHFA 1S3SA 3FPAA 1KI7A 3F5FA 4LJ9A 4DLXA 4X8HA 1G21E 2ZUDA 5JLJA 3GLIE 2GEUA 4AYXA 3SQWA 4IDOA 4PQYA 1KI3A 4LYJA 2BOVA 2GXUA 3CRMA 5CB8A 2KBEA 2CL7X 2ZRAA 3N2IA 3RS2A 4DRZA 4LJ6A 4AYWA 3FDIA 1L4UA 2IX3A 2YNMA 3TMKA 1SVMA 2H1LA 1QDEA 2OV2A 3NXSA 5C2JB 1FPMA 2J7PD 3WY9A 2C96A 3KJHA 3TUZC 2R65A 4QHSA 5SZIA 1E32A 2IEYA 4NBSA 4ZDIA 3K0FA 3OHMA 1S1MA 5FTNA 1PUJA 4BFUA 4WZAE 1UADA 2ZE6A 1CLUA 3L43A 4WOPA 1NL3A 1KI9A 2P6NA 1KI6A 2YWGA 2CVHA 3SBEA 2JASA 3OAAD 2YJTD 4JBXA 3V00A 4B2PA 3ICEA 3LQRA 5FR2A 4KBGA 4FMBB 3OAAA 4X8MA 5FOSA 4ESVA 4EPYA 1G5PA 3QOFA 3QEOA 1OSNA 3BD9A 3DZ8A 3ZH9B 1XCGB 2OSBA 2IYSA 4DLYA 3PQCA 1M7HA 5DIFA 1XWIA 1DAIA 2V4ZA 4Q00A 3C15C 1V5WA 3RSLA 1GIAA 4IVQA 4CRWB 3I32A 1SVIA 3M4YA 1ZU4A 4Z8YA 5KSZA 3FWYA 3CW2A 2V3CC 1QHIA 3C41J 3T1QA 3M6AA 4HUTA 4JYCA 1P61B 3QF4A 4DLUA 1F48A 3TUIC 2C03A 1KZ7B 3UWOA 2HLDD 5TMPA 2GJSA 3AF4A 4NL4H 4V02A 5FTMA 4A36A 2RGDA 3CLVA 4UNSA 1KMHB 1A2BA 2REXB 4A6XA 2QZ4A 1DAMA 1KAGA 1XJCA 3QEJA 4DEYA 1VYUA 3VU9B 5J4YA 5AWFC 2V7QD 1UAAA 4AIIA 1HQCA 1PJRA 1SVWA 4WZ6A 3CBQA 1SVSA 4A2PA 4YMUA 3UANA 1CR2A 4P32A 5DHAA 1XCPA 1BIFA 2NO6A 4OHZA 4RD4A 1OXUA 4PR0A 2ERYA 1GVNB 4KI0A 4A1FA 1KK1A 1YZTA 4IRUB 4BFSA 4TL7A 2WAXA 3SE0A 3ZIAD 4RFSB 3QF7A 4KODA 1VHLA 1RE0A 1Q1QA 3GJ6A 4HAUA 5KNDA 4Z8XA 3FKSA 5BN3A 5ELXA 2XB2A 2X2FA 3P32A 5KDLA 1R8SA 4B2LA 3FKQA 4ZCLA 2PLRA 2F1RA 2X1VA 4DKXA 2VHTA 5CJ2A 3A8TA 3WYFA 2ZJBA 2LCFA 1T4GA 3NDPA 2ZAOA 3KKOA 1I4LD 4URYR 1E2PA 1COWA 4M1WA 5EE3A 3LVRE 5FOXA 1F3OA 3QENA 1TQ2A 1B23P 2ZI3A 3A37A 1ZRHA 1U81A 4MRNA 1VCNA 3DVLA 2ZETA 1ONBA 1N5JA 5EXPA 3LLMA 4OHXA 1P5ZB 1U99A 2ERXA 1KI4A 5A4JA 1KSHA 1D2MA 2ZPTX 1RIFA 4BRUA 3IILA 5CIQA 1XTIA 2W6ID 3CNLA 1QHGA 5JMTA 2XXAA 2K5UA 1T91A 2P2LA 1ZIOA 4OQMA 4Q1EA 2RGXA 2HCBA 4CW7A 4C0HA 1GSIA 2UZ3A 2ASEA 5CDFE 2QP3A 3K70C 4FCVA 2QPOA 4BEBA 5E7IA 4DSUA 3EZ2A 5F9FA 4O3MA 1QRAA 2G1KA 4D81A 1EFRA 4NU0A 4HAYA 4YXWD 1E9SA 3B1VA 2ANCA 1XD8A 4NYJR 2ODEA 1QBKC 2RB4A 4NDZA 4ZKDA 1T5LA 4JLPA 3GJ7A 3QJYA 1S2MA 3RABA 4GMXA 1ZNXA 4C0BA 2PMDA 2VBCA 4M9ZA 2ZI5A 1N5IA 2GNOA 1E2NA 2DB3A 3GEIA 4JKYA 1UKYA 4A4DA 2ORVA 1XEXA 3THWB 3PUXA 4GL2A 1KJWA 2FWRA 4MGKR 2DYKA 5FTJA 5AJVB 5E3HA 2BMDA 3P27A 2FPKA 4DLWA 3OE7D 4GP6A 3U44B 1E79A 1KYIA 2WSSD 2DWQA 3NG1A 2IS2A 4GNKA 3FGNA 2PEYA 1T8UA 1XXHE 1YZQA 3BGWA 2B21A 1R5BA 3QVUA 2QU8A 4AWXA 5L8VA 1QZXA 4LBVA 4MYHA 4NONA 5IF9A 1J7KA 2O8DB 5CB6A 1GDDA 2A9KA 5GJBA 1W2HA 2KI5A 3MD0A 1AK2A 3JVUA 4A15A 2BIFA 1GUAA 1TQ4A 2QM8A 3FYHA 3KJGA 1HE1C 3LNCA 4MH0R 3CNOA 4CVNA 1D8TA 5C4GB 4D82A 1N2CE 2GK7A 2IUUA 5CM9C 1QHYA 5HR5A 4MKIA 3THXB 1R10A 2QEQA 2CLDX 5HE9A 2DFKB 1OIVA 1YQTA 2ZRLA 2ZIAA 1WMSA 3OE7A 2AXNA 5B2ZA 2PT5A 1H8HD 3MWJA 1IN4A 2IEZA 4XVUA 1QG4A 4N0DA 1XTSA 1I4DD 1IJEA 4Q4JB 4LYFA 2O8CB 2GCOA 4NYIQ 1OFTA 4FXPA 4C7OA 3EZ7A 4Y0VA 1A1VA 1ZC4A 1CS4C 4AD8A 1P62B 1TF7A 1W48A 4ZV4A 1IJFA 4A0GA 1SVKA 4HYYA 3IPXA 5DE3A 1LTQA 4C0AC 4TMWA 3DM9B 4Q1CA 3EAQA 2YINC 3NVAA 4V0KA 1S96A 3CUEF 3FMPB 5E95A 3RS7A 2PJRA 3LBHA 2IS1A 1KKLA 2ATXA 1W7AA 5L3VA 4BLTA 3AF2A 4A82A 4C7OB 1R5NA 3C8UA 1JR6A 1CF4A 3H86A 4D4LA 3VTKA 1NN3A 1X1RA 2G83A 3CX7A 2VP5A 3KXKA 2JLVA 2PX3A 3WNCA 1YR8A 4XWOA 3UATA 3EX7C 1GILA 4URWR 5H70A 4L9WA 4GZMA 2AKYA 4W5JA 2ZI4A 3U2QA 2XB4A 3CZQA 1XTJA 1HURA 4LI0A 1BKDR 2QMHA 2W6JD 4HATA 2VYFA 1ZD9A 2QMUA 3GLHB 1ZU5A 3Q3JB 1FX0B 4I81A 3RNLA 4B44A 3CH5A 4IEIA 1E69A 2ZJ5A 1XTKA 4Q1FA 4DIDA 2O8FB 1KGDA 5B64A 3ND8A 3FHCB 2JJ2A 4Q7LA 3QPVA 1XEFA 3NKVA 1VCIA 2NZJA 3RC3A 4BUJA 1WBBA 4IDPA 1ZUNB 2Z83A 4BZPA 1GP2A 4CT5A 2O0JA 2QTHA 2J46A 1GZSA 4AURA 1CEEA 5EZ5A 3K70B 2HCJB 4IXNA 3QKRA 1E2HA 3ADKA 4EJSC 5J4HA 1W5SA 2HUPA 4C0LA 4IHQA 2O52A 3L0IB 4ZCMA 4FWTA 1L2TA 3QKSB 3UKDA 4C0SA 1PUIA 4DCUA 1CU1A 2YOHA 3CRRA 2NO1A 4JVLA 3LV8A 3CM0A 3DMDA 1R0WA 4C3ZA 3OIVA 1E9AA 3RSOA 4D0LB 4PPFA 1KSJA 3SN6A 2R6AA 1G7RA 2RGBA 4AG5A 2GBLC 2PZGA 2VH5R 4HAWA 4TMXA 4EPVA 1WXQA 1GRQA 5AK0A 5K8UA 1G8FA 5FUYA 4PHFA 1TU4A 2BJVA 1LVGA 2AK2A 3SZRA 2IXGA 3CRVA 1KO7A 1YHNA 2QENA 4LC1A 4NKRA 1N0UA 4TT3D 4WBSA 1M8PA 2QMOA 3U6BA 3VR1A 4DT1A 4YONB 2QBYB 3MUFA 2Y8EA 4M53A 2WWIA 4B3XA 1BS1A 1YU9A 5D3MA 2QAGA 4LV5B 2JLWA 5IDVA 3B6EA 3EIQA 1LFDB 3ICQB 3TKLA 3MSXA 1ZINA 3ZVLA 1E1QD 5KDOA 4JJKA 3RRNA 1Z0DA 2BM1A 2WV9A 2IYLD 2W0MA 3C7KA 4QGFA 1OH5A 1MR3F 2ZRDA 5L3RA 2H16A 2H7VA 2AR7A 4IDNA 1FP6A 3EA0A 2GA8A 1BYIA 1TQ6A 2OXRA 2WKQA 5DI3A 5IRCD 4PHHA 1KMQA 1JPJA 5FPSA 2IYYA 2XTZA 3CF6R 3C4JA 3L82B 3WYAA 2V6IA 5KU1A 1E99A 1AKEA 3OEHD 4QJ3A 3NC0C 4PPGA 1OB2A 1SQ5A 3L2OB 1NMXA 1OF1A 2FOLA 3TK1A 1YZUA 2EFEB 2CLSA 2H18A 2P3SA 1YZKA 5FI1B 2IF2A 2VP2A 4I4LA 3PUWA 3MWLA 1OYWA 1J8YF 2YOGA 4EIWA 2CCKA 1H8ED 3A58B 1U8YA 4R2IA 4L5BA 1CTQA 1W0KD 1CKEA 1FNMA 3FMIA 3GFPA 1ANKA 1F60A 4TQ9A 5CDFA 4HAZA 1ZM3A 1CJVC 4LJ5A 5HCIA 4CEIA 3NBYC 2VTKA 4QJ5A 5AJYA 3HP1A 1XD2A 1F2TB 4DSOA 3ASZA 3THWA 2FE4A 1K8RA 3UK6A 5FOUA 5BXQC 1NJGA 2KB0A 4G5GA 4HB2A 3PG5A 1KSGA 2BV3A 2J1LA 1CRPA 1JXOA 3CB4A 4HDOB 3QSYA 4K46A 2P6RA 5EP2A 2NZ8A 3GJ5A 2A5JA 4AG6A 1G18A 5KOYA 4A0FA 3KFVA 5J40A 2BBWA 3ZVMA 1OKKD 4RZUA 2V54A 3E5HA 4HB4A 5KSPA 3JVVA 1MH1A 1FTNA 5LPNA 3K0AB 2GVZC 3WYGA 1B0UA 2VHCA 2WJJA 3B5JA 1A2KC 3DKPA 3TNFA 1XD9A 4C2TA 4S35A 2WICA 2AFHE 2W2XA 1IXZA 4KVGA 5BQ5A 4O25A 3SYNA 3TLXA 3U7EB 2GCPA 5KNCA 3ADCA 3AP2A 2ONKA 3R20A 3CX8A 3NEJA 4XWKA 5FUVA 3BAFA 1E98A 2ZRBA 4R98A 1E9CA 3GJ4A 2QORA 2VP4A 4OHYA 4QOSA 4QM7A 1FQJA 5B58C 1A4RA 4Q9HA 4KSBA 1NVXQ 4ARZB 3T1TA 4GDFA 4D2IA 4GFDA 5CLQA 2VSXA 4IFBA 2HXSA 4ABYA 3RS3A 4OHWA 4I1UA 3FOZA 2HV8A 2QM7A 3MWKA 5GVSA 2ZVQX 1G5RA 2Q9BA 2QPAA 4V0LA 1UEJA 1DTSA 1Z0FA 2CHVA 4AKIA 2MMGA 2YYZA 2IHBA 2ZRNA 3PEWA 1VMAA 4JT4A 4A8JA 4G0NA 1EX6A 1MO5A 2ZVPX 3ZYCA 3UG6A 4OKSA 2CLCX 2FGJA 1R0XA 2C04A 3GJ0A 4YLGA 4PAQA 2WPDD 4LJ8A 5EUQB 1Z0AA 4PXAA 3FVQA 4B3DA 4P33A 1OXXK 1RRCA 2AXPA 2LWIA 4B32A 1E4YA 4W5HA 2O8BA 4M4SA 1G16A 1HA3A 1D5CA 2ZE7A 4GPTA 4II7A 3AF0A 3H84A 4D0GA 4PC3A 3R9IA 4A8JB 4M2LA 4RD6A 4H1VA 3P26A 2BKEA 3LW8A 4DLZA 5FL7D 3LLUA 1UBGA 3U4QA 2I1QA 4CEHB 4UXIA 3SC3A 2J9RA 3KKQA 4W7SA 5CK4A 4A2WA 4A2QA 2ZRGA 4LV6A 2OAQ1 4P3YA 4QGGA 3EZ9A 4JVMA 4BLPA 2IYWA 4EFNA 1SKYB 1X3SA 2FN4A 3QG5A 1ZM4A 3U7GA 3K0CC 3HDTA 5KPJA 2J0UB 3HWSA 1RRFA 3IEVA 4Q4JA 3RLFA 3NBFA 4B3BA 2D2FA 4M8NE 2W6IA 2EFGA 2X19A 1E1QA 1UPTA 2QG6A 2X8AA 3C14C 2ZR7A 3BB1A 2AWOA 2WWGA 4DCSA 3KJEA 5FUXA 2PBRA 2XOKD 4QGAA 3SJZA 1Z63A 1YJ5A 3KXIA 1RZ3A 1O3YA 5FOTA 3A1WA 2CCJA 2JJ1A 3Q9LA 4DDVA 3PUVA 3KL4A 3U5ZB 3UXMA 4BFZA 2ZRFA 1Q57A 4CEJB 2BDTA 2HEIA 2IXFA 5LBIA 1ESNA 5EXTA 2JJ2D 4OK5A 2OCBA 5GJWC 5BN5A 2BCJQ 1U8AA 8OHMA 3VMFA 1TAGA 4J0QA 3X1WA 4C0JA 1TUEA 2GZHA 3NH6A 1IY1A 1BMFA 3KQNA 2IWRA 1HV8A 4JSTA 4Y0AA 1OXTA 1W4BA 1J2JA 3DOFA 2ZYVX 3C5CA 4C0QC 2Z5FA 4L8GA 1OXVA 2ZYWX 2W2VA 3BERA 5A0FA 1LF5A 4KV9A 2D06A 3KKPA 1F2UA 4E07A 1FTSA 2EWWA 4NH0A 4R71A 1IAQA 4K81B 2PCLA 3THOA 4GT1A 5CYOA 1JAIA 4BFXA 4DLVA 1TU3A 2GJKA 4PX9A 1OYYA 3W9YA 1T8TA 3AP1A 3I92A 1CXZA 1WF3A 3TW8B 4NCKA 2QTVB 2ZRMA 4IXMA 2RGNC 4JVNA 2ANBA 5AJZA 3ZVNA 3KDSE 2WM9B 1W36D 1KAOA 3VR6A 1OKKA 1VIAA 1XDBA 1U9IC 2OUKA 2IK8A 1OH7A 4IOKA 3GLGE 2V7QA 4JKIA 4EDHA 2P67A 1R0ZA 2QP4A 3ZZUA 1S1CA 3RS0A 1JQLB 2RAPA 1TMKA 1WA5A 2QNRA 1E2MA 1IXRC 2N42A 1GFIA 4TYYA 3J81k 4Q18A 2J0UA 5AJWA 1AA9A 4FD2A 4HDQB 1FZQA 4M0LA 3VX4A 2AKAB 2OFWA 1NSTA 4RVCA 3QVVA 1DO0A 3BC1A 5DISB 4BWYA 1II0A 2Q21A 3KB2A 1JQJC 4EFMA 3WBKA 3SYKA 1X6VA 2SHKA 3MGCA 2GF0A 4O2LA 4RJLA 1NG1A 2XZOA 4MA4A 3B1ZA 1M7GA 1X8KA 5DHFA 3W8RA 3TJZA 1VG8A 1E1RD 5JBQA 1QF9A 4HUQA 2IF0A 1G1MA 4LZZA 4PZYA 5LD2C 2ZJZA 2JLXA 2XZLA 1I2MA 1Q3TA 2O8BB 3HU3A 4PQFA 1P2TA 4YMTA 2B92A 3NHAA 1M2OB 3A1SA 2C78A 3KQHA 1ZJ6A 1YZGA 5FTKA 1E2DA 1KK2A 4IEEA 1OB5A 1SXJD 2DWOA 3W3ZB 3BH7A 1LY1A 3O8RA 4B2IA 3B8HA 3K09C 1U0HC 1RW4A 2QAGB 3NHBA 2ZS9A 1P6XA 3D31A 1NKTA 2ZSDA 1MO4A 1U2RA 2DCUA 3WRYC 1JR3D 3DM5A 1NLFA 2ZI6A 2YWEA 3CONA 3HU1A 4TYQA 3ZDQA 3VNVA 2ZXUA 1JJ7A 4WZBE 3B9QA 4BECA 3TQCA 2WWFA 2YOFA 1SXJB 2WIBA 5EZ6B 3U60B 4HDCA 4IOMA 5C46F 5JJIA 3T15A 2J87A 2IYXA 2R2AA 1BYUA 2RGEA 4LSGA 4B48A 3AVWA 2BM0A 4D25A 2QMEA 1P2SA 4TYNA 4RZXA 3FMOB 4NPHA 2VP0A 4U02A 4YXWA 5TB5A 1OH6A 4G5QA 1PLLA 5JS8A 5JSZA 4PC2A 4BLOA 4FI3C 2ZRKA 3OESA 4FMDB 3TSWA 4L4UA 3WHKA 2WJHA 4DSNA 2ZJYA 4MKHA 1HQYE 821PA 4UXHA 1FX0A 1JXMA 2ZEJA 1KDTA 2GZAA 2ZM5A 1S3GA 1SGWA 2BBTA 3O47A 1E3MA 1NY6A 2RGCA 2WOOA 3CRW1 2ZI7A 4JLVA 1Z8FA 5EE0A 3ZS8A 2QUZA 4B47A 1W1WA 5J47A 3Q8XB 4MUAA 4TLEA 5C4MA 1C4OA 5AJXA 1J8MF 4MRSA 2GETA 3TR5A 2IC5A 4LHWA 5JS7A 1VYVA 2IA5A 2QSZA 2V55B 3SBDA 4Q7KA 4RD2A 4EAQA 4Q9IA 1V43A 2ZSAA 1N6KA 1CIPA 1KY3A 1KI1A 2ZANA 2FNAA 3SS8A 1IONA 2IYZA 1Z07A 4KXFB 2KE5A 3OZXA 2G9NA 1TEXA 5JRZA 3O8CA 2Q0HA 2H8KA 1EFHA 4LJ4A 3VX3A 1HH4A 1S0UA 2OG2A 1E0SA 2GK6A 3AVUA 2DFNA 3Q7PA 4LPSA 1H65A 2C5LA 4PPQA 4UXJA 1AGRA 4EQ6B 3BK7A 2CE7A 2MMCA 3JZMA 1L8QA 4LUCA 2VPPA 1P2UA 2R9VA 1R0YA 4AC9A 4TQUS 2F43A 3PITA 2YZ2A 1HT2E 2G0NA 3FE2A 5FBLB 1BMFD 1MRSA 5FFMA 3UPUA 5EP4A 1GL9B 4HEJA 1VCOA 3NWJA 2IW3A 1MABA 3B78A 4URZR 1Z6YA 1RPZA 4F4IA 521PA 2IXEA 2A5FA 1CR0A 4LOAA 4P31A 1CJTC 2A30A 4LC0A 3TR0A 1Y3AA 3RWMB 4JSYA 4HZUA 1U94A 3VKHA 5FPHA 5FOWA 3IPYA 2BMJA 3GMTA 4FCTA 2J0QA 4KHZA 5GJVC 3EIHA 3MMPA 5J4VA 5JZVA 2IS4A 4HUQB 3RRMA 3GLFB 4TYWA 2ODNA 3IDQA 2JLQA 3H1TA 3LVQE 1OJLA 1DPFA 3WHLA 1KDPA 1VYTA 1DO2A 4DBLC 1NIJA 5JRJA 4A0RA 4Q4AA 1II8B 3SEAA 3K9LA 1IM2A 1P75A 3ND9A 3TUJC 2G77B 2C99A 4RCZA 5TXGA 4LHYA 3W5JA 4HSEA 1Z83A 5FUWA 1E0JA 1SULA 3CWQA 5BYJA 1K5GA 5BWMA 5F9HA 4HLUA 1N25A 3MJHA 5J5CA 4KLZA 4TTQA 3BFKA 1CR1A 5FL3A 2REOA 4NCHA 3QBVA 3QY0A 1CJUC 2FJUA 2ZRPA 3W5IA 1DELA 3MRSA 3L0OA 4D26A 1TF5A 2ODBA 1VPLA 4IOLA 2O8EB 4LYAA 1NBMA 4LHXA 5BN4A 2ZSBA 1GG2A 4OQNA 4TSFA 4PSVA 1ZD8A 5G3ZA 2CBZA 4NYJQ 4QGHA 1GNQA 2XJ4A 4TZ0A 4ZDWA 2PL3A 1KNQA 1G3MA 2AX4A 3SJAA 4PZZA 5K8LA 1G3RA 1G64A 1NF3A 1NRJB 1H8HA 4BFYA 2P5SA 1CBUA 2GAAA 4KITB 3BFXA 4OI4A 1UDWA 3SNHA 4N1AA 3Q7QA 3SQXA 3X1XA 2QN6A 3B13B 2OBLA 5HE8A 3A6PC 1TEVA 3D8BA 2Z43A 1P7CA 3IHWA 4JZKA 1HEIA 4QNMA 3PENA 4H9GA 1IBRA 1RVDA 2FZLA 2C9OA 4M1KA 3U6KA 4KBFA 4PAMA 1TUIA 4GOKA 5FL7A 2OT3B 3GD7A 4ZPXA 2E9SA 3CPJB 4CYMA 3PV0A 2NIPA 3U7HB 1EESA 1OT3A 2RGGA 2HLDA 4ERNA 1TADA 4B71A 1SXJC 2F9MA 2EFDB 1YRBA 2G1JA 2WJVA 4TMKA 1YKSA 4I99A 4NYMR 1U98A 4B3GA 2ZAMA 1JBKA 4RY2A 4KJZA 3A4LA 1Y63A 2N1BA 2V1UA 4Q03A 4YMWA 1ZM2A 2BC9A 1FFHA 1Q1EA 3KFXA 4Q19A 5M04A 3LQQA 1IN8A 2F7SA 4KAXA 4HLQB 2R44A 4JVSB 4XH9B 1II9A 1XXHA 3LXRA 1E9RA 1DEKA 2GJAA 1IY0A 1GKIA 3GLFA 5K8IA 4BRWA 3ZD6A 4OYHA 3A36A 4IVRA 4LBWA 5HZKA 3AKEA 5B57C 1NG9A 1D2EA 1OIWA 1SXJA 2RMKA 2X77A 1W49A 3IGFA 3EWAA 5G53C 4ITRC 5AUQA 4B6FA 2HF8A 3FTQA 4TLAA 3FHTA 4DDWA 3K70D 5JHGB 2KWIA 4JL5A 4WW0A 4ACAA 1E0AA 4NHOA 2IYTA 2VHJA 3W3AA 4GBMA 1UEIA 4TYPA 1JR3E 4ASUA 4AY2A 1ZCAA 1VKJA 2B8TA 2GESA 2OZEA 4OJQA 3NBXX 1W36C 2J3EA 4KU4A 3VR5A 1H8EA 4LJYA 1RYHA 3CX6A 3OEEA 3VR3A 1KKMA 1IHUA 1XEWY 3NC1C 2GCNA 2QT0A 3I8XA 3LWNA 4LY6A 4P4SA 4TT3A 3RVBA 3TRFA 1F2TA 3IHLA 4N0EA 1SHKA 4TN1A 1E2EA 1DG1G 2FSIA 3EZFA 4BEJA 1E9BA 2FSFA 1DE0A 2EYUA 3Q5EA 1UDXA 1AM4D 5CJPA 1G4UR 1KK0A 4KVAA 2A78A 2RH5A 1PLKA 2C2HA 3EA5A 2JIZA 3VNUA 1CP2A 1M74A 4BGDA 3WP0A 4Q21A 1LW7A 2PX0A 2DBYA 2XZPA 1T3HA 3HYTA 3LX5A 2HF9A 4S2EA 4DJTA 3KQKA 2FSGA 1FP7A 1KO5A 1UBEA 3I1FA 1XZQA 1E2IA 1NKSA 2FU5C 3BIFA 4HB3A 3GJ3A 2W83A 4EPTA 1G8PA 4XWAA 1ODFA 3SJBA 5JWOA 1EFRD 2A5DA 3X2SA 2XSZD 4Z51A 3DOEA 3VAAA 5G40A 2F3TA 1FMJA 3FFBA 1S4QA 4DC9A 1W4RA 3B9PA 3ZLJA 3BH6A 4MYTA 4WVFA 1ZC3A 3BS4A 5CIWA 1W5TA 1DVRA 2DR3A 3D7MA 2CCGA 2YWHA 4H1UA 4MDEA 1KJYA 1NBMD 4DLSA 2XXAB 1E2QA 1E2JA 3TH5A 2VL7A 2ZITA 1LS6A 4MRPA 4PQRA 2J45A 4NP6A 3RWOA 1II8A 2JDIA 2ZR9A 1KIMA 2QTFA 2X2EA 3KQUA 3F3YA 3KX2A 4DHEA 3UG7A 1AS3A 3DPUA 4O0MA 4FN5A 1XX6A 5L3QB 1UKZA 4JLMA 1G6HA 4QXAA 3VFDA 2RHMA 2WWYA 1F6BA 1N6NA 2WHXA 1XXHB 2JJ8A 4BZXA 2OXCA 2ZRCA 5TDHA 5FBWB 4LX0A 1EG7A 1E2LA 1T6NA 2WPDA 5CYPA 3I3SR 4YMSA 4MGYR 1GM5A 1G9XA 2OBMA 4OI2A 3S1AB 1WB9A 2FPMA 3EC1A 2RKOA 4PHTA 4B34A 2IYQA 2WMOB 1OW3B 2F43B 3B2EA 2J41A 1TTTA 1KY2A 3SHWA 1AGPA 1P9WA 4F4JA 3AVOA 2BKUA 1F2UB 3VKWA 3GPLA 1WE2A 5TV2A 3TAUA 3ZJYA 4DLRA 1XBTA 2D2EA 2FFBA 3W90A 1DAKA 4MKFA 3ZQJA 2CL6X 3E1SA 2GZDA 3B82A 4YQFA 5KHOC 1R5OA 5FOVA 1N0WA 5G3YA 1EXMA 3EW9A 1WDTA 1ZW6A 4DDUA 3ZIAA 3LAWA 1KSFX 4Q1DA 3AM1A 4Z1MD 1JECA 2QQEA 3WMFA 1XNJA 3TBKA 5FBVB 4M1SA 3OFND 1S9DA 2D3WA 3EXAA 1GRNA 4K8OA 4DCNA 4JL6A 4LWZA 4URVR 2GXSA 1MABB 3P1JA 4AI6A 3AKCA 3CO5A 3K9HA 4URXR 4C2UA 1ZM7A 4HI0E 2OE2A 1K5DA 2GCOB 2JLSA 4OL0A 3QF4B 4MUBA 1ZYUA 2OBNA 2FPLA 2HT6A 4GI7A 1Z22A 1XJQA 621PA 4G5SA 1CJMA 1Z6XA 2ZJOA 3AKYA 3KUDA 2J0SA 4BFVA 4Q9JA 1JEEA 1G3QA 1VCMA 1Z2CA 2JGNA 1YVDA 3DL0A 3T34A 4CEIB 1NVVQ 4P0TA 5FPTA 1XCMA 1YR6A 1Q1ZA 1EGAA 2DHRA 4ZIRA 3AVQA 2XOKA 1HE8B 3OEED 4PC6A 3AVYA 2CVFA 3CKLA 3H2YA 4UJ5A 3EG5A 3R9WA 3N5CA 3DEFA 1P73A 3KUCA 5IK2A 4EUNA 2FFAA 2GILA 3BXZA 1FL9A 3K0CA 2B6HA 3KKMA 4LK2A 4A92A 2IS6A 4D80A 1NN0A 3QKSA 3N70A 2J59A 3IBGA 1OH8A 2IUSA 4MYUA 4E5UA 4F91B 5TVKA 1FUKA 1W46A 2XAUA 4V0ME 2OLKA 1Z6GA 2JEOA 3IBYA 3QUSA 4JLKA 3AVTA 1OPXA 1A5TA 1YR7A 2ZROA 5FH9A 1P60A 5C1BA 3O8DA 4TQAA 3ZD7A 3K09A 3P4YA 1T0HB 3QKUA 2WKRA 4L9SA 1EK0A 2CMKA 5LB2A 3CH4B 3RRZA 3U61B 3ECCA 3T1OA 4PANA 2NPFA 1NIPA 3CWZA 2IYVA 2ZTSA 3I72A 4HZIA 3UMFA 3NDBB 4M9SA 5KO2A 4IJMA 3QG1A 2PZFA 3BRWD 4GRAA 3THYB 2DFTA 1E79D 4OHVA 2GF9A 3WXMA 2JA1A 1XZPA 2REBA 2ZYTX 2JLYA 2GKSA 4G3XA 4IDQA 4A8JC 3L8ZA 1VG9B 3QKRB 4MGZR 1AZTA 4DEXA 3ETLA 4LV8B 1XEWX 1SVOA 1XP8A 2Q9AA 3PUZA 4DCVA 4BQSA 1MKYA 1D9ZA 1QVRA 2FFQA 4DVGA 1ZUHA 1PV4A 2HDNB 4JLOA 4R9UC 5KYKA 2VQSA 3I62A 3CF2A 4IOJA 3AGPA 1Z0KA 2VP9A 4DB2A 3HR8A 2W0SA 3CR7A 1XPUA 3DKVA 3GLFE 1OE0A 3O8BA 1KI8A 3ADDA 1W44A 2WZQA 2EW1A 3CPHA 2NG1A 2AK3A 4W5WA 4LDJA 4XTRA 3SI7A 4EFLA 5HZHA 1SXJE 4B76A 2ZE5A
chains in the Genus database with same CATH superfamily
3ZNPA 3IIJA 4LBYA 3EF1A 3HDVA 1L4HA 3QX7A 4XVHA 5SV2A 6Q21A 5H8WA 4OQLA 2SECE 4ZAWA 1Z29A 3IP1A 1XZNA 3W2IA 1T2VA 1Q7RA 4WCFB 3RAGA 4KXMA 3W7AA 4LMBA 1GPDG 4WJLA 1JJAA 1KOLA 4ABTA 3T5GA 1XZLA 2YC4C 4MW0A 4ZOLF 3FBWA 3Q3CA 4TS1A 1BX1A 1W88A 3SR4A 4EUHA 1YS9A 2B82A 1GSAA 1UFOA 3RUDA 3AHDA 3GCWA 3VR3D 3L8YA 3T1VA 1FVHA 2WF5A 4MV8A 1JTVA 2C77A 5FWYA 1ZESA 3PJEA 1G3IA 3UWKA 3HKEB 1RFLA 4FR5A 4UREA 4YALA 5C7IO 1MV5A 2FFJA 3L05A 1W85A 1XALA 3WYEA 5DI9A 3LY8A 1H93A 4HLDA 2D1TA 3R6LA 5IEBA 2FCRA 4GLBA 1A27A 5EKXA 3HB7A 3KCQA 1SRRA 3LQ1A 3UXYA 3WWCA 2ECKA 1W36B 4DXAA 1PZNA 1Z12A 1G21A 1IG0A 5KSWB 1B7GO 3P9XA 4RKRA 3WYNA 1MTOA 3QVTA 5KSOA 2CLEB 1IC6A 3LY5A 3A27A 4G5RA 4E30A 3ORSA 2ZIWB 1K68A 2MYNA 4ZVKA 2QVGA 1AQNA 1E61A 2ILVA 3TQFA 3RO7A 1U2EA 2BGKA 3KE8A 3U40A 2JEYA 3VZBA 2O2SA 4AT1A 1T25A 4JYBA 1Q7EA 1YB5A 4B3FX 4O2AF 4OI1A 3B85A 4P3NA 3DEKA 4OJMX 4KQFA 1RVV1 4UE6A 2YMMA 1BEUB 4DEVA 3PR2B 5BW8A 1TPZA 4Y1RB 3IQXA 2G9ZA 3I9NA 4DXDA 1Z0SA 5JVDB 3T5TA 2ZRJA 2LDXA 4MDYA 1MZVA 2D62A 3GX1A 1H0RA 2YZNA 3CKMA 4CNQA 2AFIE 3HKEA 4KCGA 1JEAA 4OJKA 4UNRA 1U9CA 1BCSA 1OGIA 5JH7F 4NJEB 1BD4A 2YIVX 4RD0A 5EUBA 2RHHA 3KOYA 3KQLA 2HXYA 4EP1A 2Z6VA 2ET6A 3W79A 1LTHR 1Q12A 4NOLA 1ULUA 2ZYGA 4LKRA 1H2FA 2GH1A 2HQSA 1FMTA 5EPUA 1S2LA 5AUPB 4OK3A 3BFJA 1QS0A 4DRXB 4Z4FA 1W5BA 1SBTA 4YQZA 3X1ZA 4CNBA 2C5SA 2OO7A 4EELA 3GVPA 1U1DA 3GNTA 5DYIA 1JIKA 3BZWA 3SP1A 2IE0A 1U28A 3FSJX 1RWXA 3G2QA 3S1AA 4YRLA 3SWWA 1H94A 1K4MA 3KC2A 2CJFA 3K16A 1U90A 4HH4A 3G0BA 4YHBA 1TMYA 2VPYA 1YAHA 2NGRA 2E87A 2XE7A 2WU1A 4Q48A 4NTZA 4ZN6A 5FFNA 3TFOA 3OWOA 3DL7A 4RIIA 4E0BA 5CA0B 2VJMA 1STOA 3RARA 4L74A 4LHZA 3P0EA 3ROGA 4M1MA 3PR1A 4BLQA 3WMEA 5DP2A 2XCSB 4LF8B 2IVZA 1U0OC 4ZDKA 1WJGA 3ZGLA 3C3MA 4M6WA 4RJKA 5EHXA 1NMZA 1RP7A 1KI6B 2MTBA 2B1JA 2QR3A 4LDQA 1HTWA 3PC8C 2OLEA 4MYCA 1A71A 1VHWA 3CEJA 4XB1A 4EHJA 4F6RB 2HYIC 1N8SA 4RA9A 5TQ2B 1EIZA 4QOJA 4YDSA 1IZ8A 1IWOA 1NJ8A 3IAUA 3UN1A 9MHTA 2IDKA 3OLZA 4TMZA 2M2IA 4WA7A 3T4PA 1YWGO 1F5SA 3RAPR 4MWDA 3OX2A 1UM8A 2GFIA 4YLEA 2PXHA 3S5JA 2CNKA 1E3QA 4JITA 4OB7A 1GGNA 1T4CB 4M37A 2POQX 3JZFA 3TQQA 4Q1BA 3ZDCA 4Q9DA 4DUGD 4ZK6A 3I58A 4IO1A 4TM7A 5A3JA 4MAMA 3IAS6 2Q3LA 2UUOA 1FY2A 4YJDA 4B4OA 2W42A 1FFDA 1VE5A 4RK4A 5DCLA 4NXNB 2H4FA 1I10A 2Z09A 5EEGA 5G1PA 2XDQA 3EBPA 3E3AA 1ULHA 3F1KA 3M4NA 1PI3A 1LRLA 2AJCA 1K92A 4D0NA 1SVLA 3PJDA 3FNRA 2QUHA 3OOJA 4OXNA 3CJRA 4RBNA 4WHMA 1GWNA 3UOAB 3UIEA 4PO1A 3TLBA 2R8RA 1ORDA 2J0SA 3WWOA 1XZCA 3HABA 4PCUA 4Q66C 3DAHA 4IKPA 4BBAA 1W2GA 1JJIA 3FF4A 3FFAA 3JATB 1Y82A 2GTPA 1NP6A 5E1OA 2CFOA 4FYYA 3RQEA 2YS7A 3C5EA 1G1AA 3HVKA 2RE8A 3BICA 3L8HA 4KK3A 4AZVA 4QHTA 3LK6A 2IUFA 4JDUA 3ZE8A 1ZISA 2CL0X 2CNWD 3RQFA 2DY1A 3NEYA 4WCFC 2HRZA 1KOFA 3R5KA 2A58A 5CW1A 3UMSA 5THXA 3DYVA 4EABA 3KQVA 4L4YA 1P8AA 2X8LA 3RDPA 3RYHB 1K06A 3VYVA 4Y6OA 3ED1A 1T0IA 1L4FA 2JIMA 3G82C 5GM1A 3R8FA 1ZAYA 4ALNA 2ZUUA 3EDCA 1PZHA 1ULSA 3NTUA 2L19A 5JDIC 5IHPA 4XA8A 5F2NA 1MN6A 4NCJA 5DXFA 1DBWA 3DWIA 5DW0A 1US8A 1W4ZA 2PVCA 3GI1A 2H4HA 4GPEA 3MAAC 1PWXA 4KFSA 3RS5A 3OVMA 5F78A 3VR6H 3ZS9A 1XPRA 2VHEA 3WGVA 4C4RA 3WLHA 5B3KA 1NZFA 4YN3A 2VSOA 3K72B 2SKEA 1L7BA 3FZQA 4B3IA 2HT1A 2R62A 1WXHA 4D6PA 4UMDA 1WY5A 1Y1SA 3FWHA 2JC3A 3P20A 4UNNA 2W4IA 3TSCA 3KEFA 4C4AA 3O1LA 4EHLA 1PVVA 4L9RA 5AVSA 1GQFA 4M21A 1S4MA 3VV2A 1SZPA 2ACKA 1LPOA 3GEEA 5T6BA 3PRJA 1L9KA 2FFHA 4LKOA 3UMRA 4X9XA 1RYFA 2D8AA 2UZ1B 3REGA 1WQ1R 2HBRA 2P27A 4ZCIA 3MCZA 1G4HA 4C6SA 5JWRA 1ICEA 3ACBA 1WPRA 3VAYA 4B6GA 2VF7A 1YQ9A 1G8YA 2E5WA 1W4LA 2YV2A 2P4QA 2ZU0C 3RRYA 2EERA 2OB2A 3FZGA 4BQRA 2A1IA 4L3VA 2FW2A 2XYQA 1RT9A 2CK3D 2P9HA 3F49S 3L7DA 4M8KA 3TNJA 3UWMA 3PDJA 4TV8A 2WR8A 3A4VA 1FUEA 4K26A 121PA 4L2IA 1D9XA 1GJRA 5FWNA 1CW2B 3NKLA 1ABBA 1CUSA 1SURA 3OFVA 3CUKA 2FRDC 1CUGA 2WKWA 1FVOA 1SCDA 4Z99A 5CLLA 1OZ0A 3WP1B 4YT2A 1EAMA 1W35A 5IKOA 1R8QA 3WGHA 1ZMTA 1UP7A 2FN9A 3IPRA 3K0FB 1RAIA 2AOUB 3MGBA 4G4JA 4EFKA 1A9TA 5IVHA 2XDYA 3VKGA 2XJ9A 2B98A 1XQYA 2CDNA 3WKBA 4BMDA 4JJZA 1X9GA 1FUUA 4X6LA 2RI0A 3EPPA 2YHAA 3DMNA 4X63A 4TSFD 4QKQA 1IZ7A 2P0EA 2QAGC 4GZ6A 4P4UA 5AKGA 2I6XA 1R37A 1GAQA 2QVXX 2VH1A 1Y1LA 3LIPA 3O03A 5IM5A 3UWSA 3JCZA 1VECA 2B34A 4P53A 4AF7A 5I48A 4LEIA 1M34B 1USKA 3G8YA 3RC9A 4ENPA 2E7ZA 3T7JA 1MO6A 1Q84A 5I7OA 3UAOA 4RKFA 1CFZA 4WXPA 4OQQA 3MILA 4IDFA 1FRQA 1PR9A 1R4NB 4RADA 4WH0A 5TF4A 1OX4A 4H1WA 3AJEA 2GGSA 1N3YA 3Q7SA 4GD3Q 4MK4A 3T5DA 3VVBA 4ZYZA 5LZ7A 4BP9A 4EYQA 1B0PA 3TQHA 2FLWA 1G20B 2Q5OA 2EFCB 1OV4A 2R8XA 3HYRA 3R77A 2AJLI 4G24A 3RYCA 3UAWA 1MOSA 5CK5A 2XXBA 1RJMA 3FF1A 1DAOA 3RK0A 4PTLA 4B6OA 4KDRA 4TS4A 4QAQA 3WL8A 7YASA 2WT8A 1OFGA 1C8BA 1VG1A 5EUMA 3GRRA 3OHSX 3UUFA 4YJGB 5HFAA 3I30X 3WLKX 2J9XB 4R1OA 1G8HA 2ZULA 2D54A 3G8CA 2C8VA 3QVKA 3LS2A 3EH2A 1FYEA 3OFJA 3T3DA 3L5OA 3ITDA 4KFRA 5K3BA 1Z6AA 2POCA 1SQ6A 3VVCA 1KR2A 3LMKA 4NYIR 1T9KA 3KSRA 2I3BA 4QBHA 2JLUA 1AZSC 4YRKA 2PX4A 3DAYA 3FLAA 1LI4A 1RKBA 2NAPA 1ESMA 4Z6KA 4ZHQF 4ZICA 3DWGA 3OEYA 1UKEA 5GADl 4ELXA 1G8MA 2J7KA 3AVVA 4O2AA 1G5QA 1KEEB 3V9PA 3NNNA 3SGLA 4LRWA 4BTVA 1IWBB 3AHGA 1KFJB 1U0JA 3R9TA 2WM8A 2JF0A 2Y99A 1CG6A 3CG0A 3EFHA 4NBLA 2GRUA 4Z0PA 4IMRA 4D8UA 4Z3KA 3LQFA 3U7JA 5ALJA 2ICAA 4BFTA 3T12A 5A5VA 4INOA 3WMGA 3BXPA 3FVTA 3DUFA 5CM2Z 1V71A 4D97A 3GIDA 1MJNA 3AI3A 3SR3A 1K6EA 4FSHA 3ID6C 3TRHA 3D2CA 3M89A 4MKGA 1Y5LA 4J3FA 4WFKA 2ZSKA 2FG7C 4O63O 3ER9A 4F38A 3RVLA 3ENZA 3TBFA 2G7ZA 2OZVA 1HX7A 1E7WA 3A4MA 1G8GA 4NJMA 4CG0A 2NVWA 4C1BA 2QTVA 6ABPA 1EBBA 2J3IA 1UKAA 4XEHA 3AY6A 4KMMA 2JIQA 3K73O 4KQEA 1WHSB 3FFWA 2ZPUA 3PHBE 4QECA 1Y3BE 4MMXB 4NAHA 2YCBA 4LXXA 2DR2A 1NLMA 3GDGA 3ZWAA 3OOEA 4W6QA 4MHTA 3JQEA 4U2EA 2EZ8A 1JXAA 1RKQA 2C9MA 4NMHA 4PFJA 5ESXA 4F85A 5JC8A 5CJJA 2JK1A 3HXLA 3LWZA 3TNLA 1J1IA 5FD8A 1EVLA 3CH6A 4DMRA 5KVSA 3ZLVA 2PWAA 3PUHA 3Q6MA 2VX2A 1HE5A 2JDID 2ZBRA 3KP1A 5TSDA 1FMLA 4POAA 4UU1A 2ATVA 3EY4A 4C9BA 2CMDA 4Z86A 2ZREA 2NAFA 2FW9A 3PE4A 5LQNA 1QDUA 5JCZA 1XD2B 2XDAA 3OTGA 2XEXA 4M0FA 4OXKA 4UPDA 4V1CI 3JAMA 1DCIA 2WJIA 4B3HA 2WMNB 2YX1A 4C5BA 3ZE9A 4R54A 3M9WA 3MF4A 1OLOA 4RPCA 2AJBA 2VDWB 2OFPA 5AUNB 2DAPA 4QBFA 5TY0A 3ZI0A 5C8YA 5AM1A 3O9ZA 1EUDA 1P72A 1XMSA 5B7GA 2FGKA 4B35A 3F97A 1CVLA 1Y8RB 2X7JA 2XTAA 4RYDA 1KAMA 1Y7TA 2ZXFA 4MWCA 3UF0A 3QXJA 3PHJA 3BGSA 3FAKA 5IH3A 5K3FB 1OFUA 3ET5A 4EJ0A 1G9TA 3JD1A 4K6HA 2E1RA 3ZJ5A 1G8SA 4NYMQ 5LXTF 5D8DA 1CY4A 3G0DA 5K2OA 1OX6A 5HKKA 3DHEA 3GXBA 3ZY6A 4EQ6A 1FF9A 4I50A 2D59A 4KHPB 1R8JA 3NKFA 1GXSB 2PANA 2WQ7A 3PC4A 4RZ2A 2Y2VA 1Z68A 1ZQ9A 1T15A 3PKIA 1YNOA 5I9TA 5I3CA 3PDHA 4YJHB 2XQKA 4IPTA 2XTNA 4X45A 2VIIA 3QPCA 4QIJA 1H4SA 5BT8A 4P34A 3BHNA 2FETA 3DBLB 1XDUA 4Q3AA 4J3NA 4B87A 3QKWA 5HXAA 2YWCA 4IGKA 3Q85A 2QSYA 3CXUA 1AKYA 3HWWA 3WBBA 2HW5A 2F1IA 5EHGA 2B37A 2GAIA 2BFAA 4TTAA 4DXHA 1SA0B 3I0ZA 3M6IA 5KSYA 3GZ4A 2GVDC 3AFHA 3AR7A 4U2KA 4C7MA 4LBZA 2UU9B 1QQ7A 3AILA 1US8B 1ZFNA 4I1OA 1XNQB 4IH4A 4BNDA 3JQ9C 3MB8A 4EVQA 3QKTA 5SZIA 3RG2A 4QM6A 2ZBUA 1YH3A 2MCFA 1S2IA 3R6DA 5FR1A 3WB1A 3G1UA 4UVEA 2IU0A 1C2YA 1MX5A 2YVUA 4IDHA 1R8YA 1X86B 5K5EA 1PG0A 2ZAIA 1MLDA 3C74A 3IO5A 5DGXA 3V1UA 3TOZA 1Y0BA 1JG6A 4OMDA 4IZBA 2D2XA 1Q6YA 3VISA 5L3ZA 5BVHB 5EJ6A 3COZA 4U00A 3V4RA 5FF9A 1AN0A 5JYEA 2D74A 1QFMA 4KIFA 2D1RA 3CGGA 1ZQ1A 4QGBA 4UQPA 1EZZA 1NSYA 5E4JA 2YHBA 3BWCA 4M1QA 1DPGA 2LVBA 4MMYB 3GJSA 1AS2A 4FDTA 3V6MA 1X92A 1P44A 1YT5A 2HJVA 4JZYA 1TF2A 3OZCA 5AKIA 1KH1A 2JW5A 1EUYA 1HKUA 4TWZA 1WXGA 3RB8A 2QQ0A 2PUFA 3P0RA 3PX7A 4TOIA 3U4DA 3KLBA 5FAKA 2NZVG 2R6GA 3DBIA 3LI2A 3SAJA 4AJKA 1NE7A 1T35A 1Z7BA 2DVMA 3C6YA 4WAUA 4YMVA 4UCQA 1UBJS 2FF7A 4Y2VA 3GWZA 5IDYA 2IYFA 1QQBA 5JBWA 3LBYA 4XDYA 3SVZA 4C0WA 4X1KA 1T4CA 4BX9A 5EIFA 4EG8A 1U3GA 4RZ3A 3IHKA 1BU8A 2GCEA 1COZA 2QGZA 3OY2A 3A9WA 3D0QA 3WS7A 1RXYA 1RYNA 2YV5A 1R6XA 2B8WA 3NWPA 5HX7A 2ORIA 3KR9A 5DTEA 2ONJA 4Q7MB 1EDBA 4V24A 5JNLA 4CLXA 2VWQA 3B6KA 1XU4A 3AGQA 3KTAB 4QJBA 1JIJA 1OAOC 2DKOA 5JEEA 3EXG2 3TOVA 2CHQA 1PWEA 2XIJA 4Y2HA 2Z4RA 2HMWA 1ENOA 1UJ4A 4YEDA 3ND7A 5IP5A 2QVCA 2O5RA 5K3FA 2FF5A 1IN5A 2CC2A 1XMVA 1NMYA 1XZEA 3NCTA 1CUYA 4IHJA 5HKAA 3ZV5A 2XCIA 4B45A 4EJ2A 4QOEA 2VJPA 4R2HA 1RXVA 1J90A 3OQIA 4GPD1 2G6BA 1KYTA 2J9ZB 3H16A 1P3JA 1N6OA 3WO1A 2PTHA 1NW5A 1UBCA 2G28A 1FDTA 2ZAYA 3KPYA 3L02A 3M4XA 4FSXA 4RA6B 5KPDA 1ZGZA 2JI9A 3DD5A 5TIIA 1X87A 3SLLA 3HPQA 4R1TA 2EL7A 3K9NA 4AN4A 3HEMA 4JD5A 1ZCBA 5FI0B 1DFIA 2FMFA 5GV8A 1JEQA 3JR7A 1DV2A 2GZ2A 4DPMA 4WXRA 3ZXXA 3ZVRA 2LCQA 1JB1A 2AFVA 2BF4A 2IBTA 1GARA 1DDGA 2QE7A 3A4NA 3CLUC 3LCMA 1U9YA 1XNGA 3QXCA 4OGWA 3SJCA 4CBVA 5J4KA 1QORA 1T5OA 3HCBA 5CVEA 1T29A 5HDQA 2W48A 1EFKA 1ECLA 3TSZA 4K8RB 3F7OA 2YWDA 4P83A 1IZ9A 2IU6A 5KNBH 2HM7A 2IZ0A 3GZNA 4LI3X 2WSLA 4MV0A 4QBIA 4YCJA 1PHRA 5BOSB 4OO3A 1YJ8A 1NX9A 3OZWA 1YS1X 2HA4A 3CVVA 3N0TA 5C8DA 4W5TA 2O8CA 1XTRA 4WEOA 1D6MA 3LBFA 3QE9Y 4JU8A 2C98A 4H3KB 3EJ6A 2A0UA 3HUDA 3O95A 1P6QA 2OQIA 4QRHA 2CSXA 1XK6A 3IR6A 1Y42X 1N0VC 2Q1XA 2WVJA 4JBYA 4ZOQI 3I2KA 5A62A 2G88A 3NHZA 4GG1A 3PNYA 1K3FA 2VZ8A 1M2VB 2H31A 1SOUA 2F48A 3MIZA 4OK6A 4JFRA 1KZ6A 4PFSA 1GDHA 1ZNWA 5CDHA 2A3RA 1KP3A 1KRHA 1LI7A 1ND6A 2NO5A 1PJBA 3GQBA 3LPCA 4DDTA 1OOEA 1VTKA 4MDFA 5MHTA 1SOVA 4O5AA 2NVBA 1RKXA 4PLYA 2AYXA 1C3OB 3BCHA 5A4DA 3H4TA 1N7IA 4PHGA 3JQBC 4G1CA 3QPUA 2B8NA 5EJGA 2C0PA 2XDQB 2VT3A 1Z7EA 2JFVA 1M6VB 1JBEA 1QIJA 3WBJA 1JU9A 2WSSA 1KETA 3DBRA 3IQIX 3IQZA 2J31A 2EG9A 1CR4A 1KL7A 1DCMA 2R5FA 6GPBA 5F2EA 1NI4B 4QUKA 1E9VA 3DGEC 4DB4A 3DO8A 2QZZA 4O4IA 1G7SA 4K6KA 1O0CA 1BO6A 4BUCA 3G0OA 3N6XA 4I08A 4I46A 2F9LA 4LJ7A 4PSKA 2DR0A 1EGVB 4RL6A 5JUWA 3T7DA 4EW3A 2Q6KA 5CD1A 4A0HA 4LF7B 4F7WA 2VEOA 5LP6B 2P1RA 3H4MA 4RS3A 2Z2IA 1WHSA 2PHZA 1HT3A 3N0RA 4HTFA 2HDHA 2FWMX 3WHIA 4JXJA 2DT8A 4JN6B 3U4AA 2UV8A 4KK4A 4OFXA 4W1QA 3M0EA 4RE5A 3RANA 3RJZA 4US1R 2JZNA 2YWRA 4RKWA 1ZZEA 2XAAA 2ZYAA 4LZPA 3CN7A 5EZYB 2WHPA 2A7XA 3X2EA 4D42A 2BDUA 3V97A 5HPYB 2O1SA 4DUZB 2Q5FA 4KQMA 2C2KA 4G8DA 3SCZA 2OGUA 2ZS7A 1TZMA 1TZBA 3OLQA 1AIPA 5CHEA 4PAOA 2ZSFA 3PXGA 2HMVA 4XDHA 2C9BA 2A5GA 3LDAA 4ILEA 3WA7A 2JAPA 3V33A 2DFLA 3DDZX 2WSIA 3EZXA 1N6IA 1QHXA 2FW8A 1LVHA 4PZUA 2NQTA 5EERA 1G8KA 3TGWA 1RXEA 1UK9A 5KQSA 5MFPA 1H69A 2XTJA 1V16A 2XNDD 4LYYA 3NUQA 2E0IA 2XUGA 4LJLA 2JLRA 2V8OA 2HSWA 1PTJC 3FNEA 4M1ZA 3TTSA 1C9KA 1U8FO 1DAEA 4RHYA 3UQZA 2FPXA 3TWOA 1XU9A 2F1HA 3CKKA 1XMJA 2FZEA 3AIOA 1Z38A 1Y5IA 4G4GA 4FTWA 4US0R 4RV9A 2OVBA 2UVPA 3O0TA 3W34A 1ZNQO 4HDAA 1URPA 4D9FA 4KVFA 3WSWA 3CHYA 3R76A 5B1HA 1IQPA 2O7SA 3SYMA 1VIDA 1WBJB 2PAFA 2BJWA 2V65A 5LDDC 4GKJB 3EAGA 3WFIA 1P4GA 2B7CA 2CB9A 3DYIA 4AB1A 1RM3A 2FPIB 2PMKA 3PYMA 3UJ6A 3AEZA 2PBFA 4FCWA 4IS2A 3ZEIA 1SCJA 2BEWA 3B1JA 3PT5A 5EQTA 2NXWA 3AVPA 4FI3F 4B74A 2BEVB 3R3HA 4G9GA 5CITA 3GVCA 2O2DA 2QRZA 3G7NA 1D7OA 2P5UA 4KQHA 2HU8A 1Z2AA 2Q4OA 3HHPA 1Q0UA 1SHTX 4IW3B 5D6NA 3CG4A 4RLSA 1OBHA 1T3GA 5DYWA 4J1TA 3VHXA 2PCJA 4E1AA 1UOEA 2QRLA 4LOIA 5GINE 1CEXA 1D2NA 1P2VA 4NHEA 3GVHA 3GGGA 3SFVA 2DHDA 2J8ZA 4HDNB 1IBLB 1WZEA 2XB9A 2IXDA 3K30A 4YNBA 2F8MA 2OD7A 3PB3A 1E8DA 8GPBA 1XRJA 3RRBA 2YASA 4N3NA 1ZOLA 2TMKA 3CUYA 4P7FA 4MJLA 4IFIA 4BMOB 2ZJ8A 5I7FA 2WF7A 5H83A 5KDDA 3T3OA 3LFHA 3E9RA 1IEXA 1DUSA 3D3KA 3F5SA 4UUPA 2G0AA 1Y37A 1HDYA 4ZXFA 4ZI3A 5DLYA 3T7IA 2HK6A 3B7GA 4Y2UA 4V1CA 2REQA 3GFRA 1LNZA 4BMNA 5ALKA 1LK5A 3VHLB 3FLBA 3RTBA 4H3HB 3WRXA 4C3UA 4HMPA 1IE3A 1FRVA 1MJGM 2OV4A 1CQXA 4YYZA 3D6JA 1ONNA 3UT5B 4O4JA 2LKCA 5AVJA 3SYRA 3V8QA 1JA9A 4ARIA 1PVOA 1GCGA 3PGLA 2RHTA 4X6YA 4UUMA 5DBHX 4LPKA 2ZTVA 3O3OB 2WUGA 5L6MB 4B6QA 1HDXA 3ROFA 3ZWCA 4OBEA 3LVBA 4H18A 4CIVA 1UJNA 1ILEA 3KAJA 1UCFA 2MOKA 1P39A 2XITA 1M5TA 3MINB 3PQ6A 5DNYB 3HR4A 1YR3A 5E7JA 4N5HX 3RHFA 2A0YA 2XF8A 3EVCA 1N5DA 3E53A 3FPAA 4L6AA 5EMMA 2G07A 3HINA 3EFOA 5KQRA 1K9VF 1ZRNA 2CJXA 3GRFA 4ZV9A 4E14A 2GEUA 2RIRA 2EJUA 3BMQB 2I2FA 3CGWA 3DA8A 3KB8A 4IDOA 5ESWA 5FWAA 5FBZA 1JR4A 2HV9A 5P8WA 2Y9PB 2BOVA 2GXUA 3CRMA 5DIZA 2ZRAA 4H7DA 3N2IA 3TKAA 4CV3A 4JI5B 5CB8A 3LQKA 3R5SA 3Q2IA 2CLFB 4LJ6A 1LW6E 4DA8A 4KPUB 3PGJA 1JVNA 4FYHA 2RKWA 1V6AA 1L4UA 1T5HX 4JC8A 4PYIA 3EISA 1M75A 3CJQA 2DCMA 2OV2A 2DULA 2W11A 4RETA 2W8ZA 4XFJA 1LDBA 4CN9A 3OM0A 2QNBA 3GMIA 4JHXA 4QXQA 2PH3A 1B14A 3IAAA 1CUJA 2R65A 2YVAA 4C4YA 1CUFA 3OQ1A 2IEYA 4IQGA 1K2VN 4ZDIA 1F8FA 3K9QO 1VJDA 3OZ7A 4GLLA 3OHMA 5FTNA 1C7RA 2CWDA 4HXGA 4BFLA 1UADA 4EG3A 3HJFA 3I23A 4O4LB 1KI6A 2Z4TA 5C8ZA 2AR9A 2QD1A 1D4OA 2JASA 4LGVA 3TNYA 1N32B 1C14A 3V00A 4U9HS 3FNFA 3OAAA 3LBAA 4HVTA 5FOSA 4ZHQB 4MW2A 3UFXB 4ESVA 3QOFA 3QEOA 7ABPA 3OLVA 3MJSA 3GCXA 3EIOA 3PQCA 2ZUSA 5DIFA 1KPHA 4D9HA 1K8XB 4D92A 2V4ZA 4H3VA 3TLEA 1FNDA 3C15C 2PXAA 4AROA 3N2ZB 3ZU5A 3A9VA 4CRWB 4WY8A 2O7NA 3SDSA 5A6SB 5AI6A 1QG6A 3IBSA 2VCHA 1YK0A 3NXKA 2V9ZA 3I0NA 2DE0X 1PR0A 3FWPA 3DQQA 5ALOA 3VBCA 1QHIA 1YC5A 3T1QA 5LLTA 2Z3ZA 3FY4A 3ZNQA 4PGMA 1NPYA 2X8JB 1RWPA 2DH6A 2QL5A 3DMYA 3FDJA 4MSUA 4DLUA 4C88A 1GPH1 4R8LA 1Y7HA 1XAIA 2C03A 2LIPA 2M6KA 3MMXA 3OA2A 4AS3A 4JBNA 4B7AA 1E66A 1ECPA 1GKKA 4XCQA 4QDOA 2WFLB 3D6MA 4XQCA 4MRAA 4V02A 1JG4A 3PXCX 3W6UA 3HACA 3CLVA 4X5OA 5F5LA 5BURA 5F5NA 1I4EB 1FZTA 2AVNA 1M2NA 4JP2A 2D00A 2QMZA 1RTKA 4OLHA 4J4TA 1TRKA 3QEJA 5J4YA 3VU9B 1GUBA 1O0BA 1I2ZA 4B5LA 3O1JC 1Y9DA 1UAAA 3NCHA 4AIIA 1SVWA 4N7MA 4O1MA 3MC1A 3PGKA 3UAZA 4CUZA 4MQFA 2RG7A 4YMUA 5BSFA 1RJDA 4JOBA 2ZB8A 1U9JA 4BBPA 4Y9DA 5EZSA 1AXGA 1BIFA 1D1QA 2PH7A 4OHZA 3U17A 1DZIA 5BN5B 2HPAA 1FLVA 4HFMA 1U7ZA 3WRWA 1M0EA 3HA7A 3SKVA 2ENUA 2BH2A 4IRUB 1CY0A 4TL7A 3DAOA 2AEJA 3WIOA 5G0WA 5KYGA 1XKLA 2FSVA 2JK0A 4J7AA 4TS3A 2XWSA 3M5DA 5BR8B 2KS6A 4C7XA 1RHUA 2HLPA 1WW8A 3WQQA 3RU7A 3PQFA 5KNDA 2ADMA 4Z8XA 3PFNA 3IRBA 2X2FA 1FLAA 3EOAI 1TO1E 4WINA 4DKXA 2VHTA 2VPTA 5B6IA 3Q6NA 2ZJBA 4HWPA 1BVUA 2GD1O 3IB3A 1WUTA 2IPLA 5L4SA 4X7PA 4LRUA 5CAEB 4QU0A 4X6UA 3KKOA 4C4SA 3LP5A 1GTL1 1XI2A 2YN0A 1E2PA 4M1WA 3LVRE 2PJDA 4HVAA 1B23P 1EI9A 1XQ6A 1PK8A 4HXEB 5L7YA 4WEQA 2O2YA 2C5GA 2ZETA 4YACA 3TQOA 1N5JA 1DKRA 4OHXA 4UVDA 2ERXA 1KI4A 4Y9UA 1D2MA 2ZPTX 3C3KA 3UPDA 5DLPA 4BKRA 2PGLA 3IDZA 1ZWLA 3OX4A 4BRUA 4EJFA 3IILA 4YO7A 5A7FA 2IRWA 2VK4A 3ORFA 2DMRA 2HHCA 1KBOA 1QLWA 3CNLA 5DM0A 5JMTA 2QF7A 2XXAA 1XZJA 1ADFA 3MMNA 1M0SA 3WJ1A 5TQVA 1NRXA 1OASA 4QIHA 3ND5A 2RGXA 5KVQA 1EE9A 1A97A 1CVRA 1QXSA 4ZO8A 5TT0A 3WMRA 1E1MA 1AKVA 2XA2A 4CW7A 2BMVA 2ASEA 5EZYA 1KKUA 3W7BA 4MYDA 2H59A 3V6LA 1PO7A 4MZDA 1HYHA 1Z88A 3OIGA 4FCVA 3DP9A 3PVZA 3GCDA 4BEBA 5F9FA 3R5FA 1DKNA 4JGIA 1Z5WA 4LK3A 2G1KA 4D81A 1REQA 4MW6A 2KHZA 1EFRA 3JALA 4BO6A 1E9SA 3B1VA 1ZJYA 2I29A 3BWEA 3D3JA 2H54A 4OB8A 2YNMD 4JB3A 4M9CA 4NDZA 3X1KA 2ID7A 3WKCA 3GJ7A 4MCAA 1O9HA 4JQOA 2WT9A 2AKEA 4HVLA 1I1HA 1Y5RA 1ZNXA 2GASA 4C0BA 4IIDA 2X1MA 3TZCA 4AS1A 3MPUA 2YZ7A 2PUJA 3EXFA 3BUSA 2B5OA 2P9JA 1CWUA 5AVUA 2WFLA 4KNPA 3KZXA 5K3OA 2OGZA 3ROTA 2G5PA 1XEXA 3LLCA 1TGVA 3THWB 1LDNA 4KKVA 4FILA 1ZVKA 2PUWA 1L8LA 1PL8A 3HFSA 3VU1A 2OCDA 2BZ0A 3CLTD 4NJOA 2D7DA 3NC4A 5CFZA 3DOCA 2BMDA 3BHJA 3FPBA 3OJ0A 4FZ5A 2WE8A 4QYTA 4COOA 4KXYA 1E79A 1TCBA 4DLWA 3U44B 2DWQA 1VZ2A 3JAWB 5KCMA 4BP3A 2I99A 3OUUA 4GNKA 1SZCA 3FGNA 4U7HA 1WUIS 4MVJI 3QVXA 3QYPA 4GX1A 4FR0A 4LDZA 2H9AA 4MWGA 2XLBA 3PQ4A 3H9UA 3QWAA 2NADA 4RENA 4LBVA 5IF9A 4XUEA 1GDDA 3T0FA 1D2HA 1L7NA 5GJBA 1XZHA 4AW9A 3AR4A 2BIFA 3DVSX 1TQ4A 1PJTA 2CL5A 1K8QA 3RC2A 4MH0R 1JDPA 4HZGA 1PEKE 3QUTA 4CKCB 1QHYA 2P1DA 4MKIA 1LRJA 3DTNA 1R10A 3AINA 5AYVA 2CLDX 3RRFA 1WO8A 2XHZA 1MA3A 1QLHA 2Q2QA 5ITZA 2MIIA 2ZRLA 5B3JA 3CX4A 2AXNA 3HJTA 5KJ1A 4G0ZA 4XB2A 4UHJA 1FNSA 1RR6A 2OP1A 3C6QA 1BDMA 5AXAA 3N8DA 4B6RA 1FFXA 1K6XA 1QG4A 4I50B 1I4DD 4HQRA 5K20A 5MFZA 3E22A 3PJGA 2WUDA 3CZMA 3H9BA 2EQAA 2FUNB 1OFTA 3WSVA 4OH1A 3EZ7A 1A72A 4CUKA 1FTQA 1VDMA 2VYND 3NJ4A 1W48A 1TF7A 2FWJA 2ZWOA 1V5FA 5ICCA 1L7QA 3AF5A 1EFDN 4WXMA 1LTQA 3JPYA 2CEKA 3M6XA 1IBCA 4KO1S 4TMWA 3DM9B 4YMIA 1DJMA 4MS1A 3R3WA 1CUVA 2A88A 2YINC 3RBZA 3EGCA 3HM2A 5JD4A 5DNCA 3GLFB 3EAFA 4J2TA 5D2CA 1Z5GA 3JQGB 2ATXA 1PIWA 4K9DA 4BLTA 2WZBA 3AF2A 3QY9A 2C84A 1P81A 1R6TA 2ZBFA 4MZXA 3SS9X 4E7OA 3DE6X 1JDZA 1X1RA 4ITUA 4YMHA 5J2UA 2VP5A 1MIOA 2QD3A 2JLVA 3WNCA 1YR8A 2LDBA 5AXBA 1U2GC 1GILA 5B5SA 2ECQA 2NYUA 4L9WA 1GAXA 4GZMA 5BXYA 3U2QA 1WU8A 2QLJA 1BFKA 1Z45A 3FN4A 3RHSA 1JU4A 4CQNA 8MHTA 4TX1A 1HURA 2UVDA 4B3RB 5M2QA 3JWJA 1DJPA 3H2IA 5LMUB 4QULA 3LVFO 2VYFA 5T4BA 1ONSA 3K7EA 1ZN8A 2FFRA 3G8DA 1VL2A 4FLFA 2WUWE 3S1LA 5EQJB 4M0CA 2LV8A 3CH5A 1E69A 2ZJ5A 4FKZA 4ZI7A 3X3HA 1N8NA 1BVYF 1BXZA 2XVXA 3ND8A 4NAVA 2XQFA 3D1VA 1H42A 1O8BA 2JZOA 4J7XA 1THZA 4DJJA 1GFSA 4MP8A 1WBBA 1YONA 1BDJA 5B3AA 2NACA 2QJOA 4BZPA 1MJFA 4F11A 3P0JA 5JSYA 1AE1A 3AT1A 3ZWWA 2QTHA 1CEEA 5F7JA 3NYIA 4LY3A 5EZ5A 1N2IA 1XU7A 1JFVA 3ADKA 5CBPB 4GMKA 3WLIA 4EA7A 1FP2A 2O52A 3FBGA 4V0QA 4FWTA 3PUIA 2Q3BA 3UKDA 1PUIA 1ECBA 4IG4A 1OC4A 3L77A 1CU1A 4JXKA 4JU9A 4GLJA 3CO0S 4JVLA 4WBNA 5IF3A 3CM0A 3AF6A 1G0NA 4C3ZA 1UC4B 4EGFA 5JRDS 1ORTA 3OIVA 1GEGA 4MVCA 3WGKA 5JXGA 4PPFA 4WERA 4L0DA 2CV0A 3RT7A 5EAIA 3EDYA 4CIBA 4BB6A 4FT4A 8ATCA 2CFSA 2JBHA 2RGBA 2X86A 4BNTA 3D2AA 3LHIA 2WRZA 3A7DA 5LNK6 4I1RA 1N0IA 3TTYA 1KC3A 1NNUA 3K96A 2O7VA 4FE3A 4PHFA 3IAS1 1LX6A 1TU4A 3R9KA 1ZL2A 1LVGA 3SHOA 3L4JA 4WCZA 1T9DA 2I76A 3RROA 4DZTA 1OVMA 5EMHA 4LTDA 1NQOA 1N0UA 3WL6A 3PLAE 5AM0A 4CMEA 1HLFA 3CW9A 1DQPA 2I3DA 2QMOA 1FQWA 3IS3A 1B6TA 3L0ZA 3NJ8A 4LX8A 1IB0A 3E6AA 3VR1A 4DT1A 3R3SA 1NFFA 3COPA 3HNPA 3AI1A 1U7UA 3LU1A 4N54A 1ZEJA 2WWIA 3O94A 4XIJA 4B3XA 1BS1A 1XNRB 1UOOA 2ZOSA 2QAGA 3H5AA 5D3MA 3SF8B 5IDVA 4CKXA 1FP4B 1L3BA 4GRIA 2JPDA 1R4MA 4FFBA 3D6HA 5KDOA 4JJKA 2PU5A 2O7RA 2N1MA 2WV9A 4QGFA 5FI5A 4HRYA 1OH5A 3FPGA 3BM5A 3COVA 2H7VA 4YQYA 5L3RA 2XEDA 1OVGA 4AIRA 2H07A 1PT9A 2OXRA 3O73A 4RK6A 5CA1B 3TLGB 1AB5A 1EQ2A 1E1YA 1HRKA 3JQFC 1MIOB 5DI3A