3O4XE

Crystal structure of complex between amino and carboxy terminal fragments of mdia1
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
454
structure length
433
Chain Sequence
VLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein diaphanous homolog 1
publication title Crystal structure of a complex between amino and carboxy terminal fragments of mDia1: insights into autoinhibition of diaphanous-related formins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 128
structure length 433
sequence length 454
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02181 FH2 Formin Homology 2 Domain
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.80 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3o4xE01
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE03
1UX5A 1Y64B 2J1DG 1UX4A 3OBVE 3O4XE 1V9DA 2Z6EA 4EAHA
chains in the Genus database with same CATH superfamily
3OBVE 3ZC0A 2VWAA 5HXEA 4ELSA 1IZNB 3B13A 4DV3T 3A7MA 4JI7T 2X66A 4LFAT 2K9AA 3X1DA 5ABGA 3AE1A 4JI4T 2RPAA 5DQVA 4KX6A 3L3PA 1SUMB 5LMNT 4U31A 3QB5A 5CA1E 3RX6A 4QXBB 1E7PA 5CGMA 4QH4A 1US7B 2IIUA 4AKGA 4NXNT 3NKZA 4DR5T 4UEMA 4JI1T 2XAQB 3LSVA 2NW9A 3RIAA 3CQGB 2N9DA 4CQIA 1W9RA 3FB2A 5LXTE 2PJQA 5HEUA 3VRAA 4ASKA 4NNQA 3Q5XA 2LKHA 5JDHA 5LMUT 5KX5E 2Q9QD 4LF5T 1HFAA 4KMCA 2W0GA 5KDMC 2PG8A 3ZJ1A 4OYKA 4NEKA 2W61A 3PUWF 2HPLA 2HPJA 3KFWX 4XBFB 3HINA 4DV2T 4YSYA 1R8IA 4YJ3E 3LK2B 4HFVA 3RYFE 5IUXA 4G63A 2V26A 3PUZF 4DNDA 2JRKA 3ZMZB 5E0OA 3ZYKA 1YD8G 1O3XA 4U74A 2X9XA 4LFCT 1QSDA 5CA0E 2WCAA 3V5UA 2YDRA 1JNZA 4B3MT 2Q9QC 3OYZA 4WW0A 3ZEFB 5J1GA 4AKIA 3RH3A 5AQIB 3OYXA 3AEEA 2XY8B 5J2UE 2HW5A 2MBGA 4B3TT 4DV6T 2WQYA 4COFA 1N32T 4LF6T 4I50E 3RQGA 4QHOA 4ZU2A 2CHNA 2CRBA 3LK42 3IEEA 4PFOA 3PE0A 5KJPA 4TWFA 1U4QA 4ELXA 1WYCA 4B3ST 2M6BA 3ZCJA 2MOZA 3E08A 3PUGA 3SRZA 3O1HA 5JBXA 3Q2MA 4DV4T 2N2NA 2BKNA 3LK3B 2D0UA 1KK7A 3AEDA 4BJNA 3L09A 2A9UA 5KMGP 3I0OA 4K2NA 2E9XA 4HGAA 3MXZA 4H63H 5AQJB 1HNZT 2BDEA 3R6NA 5ABEA 3EI0A 2WAUA 5FY1A 4YTMA 4BJMA 1I94T 3C64A 4JV5T 4JI6T 2LSIA 4P09A 4O4IE 3L8RA 3ADDA 5F8PA 2EJ5A 1YKEB 5BR8T 4FJWD 3GA8A 4PJMA 4MFRA 1OXZA 2X67A 5AFUL 3H02A 3AXJB 1MIVA 1WZ8A 3ONXA 4H9RC 3RI5A 1D0YA 2UXBT 5AQRB 2L8KA 3JADA 5HCJA 3L39A 1V9DA 1ZP0A 4UVBB 4HE8A 2UU9T 2FW2A 1CUNA 2JMHA 2V8SV 2NW8A 4HFDA 3LDQB 4NUVA 4TV9E 3FHNA 3FXDB 3UUBA 2C0SA 3RYHE 4EV6A 3PUYF 4EYYR 4YSXA 4U2YA 5LCYA 3R0OA 1KNPA 1D1AA 4JI5T 3A4NA 2X0YA 2XQ3A 5HXRA 1UX4A 5HEOA 5EK3A 2WDRA 4YTNA 1D0XA 3N9NA 2X68A 3KQFA 3AA7B 2UUBT 4CN6A 4HFIA 4ISTA 4IL4A 2WP9A 4IDNA 3AA1B 3RRWA 4EZ4A 2Q9QB 1IJ5A 2BBHA 3CWZB 5L3FB 4DO0A 5HAXA 3UU8A 4AQGA 5EK2A 4EZHA 1RJNA 2BVMA 4OLQA 3MZKB 2BBJA 4YJ2E 4PJNA 4FZWA 2XQAA 3CX7B 1WRDA 3ZKRA 1X9BA 2J47A 2LLYA 5JTGA 5ABFB 5HEGA 4EXTA 1WR0A 1FEWA 3MA9A 2VQET 2CEAA 4FZWC 4AI6A 3O4XE 2LHRA 3AVSA 4AQFC 2GK9A 4UF0B 3FZKB 3G64A 2ZMAA 4UV8B 2XUEA 5C8YE 3AE8A 2XASB 3Q5EA 4JEUB 4F47A 5ABHA 4I43B 5JDNA 3R9TA 2JJ9A 5H6QB 2IHR1 3HR0A 4U2ZA 4K3WA 2C5IT 2IDOB 1BR2A 3N9PA 4UELA 2J4GA 3RYCE 3HKDE 2CLYC 4KHZF 5HEJA 1HX1B 4IE6A 2X9WA 3QUJA 3SFDA 3SLLA 3CQCB 4GYRA 2LSKA 2XSBA 2ZM8A 4QWNB 3KDSE 5JH7E 3AVRA 3A4LA 2OA5A 2UXXB 2VB6A 4EB6E 2XQ7A 3EDVA 4A98A 2CA5A 3CQXC 4IE5A 1DCIA 1EF9A 5L2LA 3AAEB 4GYSA 5LNKA 1FIOA 1MMAA 4L5GA 3W8IB 4Z90A 4CXYA 2BG9A 1OEDA 2VASA 1T98A 3C4ZA 1NEKA 3ZMTB 5FVLA 3Q0GA 3QXZA 4ZS3A 2XSAA 2W2UA 2CXFA 2EHOA 5DABA 3AEBA 4X64T 3IF8B 2A72A 3M3ZB 3F57A 1OWAA 3ZN1B 4QXHB 3E0ZA 2JMKA 4KP3C 3SS1A 2PPYA 1HZDA 4YY3T 4U18A 1BR1A 4NIQA 4MOUA 3I9YA 2E8IA 4MALA 3NZPA 4HWDA 5CB4E 1MMDA 2EHOC 2NP9A 4X5TA 2WSSV 2XAFB 5JDFA 3P4SA 1WCRA 4Z8XA 2OLTA 4P0BA 3KVAA 3ZPOA 2QGSA 3PURA 3T8AA 3AEGA 4HFHA 1UURA 2FBMA 2WWUA 4ILAA 1Y01A 3HKCE 4EMLA 3FZMB 3JC6D 5CFBA 4A56A 4PFPA 3KV4A 4PJLA 4DBRA 5IYZE 1HTJF 4AKRB 4DR2T 3HKBE 3ZSSA 1ZV4X 2I59A 2JQ9A 5JDMA 3UULA 2XAGB 2NTYA 5JRCA 4YHJA 4JUYA 3RF1A 3U78A 3I9WA 3V5SA 4DMWA 3TKLB 3RQEA 4HWIB 5JREA 1HG5A 2XM1A 4UXNB 5FP3A 2K5BB 3CIRA 3C4XA 4JWVA 3EABA 3JC6C 4YLHA 4DVDA 1ZKEA 2CPTA 2IW5B 4OG1A 5AQKB 3UU6A 2GTRA 5C9GA 2ZM6T 1VCSA 4P1NA 1N33T 3RQFA 4IDZA 1NAFA 2WU5A 4OK0A 2ES0A 3NVOA 5JR9A 3RPUA 4PK5A 2CM0A 4UR9A 3U3IA 4H9NC 2N1GA 1WLXA 4G2AA 2BG9E 2ACXA 1OEDE 3OJAA 5FXVA 1Z8UA 2XQ6A 5JR9C 2J1DG 2UXNB 2MYSA 4WZXA 2HH7A 3ESLA 3UU5A 3NRXA 5ADXL 2CLYB 2ZLYA 2LRKA 4H9OC 3OTOT 4CI2B 3RSIA 1EY3A 3ZN0B 3IRBA 3ADCA 2W67A 1UUSA 2BVLA 4YSZA 4QH5A 2VX2A 3VKGA 4HN9A 1HF8A 2C5JA 4AKLA 2CXDA 1W09A 1S35A 4OHFA 2CBJA 5HWYA 4YT0A 1NZYB 2W63A 2XTLA 3EAMA 3Q5DA 1EF8A 4FJOA 4J2CA 4DV7T 4NPPA 1BR0A 1J5WA 2CBIA 4HFCA 4ZI7E 2A3DA 3P50A 4DBQA 3M65A 1ZHCA 4CXWA 3QOFA 3I47A 3AE7A 3RKOA 3ANWB 4GOUA 3HA4A 1EZ3A 1W0AA 1HS7A 2DNXA 2K24A 5LG3A 3P4PA 1NWMX 4O8SA 3ONJA 1YW0A 5LGTB 5GONE 1IJ6A 2E9XD 3T88A 4ILUA 2VURA 4JFCA 3CPZA 3IA3A 4IDPA 3AB3B 4YTPA 1XNQT 4EYUA 2VK9A 3N9OA 3ZCIA 4PK4A 3ONLC 1XDPA 3MK7C 2WZHA 4WNKA 4JEHB 3F31A 3RQWA 1UCUA 4DUZT 4O2BE 3ABVA 2PBPA 3PUQA 3UU4A 2JQKA 3WAKA 3ZYLA 2X9YA 5HYAA 4MI2A 2WU2A 2DHRA 2WZIA 3GN5A 4X62T 3VKHA 2V6XA 2XQ4A 5DJQC 2WDQA 3ZLIA 2CCQA 2E9XC 4MHCA 4AXPA 4U72A 2FJEA 4LFBT 5FY7A 5L4HA 3P4RA 3QXIA 2D0TA 1YQ4A 4GEHB 2FUPA 5C3JA 3MKDA 4ZS2A 2UZFA 3J7Yq 4U19A 2MPKA 3UT5E 5LHIB 2AE9A 3B5MA 4NXMT 3PU8A 2WS3A 4OX9T 2Y6XA 4C91A 3UTKA 1E1HB 3ADBA 1YQ3A 2HHHT 4NUUA 5FXWA 1DUBA 2XQ8A 3ZMUB 4GKKT 2LSYA 3CKDA 2AXDS 2V7JA 3L8IA 2DI4A 4GK5E 2ZQRA 3N9LA 4GK0E 4JYAT 4U7IA 5AQFB 4UIGA 3RIFA 3KV6A 2UUCT 4JI0T 2I0MA 5FKYA 1XWMA 3AE4A 4PJJA 4ZI3D 2V7IA 5JR9B 1Z0PA 2UUAT 3KBUA 5LBQB 2RP4A 3G06A 2X51A 4QX8B 2LEHA 2D5UA 4I55E 2JQQA 4UVAB 4Z91A 2K3WA 2X0LB 3FDUA 2OV9A 5AQUB 2UXCT 2NOXA 2I6HA 2KZ7B 3GWHA 4U7YA 3ZT7A 4ZI3C 1UX5A 2YN6A 2VKDA 3E22E 3PUAA 4EIWA 3DTOA 4TUYE 1Q52A 4ILCA 2R6GF 2XAJB 1YKHB 1UIYA 4IL9A 4DMVA 1MIYA 5AQGB 4LF7T 5JBWA 2BS2A 5L3CB 1KNRA 1MNEA 2YU2A 4ERRA 1I6ZA 4F6RC 2QYWA 4WCZA 1AJ3A 3K3QC 3AE9A 3W15B 4L9IA 2DWKA 2ACZA 2XZEA 4CZZB 5TAOA 5HXHA 2NR4A 2B76A 4CI1B 4H63V 1LKXA 3JAFA 2E2AA 3AECA 4O4HE 4TNWA 2M67A 4DR3T 3OKQA 1VCTA 4DUYT 4CN1A 4ILBA 4MBQA 2FJDA 1HR0T 5F3JA 4ISSA 3O1IA 4I42A 5LGUB 4BAYB 2PFVA 3PUSA 3R9SA 2FJBA 4L0RA 1IBKT 5L3GB 4ZEYA 3MYBA 4HWFA 5J0ZA 5F5WA 2XHEB 4H9PC 1HG2A 2YK0A 2E9XB 2UXDT 2H88A 3Q9DA 1X79A 3RC3A 2LJLA 3PTRB 3GN5B 4IDOA 2DLRA 4AIUA 2XM2A 4B6XA 4N78D 5LA6E 1G8XA 2WMNA 3PZKA 1WR6A 4WYVA 4OYJA 2EHOD 4GKJT 4HEAA 2IC9A 4CN4A 4IE0A 3QC9A 4HTEA 3H81A 3UUMA 1JXZA 2ODVA 1IAPA 1VOMA 4TNVA 1D1BA 2E5VA 1M62A 5AQMB 5LJNA 3CX8B 5FXXA 4ZI2D 2IAKA 2JIWA 4O2AE 3J9X1 4PNIA 2BG9C 1OEDC 4TV8E 2MAWA 2KSRA 2E5LT 2LT3A 3ZT6A 4UV9B 1NENA 3VRBA 3N9QA 3RC8A 1WYBA 4LMJA 2YU1A 2QRXA 4YHHT 4LMKA 2LSGA 5AQTB 5FL1A 1S94A 2KWHA 4QX7B 2L9QA 3RHWA 3CX6B 4M1PA 3JCFA 4JBWF 3MOYA 3FZFB 3C4WA 2M6IA 3P4WA 1E2AA 4DV1T 1U5PA 4ZI2C 2V6YA 1RJMA 1FMWA 4JYLA 2DUBA 1SE7A 4GIWA 5FYMA 3O1JA 5L4EA 3GMIA 3QK8A 4IIJE 3NZQA 1KFYA 4O4LE 4JI3T 1HCIA 4HFBA 4CXXA 5AQOB 5AQLB 1IBLT 1JNRA 2VVNA 3P7IA 5AQSB 3C51A 3AXJA 4C90A 3TLTA 2H3RA 4IDQA 3RGLA 2CWYA 1T8BA 2VL8A 4WBOA 3NRYA 4EEBA 3UFEA 4DR6T 5LJMA 3JAEA 2YOEA 5BMVE 3FZLB 3LFMA 3VR9A 4IREA 5LP6E 4ZZBA 5L3DB 3RQUA 3KVBA 3CVRA 2JPFA 2H7OA 2NTXA 4DIDB 3H3MA 2YDQA 4LMLA 4UVCB 1YXRA 5FMNA 2V7MA 2A2FX 4TWDA 2VKOA 2ZQQA 4BA9A 2QA7A 1MJ3A 4TZ4C 2CWOA 4IHJE 3Q1TA 4DR7T 4HKAA 2IMLA 5J2TE 3PJAJ 5ETWA 3P8CD 2VKJA 4EGWA 2P9BA 2KMFA 3AEFA 3FZHB 3B57A 2LM2A 4H9QC 2V1DB 5DQWA 2KWIB 4JI2T 5KXJA 3HL6A 2F4VT 4QXCB 2Q9QA 1G73A 5FY0A 3T1HT 4IGUA 4MLKA 2W4XA 4O4JE 3TLFA 3LBXA 3VU7H 1CHUA 3ZC1A 4I0UA 3ZJ2A 2W00A 3AE2A 3EVYA 3N2GE 4LF9T 2WBLA 3VR8A 3KBTA 5EZYE 3UUXB 1XDOA 5LHGB 4ZZCA 5A1LA 1B7TA 1DU2A 3KV5A 4EAHA 3D0TA 3Q5WA 4U3CA 4YFSA 2RA1A 5IHYA 1N36T 5ABFA 2BG9B 3RIUA 5JDQA 1OEDB 3O9XA 2QVAA 3RKGA 4KUMB 2FBWA 5M4YA 5JQGE 2W66A 2BS4A 2MTQA 3PJAA 2EHOB 3HKEE 1UK5A 5LHHB 3ZSTA 4F8HA 4DR4T 2BKOA 3ETUA 4JCSA 2LKGA 4UF0A 1KF6A 3RIUC 4HWCA 3N5LA 5HXSA 3BK9A 2HN1A 3K8PC 3N2OA 4KNPA 1L0VA 2LSJA 3W8HB 3AA0B 4X1YE 2LRLA 3TLSA 3KINB 2LHNA 4P0AA 1T7SA 3R84B 2KT9A 4KI0F 3AEAA 2X9HA 2J62A 3H3AA 4QIIA 1IBMT 5JDLA 1QLBA 2KINB 3PDYA 3TRRA 2KXPB 3AE3A 2V6YB 3H37A 4E7ZA 2DCFA 3EUHA 3L8JA 1SHZC 5JVDE 1VRBA 1LVFA 5JRCB 2CMRA 2VVSA 3UUNA 3ETVA 5AQPB 3TLVA 3AM1A 3UQ7A 4ANJA 3ZT5A 3ZMSB 3LJCA 3K1SA 4U1AA 2C5KT 5AQNB 2FJAA 3PV0F 1FJGT 2JQHA 4IE7A 2CHOA 4IZDA 2YKSA 2PTFA 2WB5A 1HX8A 2QQ3A 4AKHA 5EK4A 4I52A 4CI3B 1MNDA 4JLEA 3RLFF 5LGNB 4LF8T 5HXCA 1UGOA 3AJMA 3PUXF 1T72A 4U33A 4PW8A 2HN2A 4IZBA 3FXEB 2VQFT 1BR4A 1FMVA 2H7VC 5FNVE 2ODUA 4IT4A 2KLQA 3VHLA 2V5CA 3Q0JA 2WY2A 2WWVA 1MMGA 3PU3A 4DV0T 3QK6A 1Q51A 2BKPA 3N2KE 2BS3A 3FBLA 4EOZB 5AQQB 4I4TE 1WFDA 4WBNE 3QB5K 1XMOT 3OC7A 2IUBA 3S4UA 4DV5T 2CE7A 1MMNA 1SA0E 3P5MA 1GQEA 4LF4T 1D1CA 3NBXX 2CXLA 2LE8A 2XQYA 3AAIA 4ZHQE 4ZOLE 2Z6EA 5LG4A 1KEYA 4H9SE 1XNRT 3K3OA 2XAHB 2KNDA 4A5XA 1D0ZA 3LBXB 4XAXB 2PBIA 2D2SA 2NW7A 3UU3A 3MJXA 2VREA 3A4MA 3AE6A 4TX5A 3OPCA 2VL0A 2W62A 3A8YC 1W0BA 5AQHB 2YINA 2Y48B 4X20E 2SPCA 3WAJA 2XPKA 4X1KE 4K0KT 2DL1A 2V5DA 4IE4A 4YXDA 3UFGA 2P63A 3BQKA 3LG7A 3AA6B 3F2EA 2IC6A 4HWHA 4PK6A 1J5ET 4ELWA 3IBPA 4AQFA 1XZYA 3SWXA 3SWHA 4IZCA 3I1AA 5AQVB 2LOSA 2V7LA 3BQIA 2ZM2A 2NWBA 3C50A 3FBZA 4JI8T 2BZBA 5HEHA 4XZCA 4QIJA 2YEVC 3WI3A 4V1Av 4KHPT 3ZMVB 5L47A 3DJBA 1ZEEA 4DR1T 2ZM0A 4B3RT 2WDVA 3N9MA 2XQ9A 3AE5A 5JDGA 2LM9A 4EEDA 3HRXA 4X66T 3NWIA 2Y8DA 3A5XA 2X0HA 1LRZA 4OFZA 5FL0A 2IEXA 2LOPA 3HI2A 3QNUA 5CJ5A 1KNZA 1LVKA 2XJ7A 2YDSA 3ZYMA 1J1JA 2DWGA 1NZYA 5FVKA 4ZXLA 2V7KA 3RRCA 5L3BB 3CMLA 3RYIE 1H7CA 2L3LA 1MIWA 2F6QA 3KV9A 5C2TA 3TLUA 3EDUA 2H89A 5FXZA 3PUVF 4KBMB 3SFEA 3IHRA 3T8OA 3I0QA 3ANWA 5LB7B 1XMQT 4AISA 3UQ4A 2K48A 4PAGA 4QH1A 4X65T 1QUUA 5HCMA 5H6RB 3T89A 2WM9A 1HNWT 3BQLA 1Y64B 4I4ZA 4FI5A 4TWHA 5IWAT 1N34T 5L3EB 3MACA 5LYJE 5LOVE 4ADZA 4Q25A 4TN7B 3K3NA 2D9DA 4A97A 4JOTA 2WMOA 4AQYT 3DP7A 1M7KA 3P4QA 3AAAB 4QKNA 2VKHA 1ZOYA 4X1IE 5LBMA 3EHZA 3OVUA 4HFEA 3SOLA 2B1EA 3TLWA 3T1YT 4K0UA 3CK6A 2XQ5A 3C98B 4E7SA 1HNXT 2G0UA 5HWXA
chains in the Genus database with same CATH topology
2WBLA 2XASB 3OBVE 3N9LA 3KBTA 4GK0E 3ZC0A 2VWAA 5EZYE 3UUXB 5HXEA 5LHGB 4JEUB 4UIGA 5A1LA 1B7TA 4I43B 3KV5A 1IZNB 3KV6A 3D0TA 3B13A 4EAHA 3Q5WA 5JDNA 4YFSA 2RA1A 2JJ9A 5H6QB 2X66A 3HR0A 5IHYA 2K9AA 4PJJA 4ZI3D 2V7IA 5JDQA 2C5IT 3O9XA 5JR9B 1BR2A 3N9PA 4UELA 4KUMB 3RYCE 1Z0PA 5M4YA 5DQVA 3HKDE 2CLYC 3KBUA 3L3PA 5LBQB 5JQGE 4IE6A 2MTQA 2RP4A 2X9WA 2EHOB 3QUJA 3HKEE 5LHHB 2X51A 3CQCB 4QX8B 4GYRA 2LEHA 2LSKA 2D5UA 3ETUA 2ZM8A 4I55E 2JQQA 4QWNB 4UF0A 5CA1E 3RX6A 3N5LA 3KDSE 5HXSA 5JH7E 3AVRA 4QXBB 3A4LA 2OA5A 2UXXB 3BK9A 4UVAB 1US7B 3K8PC 4AKGA 2VB6A 3N2OA 2X0LB 4EB6E 2LSJA 4UEMA 3EDVA 2XAQB 3W8HB 2CA5A 3AA0B 3CQXC 4IE5A 4X1YE 2NW9A 3KINB 2LHNA 5L2LA 3AAEB 4GYSA 4P0AA 2NOXA 3CQGB 2N9DA 5LNKA 1FIOA 2KZ7B 1MMAA 3GWHA 3R84B 4CQIA 2KT9A 3FB2A 4L5GA 5LXTE 2PJQA 4ZI3C 3W8IB 1UX5A 2X9HA 4ASKA 4NNQA 4CXYA 3Q5XA 3H3AA 2VASA 1T98A 2VKDA 3C4ZA 3E22E 3PUAA 5JDLA 5JDHA 4EIWA 5KX5E 2Q9QD 1HFAA 3DTOA 3ZMTB 2KINB 4TUYE 4KMCA 2W0GA 5KDMC 3PDYA 4ZS3A 2KXPB 2PG8A 2XAJB 3ZJ1A 1YKHB 4OYKA 2W61A 2CXFA 2EHOA 3H37A 5DABA 4E7ZA 3IF8B 2A72A 2HPLA 2HPJA 3F57A 3KFWX 4DMVA 4XBFB 2DCFA 1MIYA 1OWAA 3EUHA 3ZN1B 3L8JA 4QXHB 1SHZC 5JVDE 3E0ZA 3LK2B 4HFVA 4YJ3E 3RYFE 1MNEA 2JMKA 2YU2A 4KP3C 1VRBA 1LVFA 3SS1A 4ERRA 4F6RC 1AJ3A 5JRCB 1BR1A 3I9YA 4G63A 2E8IA 3K3QC 4MALA 2CMRA 2V26A 3NZPA 3W15B 4L9IA 5CB4E 2DWKA 3UUNA 1MMDA 2EHOC 2NP9A 4DNDA 3ETVA 2WSSV 2XAFB 2JRKA 3AM1A 5JDFA 4CZZB 5TAOA 3ZMZB 4ANJA 5HXHA 4Z8XA 5E0OA 3ZYKA 1YD8G 4P0BA 3LJCA 3ZMSB 1O3XA 3KVAA 4U74A 2X9XA 3ZPOA 4CI1B 1QSDA 2C5KT 2QGSA 3PURA 4H63V 5CA0E 1LKXA 4IE7A 2WWUA 3V5UA 4O4HE 1HX8A 3HKCE 2M67A 4AKHA 3OKQA 5EK4A 2Q9QC 4CI3B 4MBQA 1MNDA 3JC6D 4JLEA 3OYZA 4WW0A 4A56A 3ZEFB 4PFPA 3KV4A 5LGNB 5J1GA 4AKIA 5F3JA 4PJLA 5HXCA 3RH3A 4ISSA 3AJMA 4DBRA 3O1IA 5IYZE 1HTJF 5LGUB 4AKRB 4PW8A 4BAYB 2PFVA 3PUSA 3OYXA 4L0RA 5J2UE 3HKBE 5L3GB 2MBGA 1ZV4X 2I59A 4I50E 5JDMA 3FXEB 3UULA 3RQGA 2XAGB 2NTYA 1BR4A 1FMVA 4QHOA 2XHEB 5JRCA 2H7VC 5FNVE 4YHJA 4JUYA 4H9PC 1HG2A 2YK0A 3U78A 3LK42 2ODUA 3I9WA 3V5SA 2E9XB 2KLQA 3VHLA 4DMWA 3IEEA 3TKLB 3Q9DA 4PFOA 1X79A 3RQEA 1MMGA 3RC3A 2LJLA 3PE0A 5JREA 1HG5A 3PU3A 3QK6A 4UXNB 3PTRB 1U4QA 5FP3A 3GN5B 2K5BB 2DLRA 3N2KE 3C4XA 1WYCA 4B6XA 3JC6C 3FBLA 4YLHA 4N78D 5LA6E 1G8XA 2WMNA 4DVDA 1WR6A 1ZKEA 3ZCJA 2MOZA 4EOZB 3E08A 2IW5B 3PUGA 3SRZA 4I4TE 3O1HA 4OYJA 2EHOD 4WBNE 4HEAA 3S4UA 2CE7A 2IC9A 1MMNA 4IE0A 1SA0E 3QC9A 3RQFA 4HTEA 3Q2MA 3UUMA 4IDZA 2ODVA 1IAPA 1D1CA 2N2NA 1VOMA 3NBXX 1NAFA 3AAIA 2CXLA 2LE8A 2XQYA 4ZHQE 4OK0A 4ZOLE 2ES0A 3LK3B 2D0UA 1KK7A 2Z6EA 4BJNA 5LG4A 5JR9A 3RPUA 3L09A 4PK5A 4H9SE 1D1BA 2CM0A 2XAHB 3K3OA 3I0OA 5KMGP 3U3IA 2KNDA 4H9NC 2N1GA 2E9XA 1D0ZA 1WLXA 3LBXB 4HGAA 4XAXB 3MXZA 4H63H 5LJNA 2PBIA 2D2SA 4G2AA 2NW7A 3CX8B 5FXXA 4ZI2D 2BDEA 2ACXA 3R6NA 2IAKA 3MJXA 4O2AE 3J9X1 4PNIA 2WAUA 3OJAA 5FY1A 4TV8E 3A4MA 4BJMA 5FXVA 4TX5A 5JR9C 2W62A 2J1DG 2UXNB 2LT3A 4UV9B 3C64A 3N9QA 2YINA 3RC8A 2MYSA 2Y48B 2LSIA 4X20E 2SPCA 2HH7A 3ESLA 1WYBA 3WAJA 4P09A 2YU1A 3NRXA 4O4IE 5ADXL 2CLYB 2ZLYA 4X1KE 4IE4A 4H9OC 2P63A 3BQKA 2LSGA 3LG7A 3ADDA 3AA6B 3F2EA 5F8PA 1S94A 2IC6A 2KWHA 1YKEB 4PK6A 4CI2B 3ZN0B 3GA8A 3IRBA 3ADCA 4QX7B 3IBPA 4AQFA 4PJMA 4MFRA 2BVLA 2L9QA 3SWHA 3CX6B 4M1PA 1OXZA 2X67A 5AFUL 3VKGA 4HN9A 1HF8A 2C5JA 4AKLA 2CXDA 3I1AA 1MIVA 1S35A 2LOSA 2V7LA 3BQIA 2ZM2A 2NWBA 3C50A 3FBZA 3ONXA 4H9RC 1D0YA 4OHFA 3C4WA 5HWYA 2BZBA 4XZCA 2W63A 2YEVC 2XTLA 2L8KA 3WI3A 1U5PA 4ZI2C 4V1Av 1RJMA 3ZMVB 4FJOA 4J2CA 3DJBA 1FMWA 1V9DA 1ZEEA 1BR0A 2ZM0A 4HE8A 4UVBB 4ZI7E 4GIWA 1CUNA 2JMHA 5FYMA 3N9MA 2NW8A 3O1JA 3GMIA 2A3DA 4NUVA 5JDGA 4DBQA 3M65A 1ZHCA 4TV9E 4CXWA 3FHNA 2LM9A 3FXDB 3RKOA 3ANWB 2C0SA 2Y8DA 3A5XA 3RYHE 4GOUA 4IIJE 3HA4A 1EZ3A 3NZQA 4O4LE 4EYYR 1HCIA 1LRZA 4CXXA 1HS7A 2DNXA 2K24A 4OFZA 5LCYA 2LOPA 1D1AA 3HI2A 3P7IA 1NWMX 3A4NA 4O8SA 3C51A 5L3CB 1YW0A 5LGTB 4C90A 1KNZA 1LVKA 5GONE 2H3RA 5HXRA 1UX4A 1IJ6A 2CWYA 5EK3A 2E9XD 4ILUA 3ZYMA 1D0XA 2DWGA 2VL8A 3N9NA 4WBOA 3CPZA 2X68A 3NRYA 3AA7B 2V7KA 3RRCA 3AB3B 5L3BB 3CMLA 3RYIE 3UFEA 1H7CA 5LJMA 4ISTA 4EYUA 2VK9A 5BMVE 2L3LA 1MIWA 3N9OA 3LFMA 3KV9A 3ZCIA 4PK4A 3AA1B 3EDUA 5FXZA 3RRWA 4EZ4A 2Q9QB 4KBMB 1IJ5A 3MK7C 4WNKA 5LP6E 4JEHB 3F31A 3IHRA 1UCUA 5L3DB 3CWZB 3T8OA 3I0QA 3ANWA 3KVBA 3CVRA 4O2BE 5HAXA 3PUQA 4DO0A 5L3FB 2JPFA 3WAKA 2K48A 2H7OA 2NTXA 4PAGA 3ZYLA 2X9YA 1QUUA 4UVCB 4AQGA 5EK2A 5FMNA 2V7MA 2A2FX 4EZHA 5H6RB 2BVMA 5HYAA 2VKOA 2DHRA 3GN5A 3MZKB 4BA9A 2WM9A 2QA7A 3BQLA 1Y64B 3VKHA 4TZ4C 5DJQC 4FI5A 2CWOA 4YJ2E 3ZLIA 2CCQA 2E9XC 4MHCA 4IHJE 4AXPA 4U72A 4PJNA 5L3EB 3MACA 5LYJE 4HKAA 5FY7A 5LOVE 5J2TE 5ETWA 3CX7B 4ADZA 3P8CD 4TN7B 3K3NA 2D0TA 1WRDA 2P9BA 2VKJA 2WMOA 2KMFA 4GEHB 4EXTA 3DP7A 3B57A 1FEWA 3MKDA 4H9QC 4ZS2A 3MA9A 2V1DB 3AAAB 5DQWA 3J7Yq 2CEAA 2KWIB 3HL6A 4QKNA 3UT5E 2VKHA 5LHIB 4QXCB 4AI6A 2Q9QA 3O4XE 4X1IE 5LBMA 1G73A 3PU8A 5FY0A 3SOLA 2LHRA 2B1EA 3AVSA 2Y6XA 4C91A 4IGUA 4AQFC 4MLKA 1E1HB 4K0UA 4O4JE 3ADBA 2GK9A 4UF0B 3UTKA 3LBXA 3VU7H 4NUUA 5FXWA 3ZC1A 3C98B 2ZMAA 3ZMUB 4UV8B 4E7SA 2XUEA 3ZJ2A 2W00A 2LSYA 3EVYA 3CKDA 2V7JA 3N2GE 3L8IA 2DI4A 2G0UA 5C8YE 5HWXA 4GK5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX5 A;  1Y64 B;  2J1D G;  1UX4 A;  3OBV E;  3O4X E;  1V9D A;  2Z6E A;  4EAH A; 
#chains in the Genus database with same CATH topology
 3OBV E;  3ZC0 A;  2VWA A;  5HXE A;  4ELS A;  1IZN B;  3B13 A;  4DV3 T;  3A7M A;  4JI7 T;  2X66 A;  4LFA T;  2K9A A;  3X1D A;  5ABG A;  3AE1 A;  4JI4 T;  2RPA A;  5DQV A;  4KX6 A;  3L3P A;  1SUM B;  5LMN T;  4U31 A;  3QB5 A;  5CA1 E;  3RX6 A;  4QXB B;  1E7P A;  5CGM A;  4QH4 A;  1US7 B;  2IIU A;  4AKG A;  4NXN T;  3NKZ A;  4DR5 T;  4UEM A;  4JI1 T;  2XAQ B;  3LSV A;  2NW9 A;  3RIA A;  3CQG B;  2N9D A;  4CQI A;  1W9R A;  3FB2 A;  5LXT E;  2PJQ A;  5HEU A;  3VRA A;  4ASK A;  4NNQ A;  3Q5X A;  2LKH A;  5JDH A;  5LMU T;  5KX5 E;  2Q9Q D;  4LF5 T;  1HFA A;  4KMC A;  2W0G A;  5KDM C;  2PG8 A;  3ZJ1 A;  4OYK A;  4NEK A;  2W61 A;  3PUW F;  2HPL A;  2HPJ A;  3KFW X;  4XBF B;  3HIN A;  4DV2 T;  4YSY A;  1R8I A;  4YJ3 E;  3LK2 B;  4HFV A;  3RYF E;  5IUX A;  4G63 A;  2V26 A;  3PUZ F;  4DND A;  2JRK A;  3ZMZ B;  5E0O A;  3ZYK A;  1YD8 G;  1O3X A;  4U74 A;  2X9X A;  4LFC T;  1QSD A;  5CA0 E;  2WCA A;  3V5U A;  2YDR A;  1JNZ A;  4B3M T;  2Q9Q C;  3OYZ A;  4WW0 A;  3ZEF B;  5J1G A;  4AKI A;  3RH3 A;  5AQI B;  3OYX A;  3AEE A;  2XY8 B;  5J2U E;  2HW5 A;  2MBG A;  4B3T T;  4DV6 T;  2WQY A;  4COF A;  1N32 T;  4LF6 T;  4I50 E;  3RQG A;  4QHO A;  4ZU2 A;  2CHN A;  2CRB A;  3LK4 2;  3IEE A;  4PFO A;  3PE0 A;  5KJP A;  4TWF A;  1U4Q A;  4ELX A;  1WYC A;  4B3S T;  2M6B A;  3ZCJ A;  2MOZ A;  3E08 A;  3PUG A;  3SRZ A;  3O1H A;  5JBX A;  3Q2M A;  4DV4 T;  2N2N A;  2BKN A;  3LK3 B;  2D0U A;  1KK7 A;  3AED A;  4BJN A;  3L09 A;  2A9U A;  5KMG P;  3I0O A;  4K2N A;  2E9X A;  4HGA A;  3MXZ A;  4H63 H;  5AQJ B;  1HNZ T;  2BDE A;  3R6N A;  5ABE A;  3EI0 A;  2WAU A;  5FY1 A;  4YTM A;  4BJM A;  1I94 T;  3C64 A;  4JV5 T;  4JI6 T;  2LSI A;  4P09 A;  4O4I E;  3L8R A;  3ADD A;  5F8P A;  2EJ5 A;  1YKE B;  5BR8 T;  4FJW D;  3GA8 A;  4PJM A;  4MFR A;  1OXZ A;  2X67 A;  5AFU L;  3H02 A;  3AXJ B;  1MIV A;  1WZ8 A;  3ONX A;  4H9R C;  3RI5 A;  1D0Y A;  2UXB T;  5AQR B;  2L8K A;  3JAD A;  5HCJ A;  3L39 A;  1V9D A;  1ZP0 A;  4UVB B;  4HE8 A;  2UU9 T;  2FW2 A;  1CUN A;  2JMH A;  2V8S V;  2NW8 A;  4HFD A;  3LDQ B;  4NUV A;  4TV9 E;  3FHN A;  3FXD B;  3UUB A;  2C0S A;  3RYH E;  4EV6 A;  3PUY F;  4EYY R;  4YSX A;  4U2Y A;  5LCY A;  3R0O A;  1KNP A;  1D1A A;  4JI5 T;  3A4N A;  2X0Y A;  2XQ3 A;  5HXR A;  1UX4 A;  5HEO A;  5EK3 A;  2WDR A;  4YTN A;  1D0X A;  3N9N A;  2X68 A;  3KQF A;  3AA7 B;  2UUB T;  4CN6 A;  4HFI A;  4IST A;  4IL4 A;  2WP9 A;  4IDN A;  3AA1 B;  3RRW A;  4EZ4 A;  2Q9Q B;  1IJ5 A;  2BBH A;  3CWZ B;  5L3F B;  4DO0 A;  5HAX A;  3UU8 A;  4AQG A;  5EK2 A;  4EZH A;  1RJN A;  2BVM A;  4OLQ A;  3MZK B;  2BBJ A;  4YJ2 E;  4PJN A;  4FZW A;  2XQA A;  3CX7 B;  1WRD A;  3ZKR A;  1X9B A;  2J47 A;  2LLY A;  5JTG A;  5ABF B;  5HEG A;  4EXT A;  1WR0 A;  1FEW A;  3MA9 A;  2VQE T;  2CEA A;  4FZW C;  4AI6 A;  3O4X E;  2LHR A;  3AVS A;  4AQF C;  2GK9 A;  4UF0 B;  3FZK B;  3G64 A;  2ZMA A;  4UV8 B;  2XUE A;  5C8Y E;  3AE8 A;  2XAS B;  3Q5E A;  4JEU B;  4F47 A;  5ABH A;  4I43 B;  5JDN A;  3R9T A;  2JJ9 A;  5H6Q B;  2IHR 1;  3HR0 A;  4U2Z A;  4K3W A;  2C5I T;  2IDO B;  1BR2 A;  3N9P A;  4UEL A;  2J4G A;  3RYC E;  3HKD E;  2CLY C;  4KHZ F;  5HEJ A;  1HX1 B;  4IE6 A;  2X9W A;  3QUJ A;  3SFD A;  3SLL A;  3CQC B;  4GYR A;  2LSK A;  2XSB A;  2ZM8 A;  4QWN B;  3KDS E;  5JH7 E;  3AVR A;  3A4L A;  2OA5 A;  2UXX B;  2VB6 A;  4EB6 E;  2XQ7 A;  3EDV A;  4A98 A;  2CA5 A;  3CQX C;  4IE5 A;  1DCI A;  1EF9 A;  5L2L A;  3AAE B;  4GYS A;  5LNK A;  1FIO A;  1MMA A;  4L5G A;  3W8I B;  4Z90 A;  4CXY A;  2BG9 A;  1OED A;  2VAS A;  1T98 A;  3C4Z A;  1NEK A;  3ZMT B;  5FVL A;  3Q0G A;  3QXZ A;  4ZS3 A;  2XSA A;  2W2U A;  2CXF A;  2EHO A;  5DAB A;  3AEB A;  4X64 T;  3IF8 B;  2A72 A;  3M3Z B;  3F57 A;  1OWA A;  3ZN1 B;  4QXH B;  3E0Z A;  2JMK A;  4KP3 C;  3SS1 A;  2PPY A;  1HZD A;  4YY3 T;  4U18 A;  1BR1 A;  4NIQ A;  4MOU A;  3I9Y A;  2E8I A;  4MAL A;  3NZP A;  4HWD A;  5CB4 E;  1MMD A;  2EHO C;  2NP9 A;  4X5T A;  2WSS V;  2XAF B;  5JDF A;  3P4S A;  1WCR A;  4Z8X A;  2OLT A;  4P0B A;  3KVA A;  3ZPO A;  2QGS A;  3PUR A;  3T8A A;  3AEG A;  4HFH A;  1UUR A;  2FBM A;  2WWU A;  4ILA A;  1Y01 A;  3HKC E;  4EML A;  3FZM B;  3JC6 D;  5CFB A;  4A56 A;  4PFP A;  3KV4 A;  4PJL A;  4DBR A;  5IYZ E;  1HTJ F;  4AKR B;  4DR2 T;  3HKB E;  3ZSS A;  1ZV4 X;  2I59 A;  2JQ9 A;  5JDM A;  3UUL A;  2XAG B;  2NTY A;  5JRC A;  4YHJ A;  4JUY A;  3RF1 A;  3U78 A;  3I9W A;  3V5S A;  4DMW A;  3TKL B;  3RQE A;  4HWI B;  5JRE A;  1HG5 A;  2XM1 A;  4UXN B;  5FP3 A;  2K5B B;  3CIR A;  3C4X A;  4JWV A;  3EAB A;  3JC6 C;  4YLH A;  4DVD A;  1ZKE A;  2CPT A;  2IW5 B;  4OG1 A;  5AQK B;  3UU6 A;  2GTR A;  5C9G A;  2ZM6 T;  1VCS A;  4P1N A;  1N33 T;  3RQF A;  4IDZ A;  1NAF A;  2WU5 A;  4OK0 A;  2ES0 A;  3NVO A;  5JR9 A;  3RPU A;  4PK5 A;  2CM0 A;  4UR9 A;  3U3I A;  4H9N C;  2N1G A;  1WLX A;  4G2A A;  2BG9 E;  2ACX A;  1OED E;  3OJA A;  5FXV A;  1Z8U A;  2XQ6 A;  5JR9 C;  2J1D G;  2UXN B;  2MYS A;  4WZX A;  2HH7 A;  3ESL A;  3UU5 A;  3NRX A;  5ADX L;  2CLY B;  2ZLY A;  2LRK A;  4H9O C;  3OTO T;  4CI2 B;  3RSI A;  1EY3 A;  3ZN0 B;  3IRB A;  3ADC A;  2W67 A;  1UUS A;  2BVL A;  4YSZ A;  4QH5 A;  2VX2 A;  3VKG A;  4HN9 A;  1HF8 A;  2C5J A;  4AKL A;  2CXD A;  1W09 A;  1S35 A;  4OHF A;  2CBJ A;  5HWY A;  4YT0 A;  1NZY B;  2W63 A;  2XTL A;  3EAM A;  3Q5D A;  1EF8 A;  4FJO A;  4J2C A;  4DV7 T;  4NPP A;  1BR0 A;  1J5W A;  2CBI A;  4HFC A;  4ZI7 E;  2A3D A;  3P50 A;  4DBQ A;  3M65 A;  1ZHC A;  4CXW A;  3QOF A;  3I47 A;  3AE7 A;  3RKO A;  3ANW B;  4GOU A;  3HA4 A;  1EZ3 A;  1W0A A;  1HS7 A;  2DNX A;  2K24 A;  5LG3 A;  3P4P A;  1NWM X;  4O8S A;  3ONJ A;  1YW0 A;  5LGT B;  5GON E;  1IJ6 A;  2E9X D;  3T88 A;  4ILU A;  2VUR A;  4JFC A;  3CPZ A;  3IA3 A;  4IDP A;  3AB3 B;  4YTP A;  1XNQ T;  4EYU A;  2VK9 A;  3N9O A;  3ZCI A;  4PK4 A;  3ONL C;  1XDP A;  3MK7 C;  2WZH A;  4WNK A;  4JEH B;  3F31 A;  3RQW A;  1UCU A;  4DUZ T;  4O2B E;  3ABV A;  2PBP A;  3PUQ A;  3UU4 A;  2JQK A;  3WAK A;  3ZYL A;  2X9Y A;  5HYA A;  4MI2 A;  2WU2 A;  2DHR A;  2WZI A;  3GN5 A;  4X62 T;  3VKH A;  2V6X A;  2XQ4 A;  5DJQ C;  2WDQ A;  3ZLI A;  2CCQ A;  2E9X C;  4MHC A;  4AXP A;  4U72 A;  2FJE A;  4LFB T;  5FY7 A;  5L4H A;  3P4R A;  3QXI A;  2D0T A;  1YQ4 A;  4GEH B;  2FUP A;  5C3J A;  3MKD A;  4ZS2 A;  2UZF A;  3J7Y q;  4U19 A;  2MPK A;  3UT5 E;  5LHI B;  2AE9 A;  3B5M A;  4NXM T;  3PU8 A;  2WS3 A;  4OX9 T;  2Y6X A;  4C91 A;  3UTK A;  1E1H B;  3ADB A;  1YQ3 A;  2HHH T;  4NUU A;  5FXW A;  1DUB A;  2XQ8 A;  3ZMU B;  4GKK T;  2LSY A;  3CKD A;  2AXD S;  2V7J A;  3L8I A;  2DI4 A;  4GK5 E;  2ZQR A;  3N9L A;  4GK0 E;  4JYA T;  4U7I A;  5AQF B;  4UIG A;  3RIF A;  3KV6 A;  2UUC T;  4JI0 T;  2I0M A;  5FKY A;  1XWM A;  3AE4 A;  4PJJ A;  4ZI3 D;  2V7I A;  5JR9 B;  1Z0P A;  2UUA T;  3KBU A;  5LBQ B;  2RP4 A;  3G06 A;  2X51 A;  4QX8 B;  2LEH A;  2D5U A;  4I55 E;  2JQQ A;  4UVA B;  4Z91 A;  2K3W A;  2X0L B;  3FDU A;  2OV9 A;  5AQU B;  2UXC T;  2NOX A;  2I6H A;  2KZ7 B;  3GWH A;  4U7Y A;  3ZT7 A;  4ZI3 C;  1UX5 A;  2YN6 A;  2VKD A;  3E22 E;  3PUA A;  4EIW A;  3DTO A;  4TUY E;  1Q52 A;  4ILC A;  2R6G F;  2XAJ B;  1YKH B;  1UIY A;  4IL9 A;  4DMV A;  1MIY A;  5AQG B;  4LF7 T;  5JBW A;  2BS2 A;  5L3C B;  1KNR A;  1MNE A;  2YU2 A;  4ERR A;  1I6Z A;  4F6R C;  2QYW A;  4WCZ A;  1AJ3 A;  3K3Q C;  3AE9 A;  3W15 B;  4L9I A;  2DWK A;  2ACZ A;  2XZE A;  4CZZ B;  5TAO A;  5HXH A;  2NR4 A;  2B76 A;  4CI1 B;  4H63 V;  1LKX A;  3JAF A;  2E2A A;  3AEC A;  4O4H E;  4TNW A;  2M67 A;  4DR3 T;  3OKQ A;  1VCT A;  4DUY T;  4CN1 A;  4ILB A;  4MBQ A;  2FJD A;  1HR0 T;  5F3J A;  4ISS A;  3O1I A;  4I42 A;  5LGU B;  4BAY B;  2PFV A;  3PUS A;  3R9S A;  2FJB A;  4L0R A;  1IBK T;  5L3G B;  4ZEY A;  3MYB A;  4HWF A;  5J0Z A;  5F5W A;  2XHE B;  4H9P C;  1HG2 A;  2YK0 A;  2E9X B;  2UXD T;  2H88 A;  3Q9D A;  1X79 A;  3RC3 A;  2LJL A;  3PTR B;  3GN5 B;  4IDO A;  2DLR A;  4AIU A;  2XM2 A;  4B6X A;  4N78 D;  5LA6 E;  1G8X A;  2WMN A;  3PZK A;  1WR6 A;  4WYV A;  4OYJ A;  2EHO D;  4GKJ T;  4HEA A;  2IC9 A;  4CN4 A;  4IE0 A;  3QC9 A;  4HTE A;  3H81 A;  3UUM A;  1JXZ A;  2ODV A;  1IAP A;  1VOM A;  4TNV A;  1D1B A;  2E5V A;  1M62 A;  5AQM B;  5LJN A;  3CX8 B;  5FXX A;  4ZI2 D;  2IAK A;  2JIW A;  4O2A E;  3J9X 1;  4PNI A;  2BG9 C;  1OED C;  4TV8 E;  2MAW A;  2KSR A;  2E5L T;  2LT3 A;  3ZT6 A;  4UV9 B;  1NEN A;  3VRB A;  3N9Q A;  3RC8 A;  1WYB A;  4LMJ A;  2YU1 A;  2QRX A;  4YHH T;  4LMK A;  2LSG A;  5AQT B;  5FL1 A;  1S94 A;  2KWH A;  4QX7 B;  2L9Q A;  3RHW A;  3CX6 B;  4M1P A;  3JCF A;  4JBW F;  3MOY A;  3FZF B;  3C4W A;  2M6I A;  3P4W A;  1E2A A;  4DV1 T;  1U5P A;  4ZI2 C;  2V6Y A;  1RJM A;  1FMW A;  4JYL A;  2DUB A;  1SE7 A;  4GIW A;  5FYM A;  3O1J A;  5L4E A;  3GMI A;  3QK8 A;  4IIJ E;  3NZQ A;  1KFY A;  4O4L E;  4JI3 T;  1HCI A;  4HFB A;  4CXX A;  5AQO B;  5AQL B;  1IBL T;  1JNR A;  2VVN A;  3P7I A;  5AQS B;  3C51 A;  3AXJ A;  4C90 A;  3TLT A;  2H3R A;  4IDQ A;  3RGL A;  2CWY A;  1T8B A;  2VL8 A;  4WBO A;  3NRY A;  4EEB A;  3UFE A;  4DR6 T;  5LJM A;  3JAE A;  2YOE A;  5BMV E;  3FZL B;  3LFM A;  3VR9 A;  4IRE A;  5LP6 E;  4ZZB A;  5L3D B;  3RQU A;  3KVB A;  3CVR A;  2JPF A;  2H7O A;  2NTX A;  4DID B;  3H3M A;  2YDQ A;  4LML A;  4UVC B;  1YXR A;  5FMN A;  2V7M A;  2A2F X;  4TWD A;  2VKO A;  2ZQQ A;  4BA9 A;  2QA7 A;  1MJ3 A;  4TZ4 C;  2CWO A;  4IHJ E;  3Q1T A;  4DR7 T;  4HKA A;  2IML A;  5J2T E;  3PJA J;  5ETW A;  3P8C D;  2VKJ A;  4EGW A;  2P9B A;  2KMF A;  3AEF A;  3FZH B;  3B57 A;  2LM2 A;  4H9Q C;  2V1D B;  5DQW A;  2KWI B;  4JI2 T;  5KXJ A;  3HL6 A;  2F4V T;  4QXC B;  2Q9Q A;  1G73 A;  5FY0 A;  3T1H T;  4IGU A;  4MLK A;  2W4X A;  4O4J E;  3TLF A;  3LBX A;  3VU7 H;  1CHU A;  3ZC1 A;  4I0U A;  3ZJ2 A;  2W00 A;  3AE2 A;  3EVY A;  3N2G E;  4LF9 T;  2WBL A;  3VR8 A;  3KBT A;  5EZY E;  3UUX B;  1XDO A;  5LHG B;  4ZZC A;  5A1L A;  1B7T A;  1DU2 A;  3KV5 A;  4EAH A;  3D0T A;  3Q5W A;  4U3C A;  4YFS A;  2RA1 A;  5IHY A;  1N36 T;  5ABF A;  2BG9 B;  3RIU A;  5JDQ A;  1OED B;  3O9X A;  2QVA A;  3RKG A;  4KUM B;  2FBW A;  5M4Y A;  5JQG E;  2W66 A;  2BS4 A;  2MTQ A;  3PJA A;  2EHO B;  3HKE E;  1UK5 A;  5LHH B;  3ZST A;  4F8H A;  4DR4 T;  2BKO A;  3ETU A;  4JCS A;  2LKG A;  4UF0 A;  1KF6 A;  3RIU C;  4HWC A;  3N5L A;  5HXS A;  3BK9 A;  2HN1 A;  3K8P C;  3N2O A;  4KNP A;  1L0V A;  2LSJ A;  3W8H B;  3AA0 B;  4X1Y E;  2LRL A;  3TLS A;  3KIN B;  2LHN A;  4P0A A;  1T7S A;  3R84 B;  2KT9 A;  4KI0 F;  3AEA A;  2X9H A;  2J62 A;  3H3A A;  4QII A;  1IBM T;  5JDL A;  1QLB A;  2KIN B;  3PDY A;  3TRR A;  2KXP B;  3AE3 A;  2V6Y B;  3H37 A;  4E7Z A;  2DCF A;  3EUH A;  3L8J A;  1SHZ C;  5JVD E;  1VRB A;  1LVF A;  5JRC B;  2CMR A;  2VVS A;  3UUN A;  3ETV A;  5AQP B;  3TLV A;  3AM1 A;  3UQ7 A;  4ANJ A;  3ZT5 A;  3ZMS B;  3LJC A;  3K1S A;  4U1A A;  2C5K T;  5AQN B;  2FJA A;  3PV0 F;  1FJG T;  2JQH A;  4IE7 A;  2CHO A;  4IZD A;  2YKS A;  2PTF A;  2WB5 A;  1HX8 A;  2QQ3 A;  4AKH A;  5EK4 A;  4I52 A;  4CI3 B;  1MND A;  4JLE A;  3RLF F;  5LGN B;  4LF8 T;  5HXC A;  1UGO A;  3AJM A;  3PUX F;  1T72 A;  4U33 A;  4PW8 A;  2HN2 A;  4IZB A;  3FXE B;  2VQF T;  1BR4 A;  1FMV A;  2H7V C;  5FNV E;  2ODU A;  4IT4 A;  2KLQ A;  3VHL A;  2V5C A;  3Q0J A;  2WY2 A;  2WWV A;  1MMG A;  3PU3 A;  4DV0 T;  3QK6 A;  1Q51 A;  2BKP A;  3N2K E;  2BS3 A;  3FBL A;  4EOZ B;  5AQQ B;  4I4T E;  1WFD A;  4WBN E;  3QB5 K;  1XMO T;  3OC7 A;  2IUB A;  3S4U A;  4DV5 T;  2CE7 A;  1MMN A;  1SA0 E;  3P5M A;  1GQE A;  4LF4 T;  1D1C A;  3NBX X;  2CXL A;  2LE8 A;  2XQY A;  3AAI A;  4ZHQ E;  4ZOL E;  2Z6E A;  5LG4 A;  1KEY A;  4H9S E;  1XNR T;  3K3O A;  2XAH B;  2KND A;  4A5X A;  1D0Z A;  3LBX B;  4XAX B;  2PBI A;  2D2S A;  2NW7 A;  3UU3 A;  3MJX A;  2VRE A;  3A4M A;  3AE6 A;  4TX5 A;  3OPC A;  2VL0 A;  2W62 A;  3A8Y C;  1W0B A;  5AQH B;  2YIN A;  2Y48 B;  4X20 E;  2SPC A;  3WAJ A;  2XPK A;  4X1K E;  4K0K T;  2DL1 A;  2V5D A;  4IE4 A;  4YXD A;  3UFG A;  2P63 A;  3BQK A;  3LG7 A;  3AA6 B;  3F2E A;  2IC6 A;  4HWH A;  4PK6 A;  1J5E T;  4ELW A;  3IBP A;  4AQF A;  1XZY A;  3SWX A;  3SWH A;  4IZC A;  3I1A A;  5AQV B;  2LOS A;  2V7L A;  3BQI A;  2ZM2 A;  2NWB A;  3C50 A;  3FBZ A;  4JI8 T;  2BZB A;  5HEH A;  4XZC A;  4QIJ A;  2YEV C;  3WI3 A;  4V1A v;  4KHP T;  3ZMV B;  5L47 A;  3DJB A;  1ZEE A;  4DR1 T;  2ZM0 A;  4B3R T;  2WDV A;  3N9M A;  2XQ9 A;  3AE5 A;  5JDG A;  2LM9 A;  4EED A;  3HRX A;  4X66 T;  3NWI A;  2Y8D A;  3A5X A;  2X0H A;  1LRZ A;  4OFZ A;  5FL0 A;  2IEX A;  2LOP A;  3HI2 A;  3QNU A;  5CJ5 A;  1KNZ A;  1LVK A;  2XJ7 A;  2YDS A;  3ZYM A;  1J1J A;  2DWG A;  1NZY A;  5FVK A;  4ZXL A;  2V7K A;  3RRC A;  5L3B B;  3CML A;  3RYI E;  1H7C A;  2L3L A;  1MIW A;  2F6Q A;  3KV9 A;  5C2T A;  3TLU A;  3EDU A;  2H89 A;  5FXZ A;  3PUV F;  4KBM B;  3SFE A;  3IHR A;  3T8O A;  3I0Q A;  3ANW A;  5LB7 B;  1XMQ T;  4AIS A;  3UQ4 A;  2K48 A;  4PAG A;  4QH1 A;  4X65 T;  1QUU A;  5HCM A;  5H6R B;  3T89 A;  2WM9 A;  1HNW T;  3BQL A;  1Y64 B;  4I4Z A;  4FI5 A;  4TWH A;  5IWA T;  1N34 T;  5L3E B;  3MAC A;  5LYJ E;  5LOV E;  4ADZ A;  4Q25 A;  4TN7 B;  3K3N A;  2D9D A;  4A97 A;  4JOT A;  2WMO A;  4AQY T;  3DP7 A;  1M7K A;  3P4Q A;  3AAA B;  4QKN A;  2VKH A;  1ZOY A;  4X1I E;  5LBM A;  3EHZ A;  3OVU A;  4HFE A;  3SOL A;  2B1E A;  3TLW A;  3T1Y T;  4K0U A;  3CK6 A;  2XQ5 A;  3C98 B;  4E7S A;  1HNX T;  2G0U A;  5HWX A; 
#chains in the Genus database with same CATH homology
 2WBL A;  2XAS B;  3OBV E;  3N9L A;  3KBT A;  4GK0 E;  3ZC0 A;  2VWA A;  5EZY E;  3UUX B;  5HXE A;  5LHG B;  4JEU B;  4UIG A;  5A1L A;  1B7T A;  4I43 B;  3KV5 A;  1IZN B;  3KV6 A;  3D0T A;  3B13 A;  4EAH A;  3Q5W A;  5JDN A;  4YFS A;  2RA1 A;  2JJ9 A;  5H6Q B;  2X66 A;  3HR0 A;  5IHY A;  2K9A A;  4PJJ A;  4ZI3 D;  2V7I A;  5JDQ A;  2C5I T;  3O9X A;  5JR9 B;  1BR2 A;  3N9P A;  4UEL A;  4KUM B;  3RYC E;  1Z0P A;  5M4Y A;  5DQV A;  3HKD E;  2CLY C;  3KBU A;  3L3P A;  5LBQ B;  5JQG E;  4IE6 A;  2MTQ A;  2RP4 A;  2X9W A;  2EHO B;  3QUJ A;  3HKE E;  5LHH B;  2X51 A;  3CQC B;  4QX8 B;  4GYR A;  2LEH A;  2LSK A;  2D5U A;  3ETU A;  2ZM8 A;  4I55 E;  2JQQ A;  4QWN B;  4UF0 A;  5CA1 E;  3RX6 A;  3N5L A;  3KDS E;  5HXS A;  5JH7 E;  3AVR A;  4QXB B;  3A4L A;  2OA5 A;  2UXX B;  3BK9 A;  4UVA B;  1US7 B;  3K8P C;  4AKG A;  2VB6 A;  3N2O A;  2X0L B;  4EB6 E;  2LSJ A;  4UEM A;  3EDV A;  2XAQ B;  3W8H B;  2CA5 A;  3AA0 B;  3CQX C;  4IE5 A;  4X1Y E;  2NW9 A;  3KIN B;  2LHN A;  5L2L A;  3AAE B;  4GYS A;  4P0A A;  2NOX A;  3CQG B;  2N9D A;  5LNK A;  1FIO A;  2KZ7 B;  1MMA A;  3GWH A;  3R84 B;  4CQI A;  2KT9 A;  3FB2 A;  4L5G A;  5LXT E;  2PJQ A;  4ZI3 C;  3W8I B;  1UX5 A;  2X9H A;  4ASK A;  4NNQ A;  4CXY A;  3Q5X A;  3H3A A;  2VAS A;  1T98 A;  2VKD A;  3C4Z A;  3E22 E;  3PUA A;  5JDL A;  5JDH A;  4EIW A;  5KX5 E;  2Q9Q D;  1HFA A;  3DTO A;  3ZMT B;  2KIN B;  4TUY E;  4KMC A;  2W0G A;  5KDM C;  3PDY A;  4ZS3 A;  2KXP B;  2PG8 A;  2XAJ B;  3ZJ1 A;  1YKH B;  4OYK A;  2W61 A;  2CXF A;  2EHO A;  3H37 A;  5DAB A;  4E7Z A;  3IF8 B;  2A72 A;  2HPL A;  2HPJ A;  3F57 A;  3KFW X;  4DMV A;  4XBF B;  2DCF A;  1MIY A;  1OWA A;  3EUH A;  3ZN1 B;  3L8J A;  4QXH B;  1SHZ C;  5JVD E;  3E0Z A;  3LK2 B;  4HFV A;  4YJ3 E;  3RYF E;  1MNE A;  2JMK A;  2YU2 A;  4KP3 C;  1VRB A;  1LVF A;  3SS1 A;  4ERR A;  4F6R C;  1AJ3 A;  5JRC B;  1BR1 A;  3I9Y A;  4G63 A;  2E8I A;  3K3Q C;  4MAL A;  2CMR A;  2V26 A;  3NZP A;  3W15 B;  4L9I A;  5CB4 E;  2DWK A;  3UUN A;  1MMD A;  2EHO C;  2NP9 A;  4DND A;  3ETV A;  2WSS V;  2XAF B;  2JRK A;  3AM1 A;  5JDF A;  4CZZ B;  5TAO A;  3ZMZ B;  4ANJ A;  5HXH A;  4Z8X A;  5E0O A;  3ZYK A;  1YD8 G;  4P0B A;  3LJC A;  3ZMS B;  1O3X A;  3KVA A;  4U74 A;  2X9X A;  3ZPO A;  4CI1 B;  1QSD A;  2C5K T;  2QGS A;  3PUR A;  4H63 V;  5CA0 E;  1LKX A;  4IE7 A;  2WWU A;  3V5U A;  4O4H E;  1HX8 A;  3HKC E;  2M67 A;  4AKH A;  3OKQ A;  5EK4 A;  2Q9Q C;  4CI3 B;  4MBQ A;  1MND A;  3JC6 D;  4JLE A;  3OYZ A;  4WW0 A;  4A56 A;  3ZEF B;  4PFP A;  3KV4 A;  5LGN B;  5J1G A;  4AKI A;  5F3J A;  4PJL A;  5HXC A;  3RH3 A;  4ISS A;  3AJM A;  4DBR A;  3O1I A;  5IYZ E;  1HTJ F;  5LGU B;  4AKR B;  4PW8 A;  4BAY B;  2PFV A;  3PUS A;  3OYX A;  4L0R A;  5J2U E;  3HKB E;  5L3G B;  2MBG A;  1ZV4 X;  2I59 A;  4I50 E;  5JDM A;  3FXE B;  3UUL A;  3RQG A;  2XAG B;  2NTY A;  1BR4 A;  1FMV A;  4QHO A;  2XHE B;  5JRC A;  2H7V C;  5FNV E;  4YHJ A;  4JUY A;  4H9P C;  1HG2 A;  2YK0 A;  3U78 A;  3LK4 2;  2ODU A;  3I9W A;  3V5S A;  2E9X B;  2KLQ A;  3VHL A;  4DMW A;  3IEE A;  3TKL B;  3Q9D A;  4PFO A;  1X79 A;  3RQE A;  1MMG A;  3RC3 A;  2LJL A;  3PE0 A;  5JRE A;  1HG5 A;  3PU3 A;  3QK6 A;  4UXN B;  3PTR B;  1U4Q A;  5FP3 A;  3GN5 B;  2K5B B;  2DLR A;  3N2K E;  3C4X A;  1WYC A;  4B6X A;  3JC6 C;  3FBL A;  4YLH A;  4N78 D;  5LA6 E;  1G8X A;  2WMN A;  4DVD A;  1WR6 A;  1ZKE A;  3ZCJ A;  2MOZ A;  4EOZ B;  3E08 A;  2IW5 B;  3PUG A;  3SRZ A;  4I4T E;  3O1H A;  4OYJ A;  2EHO D;  4WBN E;  4HEA A;  3S4U A;  2CE7 A;  2IC9 A;  1MMN A;  4IE0 A;  1SA0 E;  3QC9 A;  3RQF A;  4HTE A;  3Q2M A;  3UUM A;  4IDZ A;  2ODV A;  1IAP A;  1D1C A;  2N2N A;  1VOM A;  3NBX X;  1NAF A;  3AAI A;  2CXL A;  2LE8 A;  2XQY A;  4ZHQ E;  4OK0 A;  4ZOL E;  2ES0 A;  3LK3 B;  2D0U A;  1KK7 A;  2Z6E A;  4BJN A;  5LG4 A;  5JR9 A;  3RPU A;  3L09 A;  4PK5 A;  4H9S E;  1D1B A;  2CM0 A;  2XAH B;  3K3O A;  3I0O A;  5KMG P;  3U3I A;  2KND A;  4H9N C;  2N1G A;  2E9X A;  1D0Z A;  1WLX A;  3LBX B;  4HGA A;  4XAX B;  3MXZ A;  4H63 H;  5LJN A;  2PBI A;  2D2S A;  4G2A A;  2NW7 A;  3CX8 B;  5FXX A;  4ZI2 D;  2BDE A;  2ACX A;  3R6N A;  2IAK A;  3MJX A;  4O2A E;  3J9X 1;  4PNI A;  2WAU A;  3OJA A;  5FY1 A;  4TV8 E;  3A4M A;  4BJM A;  5FXV A;  4TX5 A;  5JR9 C;  2W62 A;  2J1D G;  2UXN B;  2LT3 A;  4UV9 B;  3C64 A;  3N9Q A;  2YIN A;  3RC8 A;  2MYS A;  2Y48 B;  2LSI A;  4X20 E;  2SPC A;  2HH7 A;  3ESL A;  1WYB A;  3WAJ A;  4P09 A;  2YU1 A;  3NRX A;  4O4I E;  5ADX L;  2CLY B;  2ZLY A;  4X1K E;  4IE4 A;  4H9O C;  2P63 A;  3BQK A;  2LSG A;  3LG7 A;  3ADD A;  3AA6 B;  3F2E A;  5F8P A;  1S94 A;  2IC6 A;  2KWH A;  1YKE B;  4PK6 A;  4CI2 B;  3ZN0 B;  3GA8 A;  3IRB A;  3ADC A;  4QX7 B;  3IBP A;  4AQF A;  4PJM A;  4MFR A;  2BVL A;  2L9Q A;  3SWH A;  3CX6 B;  4M1P A;  1OXZ A;  2X67 A;  5AFU L;  3VKG A;  4HN9 A;  1HF8 A;  2C5J A;  4AKL A;  2CXD A;  3I1A A;  1MIV A;  1S35 A;  2LOS A;  2V7L A;  3BQI A;  2ZM2 A;  2NWB A;  3C50 A;  3FBZ A;  3ONX A;  4H9R C;  1D0Y A;  4OHF A;  3C4W A;  5HWY A;  2BZB A;  4XZC A;  2W63 A;  2YEV C;  2XTL A;  2L8K A;  3WI3 A;  1U5P A;  4ZI2 C;  4V1A v;  1RJM A;  3ZMV B;  4FJO A;  4J2C A;  3DJB A;  1FMW A;  1V9D A;  1ZEE A;  1BR0 A;  2ZM0 A;  4HE8 A;  4UVB B;  4ZI7 E;  4GIW A;  1CUN A;  2JMH A;  5FYM A;  3N9M A;  2NW8 A;  3O1J A;  3GMI A;  2A3D A;  4NUV A;  5JDG A;  4DBQ A;  3M65 A;  1ZHC A;  4TV9 E;  4CXW A;  3FHN A;  2LM9 A;  3FXD B;  3RKO A;  3ANW B;  2C0S A;  2Y8D A;  3A5X A;  3RYH E;  4GOU A;  4IIJ E;  3HA4 A;  1EZ3 A;  3NZQ A;  4O4L E;  4EYY R;  1HCI A;  1LRZ A;  4CXX A;  1HS7 A;  2DNX A;  2K24 A;  4OFZ A;  5LCY A;  2LOP A;  1D1A A;  3HI2 A;  3P7I A;  1NWM X;  3A4N A;  4O8S A;  3C51 A;  5L3C B;  1YW0 A;  5LGT B;  4C90 A;  1KNZ A;  1LVK A;  5GON E;  2H3R A;  5HXR A;  1UX4 A;  1IJ6 A;  2CWY A;  5EK3 A;  2E9X D;  4ILU A;  3ZYM A;  1D0X A;  2DWG A;  2VL8 A;  3N9N A;  4WBO A;  3CPZ A;  2X68 A;  3NRY A;  3AA7 B;  2V7K A;  3RRC A;  3AB3 B;  5L3B B;  3CML A;  3RYI E;  3UFE A;  1H7C A;  5LJM A;  4IST A;  4EYU A;  2VK9 A;  5BMV E;  2L3L A;  1MIW A;  3N9O A;  3LFM A;  3KV9 A;  3ZCI A;  4PK4 A;  3AA1 B;  3EDU A;  5FXZ A;  3RRW A;  4EZ4 A;  2Q9Q B;  4KBM B;  1IJ5 A;  3MK7 C;  4WNK A;  5LP6 E;  4JEH B;  3F31 A;  3IHR A;  1UCU A;  5L3D B;  3CWZ B;  3T8O A;  3I0Q A;  3ANW A;  3KVB A;  3CVR A;  4O2B E;  5HAX A;  3PUQ A;  4DO0 A;  5L3F B;  2JPF A;  3WAK A;  2K48 A;  2H7O A;  2NTX A;  4PAG A;  3ZYL A;  2X9Y A;  1QUU A;  4UVC B;  4AQG A;  5EK2 A;  5FMN A;  2V7M A;  2A2F X;  4EZH A;  5H6R B;  2BVM A;  5HYA A;  2VKO A;  2DHR A;  3GN5 A;  3MZK B;  4BA9 A;  2WM9 A;  2QA7 A;  3BQL A;  1Y64 B;  3VKH A;  4TZ4 C;  5DJQ C;  4FI5 A;  2CWO A;  4YJ2 E;  3ZLI A;  2CCQ A;  2E9X C;  4MHC A;  4IHJ E;  4AXP A;  4U72 A;  4PJN A;  5L3E B;  3MAC A;  5LYJ E;  4HKA A;  5FY7 A;  5LOV E;  5J2T E;  5ETW A;  3CX7 B;  4ADZ A;  3P8C D;  4TN7 B;  3K3N A;  2D0T A;  1WRD A;  2P9B A;  2VKJ A;  2WMO A;  2KMF A;  4GEH B;  4EXT A;  3DP7 A;  3B57 A;  1FEW A;  3MKD A;  4H9Q C;  4ZS2 A;  3MA9 A;  2V1D B;  3AAA B;  5DQW A;  3J7Y q;  2CEA A;  2KWI B;  3HL6 A;  4QKN A;  3UT5 E;  2VKH A;  5LHI B;  4QXC B;  4AI6 A;  2Q9Q A;  3O4X E;  4X1I E;  5LBM A;  1G73 A;  3PU8 A;  5FY0 A;  3SOL A;  2LHR A;  2B1E A;  3AVS A;  2Y6X A;  4C91 A;  4IGU A;  4AQF C;  4MLK A;  1E1H B;  4K0U A;  4O4J E;  3ADB A;  2GK9 A;  4UF0 B;  3UTK A;  3LBX A;  3VU7 H;  4NUU A;  5FXW A;  3ZC1 A;  3C98 B;  2ZMA A;  3ZMU B;  4UV8 B;  4E7S A;  2XUE A;  3ZJ2 A;  2W00 A;  2LSY A;  3EVY A;  3CKD A;  2V7J A;  3N2G E;  3L8I A;  2DI4 A;  2G0U A;  5C8Y E;  5HWX A;  4GK5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...