3O4XE

Crystal structure of complex between amino and carboxy terminal fragments of mdia1
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
454
structure length
433
Chain Sequence
b'VLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein diaphanous homolog 1
publication title Crystal structure of a complex between amino and carboxy terminal fragments of mDia1: insights into autoinhibition of diaphanous-related formins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 128
structure length 433
sequence length 454
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02181 FH2 Formin Homology 2 Domain
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.80 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3o4xE01
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE03
3OBVE 4EAHA 3O4XE 1UX5A 2J1DG 2Z6EA 1Y64B 1UX4A 1V9DA
chains in the Genus database with same CATH superfamily
5JTGA 5F5WA 1X79A 1T8BA 2K24A 5FXVA 1CHUA 4YLHA 2R6GF 3ONLC 3PUAA 4MHCA 5EK4A 2JPFA 3EUHA 3LBXA 3AJMA 2W62A 3Q1TA 2N1GA 5ETWA 1N36T 2X68A 2EHOA 5AQMB 3RIFA 3ZCIA 5J2UE 1HG2A 3DTOA 2N2NA 1HF8A 4MFRA 3LFMA 5L47A 3D0TA 1I6ZA 4GIWA 1VCSA 2J1DG 1IJ6A 2A3DA 2MOZA 3N2KE 4EMLA 1E2AA 2LSGA 4JEHB 2VK9A 3C64A 2PTFA 4BAYB 1RJNA 4DNDA 4DV1T 4WZXA 4GKJT 2NOXA 2E2AA 2CBIA 4CI2B 3ETUA 5AQPB 4I4TE 5FL0A 3AEGA 4LFBT 2MBGA 2JQKA 2NP9A 2ZM8A 5CB4E 5HCMA 2Z6EA 4KHPT 2VWAA 5J1GA 2FJEA 4UVCB 3VHLA 4YFSA 3FXEB 1YKHB 5ADXL 3G06A 3Q5EA 2XSBA 2E9XC 5KDMC 4ZI2D 4PFOA 3G64A 4ILBA 4DBRA 2LSIA 5DJQC 2WP9A 2VVSA 2V7KA 5LMNT 3LG7A 2IW5B 5L3EB 2PPYA 3CMLA 3HI2A 2FBMA 1SA0E 2XAFB 4U1AA 4GYRA 4DUYT 2CWOA 4BA9A 5L4HA 2WDRA 1EY3A 3T8AA 4O4LE 4QWNB 4PK6A 3K3NA 2XM1A 2BS4A 2KSRA 2H7OA 3ONJA 4CXWA 3W8HB 5ABEA 3R84B 1LRZA 2QA7A 4AQGA 3AEFA 2CM0A 3RQWA 2XASB 2J47A 5L3CB 2LLYA 2L8KA 3R6NA 3O4XE 3ZYLA 4ISTA 2WDVA 5LGUB 4JWVA 1IBKT 4PK4A 3ZMUB 3PU3A 2QVAA 2XZEA 3N2GE 4ILAA 3RC8A 1LVKA 2D0UA 2WU5A 3IHRA 3P4SA 4DMVA 3M65A 4F8HA 1YW0A 3CK6A 1UURA 3K3OA 5LHIB 2ZMAA 4YY3T 3RRWA 4IDQA 3MOYA 5JDHA 2ES0A 2YDRA 4MLKA 2NTYA 3K3QC 2BS3A 3N2OA 5HXRA 5HXEA 3J7Yq 5HYAA 4HN9A 4X62T 1W0AA 2UXXB 1N33T 3EI0A 2E5VA 3TLTA 4ZS3A 2EHOC 1V9DA 4IIJE 4U3CA 4AKIA 3MKDA 4IL9A 3P8CD 2HW5A 3A4NA 4NIQA 2LM2A 4TUYE 3EVYA 4ZEYA 2UXNB 4E7SA 3WI3A 2BBHA 2WS3A 3SWXA 1S35A 4KBMB 3C4ZA 2UXCT 4OG1A 3AECA 5LG3A 3IF8B 5L2LA 3RIUA 4B3ST 1Q52A 2JMHA 1L0VA 4ISSA 2XUEA 4L9IA 3AEBA 1G73A 3I0OA 1NENA 5CA0E 2VQET 4XAXB 4LMKA 4HFVA 3QUJA 4LF6T 4C91A 5GONE 3AA7B 3GMIA 3JC6D 1MNDA 5BR8T 5FXXA 1D1AA 3FZMB 5AFUL 3HRXA 3P4QA 2X0YA 3C98B 2XQ4A 4E7ZA 2C0SA 5LHHB 2XQ7A 3AAEB 3UUBA 4AI6A 5LG4A 1UGOA 2CLYB 4K0KT 1O3XA 2J4GA 2LKGA 3FZFB 2IUBA 2NR4A 4IDOA 1E1HB 2VASA 2WM9A 3AVRA 4I0UA 1QLBA 5CJ5A 2ZM6T 3I1AA 4I43B 2LSJA 4ZZBA 4QHOA 4O2AE 4DUZT 2DUBA 4IE5A 1SE7A 1WLXA 3KDSE 5LP6E 4JI2T 4CN6A 4H9SE 3L8JA 4PJLA 5LXTE 4GEHB 4JI4T 4B6XA 5AQQB 2PFVA 3AAAB 2DLRA 2EJ5A 2M6IA 2QGSA 4ZZCA 3O1IA 2ZM0A 3SFEA 5JR9B 4YTMA 4CZZB 2XQ3A 4NXNT 2Y8DA 3T88A 4FJWD 4H9QC 4L5GA 4UVBB 3EDUA 3RC3A 1Z0PA 1DCIA 3I9YA 3AE2A 3RPUA 3CQXC 4OFZA 4MOUA 4JV5T 3HKCE 2Q9QD 2UUCT 2DCFA 1BR1A 4K2NA 2NWBA 3OC7A 2HN2A 2ODVA 4CN1A 2FJBA 3TLSA 2LEHA 3IEEA 2BKPA 1HS7A 2XQAA 4JYLA 4JLEA 5LNKA 3PURA 3JAFA 3NRXA 5H6RB 4ELXA 4X5TA 1Z8UA 2YOEA 2L3LA 4IDPA 4H9NC 4QKNA 1Y64B 4A98A 3QXIA 5C8YE 3N9OA 4AKGA 5C3JA 2HPJA 4UF0B 3JCFA 4JI8T 2WAUA 3RIUC 3LJCA 2CRBA 4IE4A 2D0TA 2VL8A 4KP3C 3V5UA 4U18A 5FYMA 5H6QB 3CVRA 5FXWA 3NWIA 3ZC1A 1WR6A 2JRKA 4P0BA 3F2EA 1XMQT 4ZOLE 4F6RC 4TWDA 4UF0A 4TNVA 5HEJA 4KNPA 4DVDA 4B3MT 2N9DA 5KJPA 2ODUA 4I55E 5JBXA 4YXDA 3SRZA 4YTPA 4KHZF 2KINB 2D2SA 4PW8A 4DV0T 5CA1E 3O1JA 4DR2T 4DV3T 5JRCB 3PTRB 3EDVA 4X65T 4TWHA 1ZOYA 1N34T 3BK9A 1WCRA 1QSDA 2NW7A 4XZCA 3E08A 1KNPA 4IGUA 3OVUA 1UCUA 2XSAA 4I50E 4LF8T 2CLYC 1FIOA 5JRCA 4UELA 3B5MA 4JCSA 1MIVA 3QK6A 3CQGB 4CI3B 2L9QA 2V7IA 2E5LT 1XDOA 3QB5A 4LF9T 4PK5A 3U78A 1U5PA 2LRLA 3AEEA 4ELWA 3VR8A 4IZCA 2X9YA 3NKZA 4YSZA 3ZMVB 2XAQB 2WY2A 3RRCA 1E7PA 4EAHA 3LK42 3PUSA 3DP7A 5EK2A 2GTRA 4DR4T 3N9QA 5M4YA 3OPCA 5JR9C 2QRXA 4EZ4A 3AE6A 4NPPA 1NZYB 3CX6B 3KVAA 4K0UA 4PAGA 3M3ZB 4FZWC 2WBLA 2V26A 5FVLA 1AJ3A 3KV6A 2CXFA 2IDOB 4TX5A 2JQQA 4X1KE 1KFYA 3C51A 1T7SA 4TN7B 2LKHA 5FXZA 1HNXT 4J2CA 1XMOT 5E0OA 2GK9A 2JJ9A 4O4HE 3U3IA 3ZC0A 4P09A 4DV2T 4BJNA 1NZYA 1IJ5A 3Q9DA 3KV5A 5IUXA 2IIUA 4HKAA 4OHFA 2W67A 2WQYA 2IEXA 2NTXA 4O4IE 1HX8A 2PBIA 4DR6T 5LJNA 4U72A 2G0UA 1IBLT 5JDLA 5JDQA 4LMLA 2A9UA 4NUVA 1LVFA 3FBZA 2V5CA 3KVBA 2CEAA 1XNQT 4DV5T 4X1IE 1HR0T 3RYFE 2IHR1 2WWUA 3W15B 4HFBA 3AE3A 3UULA 3MYBA 2LE8A 4ADZA 3N9LA 4DV4T 2ACZA 5JVDE 2BG9B 2AE9A 4IREA 1IZNB 4AQFA 2W2UA 1YQ4A 3AE5A 4UIGA 2H3RA 3NZPA 3PUVF 2H89A 3UU6A 3N9MA 3ADBA 4ZI3D 3T1HT 4QH5A 3RQUA 1HCIA 2B1EA 2BG9A 2A72A 2VURA 4NUUA 1KNZA 3RQEA 2WCAA 1US7B 1OEDE 1YD8G 1HNWT 4TV9E 3QOFA 2M6BA 2VKDA 4U74A 2CCQA 4COFA 2BVLA 4EEBA 3AA1B 3N9PA 4UV9B 2XAGB 3C4XA 5AQVB 4Q25A 2DNXA 2X66A 3RYCE 2BS2A 2SPCA 5IYZE 5L4EA 4MI2A 3LSVA 2XQ6A 4KMCA 3ZN1B 4N78D 3ZPOA 4V1Av 1B7TA 2LOSA 2PJQA 4CQIA 4I52A 3AAIA 2QQ3A 1UUSA 1QUUA 4H9RC 4JUYA 4QXBB 2JQHA 4B3TT 1HX1B 1N32T 2CMRA 2ACXA 3K8PC 3AM1A 1GQEA 2D9DA 4HTEA 4EOZB 1WRDA 2BBJA 4O8SA 4A5XA 3CPZA 3PE0A 4IE7A 2F4VT 3CIRA 3V5SA 2FUPA 3DJBA 4LF7T 3RIAA 2HPLA 4CXYA 2VKOA 5HXSA 2RPAA 4LF5T 3ZT5A 1J1JA 3KBTA 4QX8B 4EYYR 1WR0A 1D1BA 4ELSA 3RKOA 4HWFA 3NZQA 4JEUB 4A56A 2OA5A 3SOLA 2XQ5A 4MALA 3KV9A 3RGLA 3PZKA 2Q9QA 5LCYA 1KK7A 4IE0A 3UUNA 2HN1A 4TZ4C 5FL1A 1MIYA 2BZBA 2FBWA 3RI5A 2W00A 3P4RA 4DR1T 5HEHA 3UT5E 3ZSSA 4UVAB 5LA6E 3IRBA 2LHRA 3MJXA 4PJJA 5C2TA 5F3JA 2JIWA 4MBQA 5EK3A 4HGAA 2VKHA 4ZU2A 3RF1A 3L8IA 5J2TE 4HWIB 1FJGT 2VQFT 1OEDB 1MMGA 2UZFA 2VREA 4AQFC 1MNEA 3FB2A 5AQGB 4EB6E 3CX8B 5HCJA 5LBQB 3Q0GA 3A5XA 4U7IA 3VKGA 5HXCA 3OYZA 4JI7T 3AXJB 1W9RA 2BG9C 1OEDA 3VRBA 2RP4A 1IAPA 5DQVA 3RQFA 2BDEA 3JC6C 4AIUA 5LMUT 3Q2MA 5AQKB 5C9GA 4OYKA 4O2BE 3WAJA 1WYBA 3ZSTA 4UV8B 3B13A 2XHEB 1MMAA 3AXJA 2MAWA 3PUGA 4AXPA 2F6QA 1U4QA 3HR0A 3OYXA 3W8IB 1WYCA 4LFAT 4FJOA 4U2ZA 5KMGP 3CWZB 3KINB 4H63V 2ZLYA 3R0OA 2BKOA 3SWHA 4GK5E 2MYSA 3TLUA 5CGMA 1UX5A 5AQJB 2MPKA 3GWHA 5HXHA 3F31A 4DR7T 4YSYA 3ESLA 2XY8B 1D1CA 4YJ3E 3UU5A 4I4ZA 2XPKA 2K9AA 4PNIA 2H7VC 5JDFA 3Q5WA 1ZP0A 2VKJA 2AXDS 3ZLIA 3E0ZA 2PBPA 2C5IT 4HEAA 3A4MA 4G63A 4HFIA 3ZN0B 3A4LA 4EZHA 2KMFA 3O9XA 2WU2A 2WWVA 1M62A 5DQWA 3RH3A 4X20E 3ETVA 3ABVA 1XNRT 4A97A 4DR5T 4JI1T 3LK2B 3OBVE 4EIWA 5FY7A 3WAKA 1BR4A 3RHWA 2XJ7A 4OK0A 5AQRB 5ABGA 2WMOA 1X9BA 2LSYA 1ZHCA 5HEUA 5BMVE 2A2FX 3FXDB 2CXLA 1UK5A 2UXBT 2X67A 1NEKA 4KUMB 3VU7H 2ZQRA 1H7CA 5IWAT 2RA1A 3J9X1 4U31A 1DU2A 5JQGE 3RKGA 4IE6A 4ZXLA 2CE7A 4JOTA 3JAEA 3ZCJA 3QXZA 3R9SA 2KT9A 3K1SA 3MK7C 5L3BB 3UTKA 5LB7B 4YTNA 2WMNA 1VCTA 2I0MA 3MACA 3PUYF 4KX6A 1D0YA 4IDZA 2CXDA 4ILUA 3OKQA 3TLVA 1HG5A 5FMNA 2ZQQA 3P7IA 4G2AA 1JXZA 3AEDA 2YN6A 1RJMA 1D0ZA 3KQFA 1SUMB 1OEDC 4WCZA 3JADA 3UFGA 3OJAA 3C4WA 2BG9E 4JI5T 4NNQA 3TKLB 4WBNE 4UXNB 4OX9T 2V7LA 3Q0JA 3ZMZB 2DWGA 3PUZF 4AKHA 3FDUA 2ZM2A 5AQOB 5KXJA 4AISA 4X64T 4H9OC 5LYJE 4ZS2A 3VKHA 4I42A 1G8XA 4IT4A 1HTJF 3PUXF 4UR9A 4QIIA 3FZLB 2IAKA 3AE4A 4EEDA 2K48A 3I9WA 4H63H 4CI1B 1ZEEA 1XZYA 5A1LA 3FZKB 3AVSA 3FHNA 4QH1A 2XTLA 5HAXA 2VB6A 3PUQA 3AE1A 1FMVA 2KWHA 3Q5XA 3UQ7A 4YHHT 1LKXA 2KZ7B 4WBOA 4NEKA 2MTQA 3T89A 2XQ8A 1ZV4X 3ZEFB 2Y6XA 3CQCB 4IZDA 4U7YA 1EF8A 2E9XD 1W09A 2UUAT 2V7JA 2W0GA 1IBMT 1T98A 3NBXX 4X1YE 1YKEB 3X1DA 4U33A 5L3DB 2V8SV 4QXCB 5LGNB 1YQ3A 4O4JE 5AQNB 3IA3A 5AQFB 1KF6A 2WSSV 3ZT6A 5KX5E 2FJDA 3QNUA 4LFCT 3HKBE 3A7MA 2IMLA 2XAJB 3CKDA 3NRYA 2J62A 3RYIE 2NW9A 3L3PA 5JREA 2XM2A 3I0QA 1R8IA 4ERRA 2B76A 1VOMA 3RX6A 2VL0A 2YKSA 3AB3B 4K3WA 2XAHB 3ZMSB 3AEAA 5LBMA 2YDQA 3P5MA 1JNZA 1EZ3A 1BR0A 3ADDA 5FY0A 4DIDB 4B3RT 1W0BA 1MJ3A 2WB5A 1J5ET 2I6HA 1I94T 3RLFF 3ZJ2A 4LMJA 1FMWA 2HH7A 3Q5DA 3SLLA 3NVOA 3TLFA 3HKEE 3BQKA 4NXMT 4ZI2C 4ANJA 3PJAJ 2BVMA 5ABFB 3FZHB 3OTOT 3UU4A 1NAFA 2LHNA 2OV9A 3VRAA 3B57A 4AKLA 4GKKT 2EHOD 3UU8A 4JYAT 3H3AA 2LT3A 4ZI3C 5LOVE 1NWMX 5ABFA 1UIYA 4HWDA 3L39A 1T72A 1CUNA 4DBQA 4EGWA 5FVKA 3EAMA 3EHZA 4DMWA 3LDQB 3EABA 1UX4A 2JQ9A 4JBWF 4ZI7E 1J5WA 3MZKB 3RQGA 4JI6T 1MMDA 4TWFA 3SFDA 3PDYA 4JI0T 2P9BA 2Q9QB 5HWYA 1S94A 3SS1A 1XDPA 3IBPA 2X9XA 2CWYA 2V1DB 4UEMA 3P4WA 4HFHA 2V6XA 3UFEA 3S4UA 3VR9A 2OLTA 2VX2A 4DO0A 2P63A 4OYJA 5HWXA 2X9WA 3UU3A 3P4PA 2XQ9A 4Z90A 4GOUA 4TNWA 3ANWB 3RYHE 3ZJ1A 2KNDA 2M67A 3ONXA 2UU9T 5F8PA 3F57A 3HKDE 1MIWA 2DI4A 4IL4A 5JH7E 1Q51A 2H88A 3N5LA 4HWHA 2V7MA 1M7KA 2YU2A 3FBLA 4CN4A 1OWAA 2DWKA 4AQYT 2CHNA 5DABA 5AQTB 3ANWA 5LJMA 3A8YC 3CX7B 5AQHB 3HL6A 4YSXA 4HWCA 4IZBA 2I59A 5L3FB 3AE7A 3MA9A 5HEGA 4WYVA 4EV6A 1KNRA 2FW2A 2YEVC 3ZKRA 3QB5K 5LGTB 4F47A 3H02A 1D0XA 3N9NA 3KV4A 3H81A 2YK0A 2LRKA 2CPTA 4U2YA 2QYWA 3PU8A 3C50A 4DR3T 5LHGB 2K5BB 2LSKA 3I47A 5L3GB 2YU1A 4TV8E 3QC9A 3ZYMA 1DUBA 4ILCA 4L0RA 2E8IA 4KI0F 2IC6A 2WZIA 5J0ZA 3AE8A 3ADCA 1YXRA 3H37A 4YT0A 1HNZT 5HEOA 4WNKA 2WDQA 2X9HA 2X51A 3AE9A 4GK0E 4IDNA 4YJ2E 3H3MA 3LK3B 1MMNA 1XWMA 2LM9A 1WFDA 4WW0A 5JDNA 5ABHA 4X66T 2W63A 3QK8A 5JBWA 4PJMA 4Z91A 5JDMA 2C5JA 4GYSA 3GA8A 2UXDT 4P1NA 2X0HA 5JR9A 4AKRB 3TLWA 2V5DA 1WZ8A 2BKNA 2LJLA 2PG8A 5FY1A 1ZKEA 1VRBA 4CXXA 4C90A 2V6YB 4FZWA 2W4XA 4BJMA 3AA6B 4P0AA 4QXHB 3R9TA 2UUBT 1HZDA 2C5KT 1HFAA 3KBUA 2CBJA 2CA5A 2YINA 2KWIB 4PFPA 5CFBA 3BQIA 5AQUB 4DV7T 2KLQA 3PV0F 2Q9QC 5FNVE 4OLQA 4EYUA 3GN5B 2DL1A 2V6YA 5AQIB 2E9XB 3AA0B 2Y48B 4HFDA 4XBFB 5EZYE 3TRRA 2W66A 5TAOA 4JFCA 3L8RA 1Y01A 3KFWX 3UUXB 2K3WA 4M1PA 4ASKA 4YHJA 3O1HA 4PJNA 2YDSA 2NW8A 4JI3T 3GN5A 4IHJE 3E22E 4FI5A 3HINA 2E9XA 2DHRA 2X0LB 2IC9A 2XQYA 5JDGA 1BR2A 5IHYA 2FJAA 4DV6T 3PUWF 4H9PC 5AQSB 3ZT7A 2D5UA 3T8OA 3UQ4A 5FKYA 4HFEA 2WZHA 1JNRA 1OXZA 2JMKA 1SHZC 2LOPA 5AQLB 3T1YT 3L09A 4QX7B 4U19A 3PJAA 4HE8A 2KXPB 3P50A 1EF9A 3UUMA 3ZYKA 3HA4A 4HFCA 3RSIA 4QH4A 3MXZA 2VVNA 4EXTA 1KEYA 5FP3A 3ZMTB 2HHHT 3LBXB 3BQLA 4ZHQE 2CHOA 4QIJA 4Z8XA 2EHOB 4LF4T 1FEWA 2W61A
chains in the Genus database with same CATH topology
5C8YE 4DBRA 3L8IA 3N9OA 4ANJA 5J2TE 1X79A 4AKGA 2BVMA 2K24A 2HPJA 5FXVA 1MMGA 4UF0B 2WAUA 4YLHA 4AQFC 1MNEA 1NAFA 2LHNA 3FB2A 3LJCA 4EB6E 3PUAA 3CX8B 4MHCA 2JPFA 4IE4A 5EK4A 2D0TA 2VL8A 3EUHA 4HGAA 4KP3C 3V5UA 3B57A 3LBXA 4AKLA 3AJMA 5LBQB 2W62A 5FYMA 3A5XA 2N1GA 5H6QB 5ETWA 2EHOD 3VKGA 5HXCA 2X68A 3OYZA 3CVRA 5FXWA 2EHOA 3ZC1A 3ZCIA 3H3AA 1WR6A 2LT3A 5J2UE 1HG2A 2JRKA 2N2NA 1HF8A 3DTOA 4MFRA 4P0BA 3F2EA 4ZI3C 5LOVE 1NWMX 3LFMA 4ZOLE 4F6RC 3D0TA 2RP4A 4GIWA 1CUNA 1IAPA 2J1DG 4UF0A 5DQVA 1IJ6A 4DBQA 2A3DA 2MOZA 4DVDA 3N2KE 2N9DA 3RQFA 2BDEA 2ODUA 4DMWA 2LSGA 3JC6C 4I55E 4JEHB 2VK9A 3Q2MA 3C64A 1UX4A 3SRZA 4BAYB 4DNDA 4OYKA 4O2BE 4ZI7E 3MZKB 3RQGA 2KINB 3WAJA 2D2SA 2NOXA 1WYBA 4PW8A 4UV8B 1MMDA 3B13A 2XHEB 5CA1E 1MMAA 3O1JA 3PDYA 4CI2B 3ETUA 4I4TE 2P9BA 5JRCB 3PTRB 3PUGA 3EDVA 4AXPA 2Q9QB 5HWYA 1S94A 2MBGA 1U4QA 3SS1A 2NP9A 2ZM8A 3HR0A 3BK9A 3IBPA 3OYXA 2X9XA 5CB4E 3W8IB 1QSDA 1WYCA 2Z6EA 2VWAA 4FJOA 2NW7A 5J1GA 2CWYA 2V1DB 3E08A 4UEMA 4XZCA 4UVCB 5KMGP 4IGUA 3VHLA 4YFSA 3CWZB 3FXEB 3KINB 3UFEA 3S4UA 4H63V 2ZLYA 1YKHB 5ADXL 3SWHA 4GK5E 2MYSA 2P63A 1UCUA 4OYJA 4DO0A 4I50E 5HWXA 2X9WA 1UX5A 2E9XC 5KDMC 2CLYC 1FIOA 4ZI2D 3GWHA 5HXHA 5JRCA 3F31A 4GOUA 3ESLA 4PFOA 3ANWB 4UELA 1D1CA 3RYHE 2LSIA 4YJ3E 2KNDA 5DJQC 3ZJ1A 2M67A 1MIVA 3ONXA 3QK6A 5F8PA 3F57A 2V7KA 3HKDE 1MIWA 2DI4A 2K9AA 3CQGB 4PNIA 3LG7A 2H7VC 5JDFA 4CI3B 5JH7E 3Q5WA 2L9QA 2IW5B 2V7IA 5L3EB 2VKJA 4PK5A 3U78A 1U5PA 3ZLIA 3CMLA 3HI2A 3N5LA 1SA0E 3E0ZA 2X9YA 2XAFB 2V7MA 4GYRA 2CWOA 2C5IT 4BA9A 4HEAA 3ZMVB 2YU2A 3A4MA 4G63A 3FBLA 4O4LE 4QWNB 2XAQB 3ZN0B 3A4LA 3RRCA 1OWAA 4PK6A 3K3NA 4EZHA 2DWKA 2KMFA 4EAHA 3LK42 2H7OA 3PUSA 5DABA 4CXWA 3O9XA 3ANWA 5LJMA 5DQWA 3RH3A 3CX7B 3W8HB 3DP7A 5EK2A 4X20E 1LRZA 3R84B 3ETVA 2QA7A 3HL6A 4AQGA 3N9QA 3LK2B 3OBVE 4EIWA 5M4YA 2CM0A 5FY7A 5JR9C 2XASB 5L3CB 3WAKA 2I59A 5L3FB 4EZ4A 1BR4A 4OK0A 2L8KA 3MA9A 3R6NA 2WMOA 3O4XE 2LSYA 1ZHCA 3CX6B 3KVAA 4K0UA 3ZYLA 2A2FX 5BMVE 4ISTA 3FXDB 4PAGA 2CXLA 2YEVC 2WBLA 2V26A 5LGUB 2X67A 4KUMB 1AJ3A 4PK4A 3KV6A 5LGTB 2CXFA 3PU3A 3ZMUB 1D0XA 3N9NA 4TX5A 3KV4A 3VU7H 2YK0A 3N2GE 3RC8A 2JQQA 4X1KE 1LVKA 2D0UA 3IHRA 1H7CA 2RA1A 4DMVA 3M65A 3PU8A 3J9X1 3C51A 3C50A 5JQGE 4TN7B 5LHGB 1YW0A 2K5BB 4IE6A 2LSKA 2CE7A 3K3OA 2ZMAA 5FXZA 2YU1A 4J2CA 4TV8E 3ZCJA 5L3GB 5LHIB 2KT9A 5E0OA 3MK7C 2GK9A 3QC9A 3ZYMA 2JJ9A 4O4HE 3RRWA 3U3IA 5L3BB 3ZC0A 4P09A 4BJNA 3UTKA 1IJ5A 3Q9DA 4L0RA 3KV5A 2E8IA 4OHFA 4HKAA 2IC6A 2WMNA 5JDHA 2ES0A 4ZI2C 4MLKA 3MACA 2NTYA 3ADCA 3K3QC 3N2OA 5HXRA 2NTXA 5HXEA 4O4IE 1D0YA 3J7Yq 4IDZA 3H37A 5HYAA 1HX8A 2CXDA 4ILUA 3OKQA 4HN9A 2PBIA 4WNKA 5LJNA 1HG5A 5FMNA 4U72A 2X9HA 2UXXB 3P7IA 2G0UA 2X51A 4G2AA 4GK0E 5JDLA 5JDQA 4YJ2E 4ZS3A 4NUVA 2EHOC 1V9DA 1RJMA 1LVFA 3LK3B 4IIJE 3FBZA 4AKIA 1D0ZA 3MKDA 1MMNA 3KVBA 2CEAA 4X1IE 3RYFE 3P8CD 2LM9A 2WWUA 3A4NA 3W15B 3OJAA 3C4WA 4TUYE 4NNQA 3EVYA 3TKLB 4WW0A 4WBNE 5JDNA 2UXNB 4UXNB 3UULA 4E7SA 3WI3A 2LE8A 2V7LA 4ADZA 2W63A 3ZMZB 3N9LA 1S35A 2DWGA 4PJMA 5JDMA 4KBMB 4AKHA 3C4ZA 5JVDE 2ZM2A 2C5JA 4GYSA 3GA8A 3IF8B 5L2LA 4H9OC 1IZNB 4AQFA 5LYJE 5JR9A 4ZS2A 4AKRB 3VKHA 4UIGA 2JMHA 2H3RA 3NZPA 4ISSA 1G8XA 2LJLA 2PG8A 5FY1A 2XUEA 1ZKEA 1HTJF 1VRBA 4CXXA 4L9IA 4C90A 1G73A 2IAKA 3I0OA 5CA0E 3N9MA 3ADBA 3AA6B 4BJMA 4P0AA 4XAXB 4ZI3D 4QXHB 4HFVA 3QUJA 1HCIA 2B1EA 4C91A 2K48A 5GONE 3I9WA 2A72A 2C5KT 4H63H 1HFAA 3KBUA 4CI1B 1ZEEA 4NUUA 3AA7B 2CA5A 1KNZA 2YINA 3GMIA 2KWIB 3JC6D 1MNDA 3RQEA 4PFPA 5FXXA 1US7B 1YD8G 3BQIA 4TV9E 1D1AA 5A1LA 5AFUL 3AVSA 2KLQA 2Q9QC 3FHNA 5FNVE 2VKDA 4U74A 2CCQA 3C98B 2BVLA 2XTLA 5HAXA 4E7ZA 2VB6A 4EYUA 3AA1B 3PUQA 2C0SA 3N9PA 4UV9B 3GN5B 5LHHB 3AAEB 2XAGB 3C4XA 4AI6A 5LG4A 2E9XB 2CLYB 1FMVA 1O3XA 2KWHA 3AA0B 2Y48B 2DNXA 4XBFB 3Q5XA 5EZYE 2X66A 3RYCE 1E1HB 2VASA 2SPCA 2WM9A 5IYZE 3AVRA 5TAOA 1LKXA 2KZ7B 4WBOA 2MTQA 3KFWX 3UUXB 3I1AA 4M1PA 4I43B 2LSJA 4ASKA 4KMCA 4YHJA 3ZN1B 3O1HA 4QHOA 4N78D 1ZV4X 4PJNA 3ZEFB 4O2AE 3ZPOA 2Y6XA 4V1Av 1B7TA 3CQCB 2NW8A 4IE5A 2LOSA 1WLXA 3KDSE 2E9XD 5LP6E 3GN5A 2PJQA 2V7JA 4IHJE 2W0GA 4CQIA 4H9SE 3L8JA 3AAIA 3E22E 4FI5A 1QUUA 4PJLA 2E9XA 4H9RC 5LXTE 1T98A 2DHRA 2X0LB 4GEHB 3NBXX 4X1YE 4JUYA 2IC9A 2XQYA 4QXBB 4B6XA 1YKEB 5JDGA 1BR2A 2PFVA 3AAAB 2CMRA 2ACXA 5IHYA 3K8PC 2DLRA 5L3DB 5LGNB 4QXCB 3AM1A 4O4JE 4H9PC 4HTEA 4EOZB 1WRDA 2D5UA 2QGSA 4O8SA 3O1IA 2ZM0A 3CPZA 5JR9B 3PE0A 4IE7A 3T8OA 2WSSV 4CZZB 3V5SA 5KX5E 3DJBA 3HKBE 2Y8DA 1OXZA 2HPLA 2XAJB 3CKDA 3NRYA 3RYIE 4CXYA 2JMKA 2NW9A 1SHZC 4H9QC 2LOPA 2VKOA 3L3PA 4L5GA 5HXSA 5JREA 3I0QA 3L09A 4UVBB 4ERRA 3EDUA 3RC3A 4QX7B 1Z0PA 3KBTA 4QX8B 1VOMA 3RX6A 4EYYR 3I9YA 3RPUA 1D1BA 3CQXC 4OFZA 3AB3B 3RKOA 3NZQA 2XAHB 4HE8A 3HKCE 2KXPB 4JEUB 3ZMSB 4A56A 3UUMA 2OA5A 3SOLA 3ZYKA 4MALA 3KV9A 2Q9QD 2DCFA 3HA4A 1BR1A 5LBMA 1BR0A 1EZ3A 2Q9QA 2NWBA 5LCYA 3MXZA 1KK7A 4IE0A 2ODVA 4EXTA 3UUNA 3ADDA 5FY0A 4TZ4C 5FP3A 3ZMTB 2LEHA 3IEEA 1MIYA 2BZBA 1HS7A 3ZJ2A 2W00A 3LBXB 3UT5E 4JLEA 5LNKA 3PURA 4UVAB 5LA6E 1FMWA 3BQLA 3IRBA 2LHRA 2HH7A 4ZHQE 3NRXA 3MJXA 4PJJA 5H6RB 5F3JA 2L3LA 4H9NC 4MBQA 3HKEE 1Y64B 4QKNA 2EHOB 4Z8XA 3BQKA 5EK3A 1FEWA 2W61A 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBV E;  4EAH A;  3O4X E;  1UX5 A;  2J1D G;  2Z6E A;  1Y64 B;  1UX4 A;  1V9D A; 
#chains in the Genus database with same CATH topology
 5JTG A;  5F5W A;  1X79 A;  1T8B A;  2K24 A;  5FXV A;  1CHU A;  4YLH A;  2R6G F;  3ONL C;  3PUA A;  4MHC A;  5EK4 A;  2JPF A;  3EUH A;  3LBX A;  3AJM A;  2W62 A;  3Q1T A;  2N1G A;  5ETW A;  1N36 T;  2X68 A;  2EHO A;  5AQM B;  3RIF A;  3ZCI A;  5J2U E;  1HG2 A;  3DTO A;  2N2N A;  1HF8 A;  4MFR A;  3LFM A;  5L47 A;  3D0T A;  1I6Z A;  4GIW A;  1VCS A;  2J1D G;  1IJ6 A;  2A3D A;  2MOZ A;  3N2K E;  4EML A;  1E2A A;  2LSG A;  4JEH B;  2VK9 A;  3C64 A;  2PTF A;  4BAY B;  1RJN A;  4DND A;  4DV1 T;  4WZX A;  4GKJ T;  2NOX A;  2E2A A;  2CBI A;  4CI2 B;  3ETU A;  5AQP B;  4I4T E;  5FL0 A;  3AEG A;  4LFB T;  2MBG A;  2JQK A;  2NP9 A;  2ZM8 A;  5CB4 E;  5HCM A;  2Z6E A;  4KHP T;  2VWA A;  5J1G A;  2FJE A;  4UVC B;  3VHL A;  4YFS A;  3FXE B;  1YKH B;  5ADX L;  3G06 A;  3Q5E A;  2XSB A;  2E9X C;  5KDM C;  4ZI2 D;  4PFO A;  3G64 A;  4ILB A;  4DBR A;  2LSI A;  5DJQ C;  2WP9 A;  2VVS A;  2V7K A;  5LMN T;  3LG7 A;  2IW5 B;  5L3E B;  2PPY A;  3CML A;  3HI2 A;  2FBM A;  1SA0 E;  2XAF B;  4U1A A;  4GYR A;  4DUY T;  2CWO A;  4BA9 A;  5L4H A;  2WDR A;  1EY3 A;  3T8A A;  4O4L E;  4QWN B;  4PK6 A;  3K3N A;  2XM1 A;  2BS4 A;  2KSR A;  2H7O A;  3ONJ A;  4CXW A;  3W8H B;  5ABE A;  3R84 B;  1LRZ A;  2QA7 A;  4AQG A;  3AEF A;  2CM0 A;  3RQW A;  2XAS B;  2J47 A;  5L3C B;  2LLY A;  2L8K A;  3R6N A;  3O4X E;  3ZYL A;  4IST A;  2WDV A;  5LGU B;  4JWV A;  1IBK T;  4PK4 A;  3ZMU B;  3PU3 A;  2QVA A;  2XZE A;  3N2G E;  4ILA A;  3RC8 A;  1LVK A;  2D0U A;  2WU5 A;  3IHR A;  3P4S A;  4DMV A;  3M65 A;  4F8H A;  1YW0 A;  3CK6 A;  1UUR A;  3K3O A;  5LHI B;  2ZMA A;  4YY3 T;  3RRW A;  4IDQ A;  3MOY A;  5JDH A;  2ES0 A;  2YDR A;  4MLK A;  2NTY A;  3K3Q C;  2BS3 A;  3N2O A;  5HXR A;  5HXE A;  3J7Y q;  5HYA A;  4HN9 A;  4X62 T;  1W0A A;  2UXX B;  1N33 T;  3EI0 A;  2E5V A;  3TLT A;  4ZS3 A;  2EHO C;  1V9D A;  4IIJ E;  4U3C A;  4AKI A;  3MKD A;  4IL9 A;  3P8C D;  2HW5 A;  3A4N A;  4NIQ A;  2LM2 A;  4TUY E;  3EVY A;  4ZEY A;  2UXN B;  4E7S A;  3WI3 A;  2BBH A;  2WS3 A;  3SWX A;  1S35 A;  4KBM B;  3C4Z A;  2UXC T;  4OG1 A;  3AEC A;  5LG3 A;  3IF8 B;  5L2L A;  3RIU A;  4B3S T;  1Q52 A;  2JMH A;  1L0V A;  4ISS A;  2XUE A;  4L9I A;  3AEB A;  1G73 A;  3I0O A;  1NEN A;  5CA0 E;  2VQE T;  4XAX B;  4LMK A;  4HFV A;  3QUJ A;  4LF6 T;  4C91 A;  5GON E;  3AA7 B;  3GMI A;  3JC6 D;  1MND A;  5BR8 T;  5FXX A;  1D1A A;  3FZM B;  5AFU L;  3HRX A;  3P4Q A;  2X0Y A;  3C98 B;  2XQ4 A;  4E7Z A;  2C0S A;  5LHH B;  2XQ7 A;  3AAE B;  3UUB A;  4AI6 A;  5LG4 A;  1UGO A;  2CLY B;  4K0K T;  1O3X A;  2J4G A;  2LKG A;  3FZF B;  2IUB A;  2NR4 A;  4IDO A;  1E1H B;  2VAS A;  2WM9 A;  3AVR A;  4I0U A;  1QLB A;  5CJ5 A;  2ZM6 T;  3I1A A;  4I43 B;  2LSJ A;  4ZZB A;  4QHO A;  4O2A E;  4DUZ T;  2DUB A;  4IE5 A;  1SE7 A;  1WLX A;  3KDS E;  5LP6 E;  4JI2 T;  4CN6 A;  4H9S E;  3L8J A;  4PJL A;  5LXT E;  4GEH B;  4JI4 T;  4B6X A;  5AQQ B;  2PFV A;  3AAA B;  2DLR A;  2EJ5 A;  2M6I A;  2QGS A;  4ZZC A;  3O1I A;  2ZM0 A;  3SFE A;  5JR9 B;  4YTM A;  4CZZ B;  2XQ3 A;  4NXN T;  2Y8D A;  3T88 A;  4FJW D;  4H9Q C;  4L5G A;  4UVB B;  3EDU A;  3RC3 A;  1Z0P A;  1DCI A;  3I9Y A;  3AE2 A;  3RPU A;  3CQX C;  4OFZ A;  4MOU A;  4JV5 T;  3HKC E;  2Q9Q D;  2UUC T;  2DCF A;  1BR1 A;  4K2N A;  2NWB A;  3OC7 A;  2HN2 A;  2ODV A;  4CN1 A;  2FJB A;  3TLS A;  2LEH A;  3IEE A;  2BKP A;  1HS7 A;  2XQA A;  4JYL A;  4JLE A;  5LNK A;  3PUR A;  3JAF A;  3NRX A;  5H6R B;  4ELX A;  4X5T A;  1Z8U A;  2YOE A;  2L3L A;  4IDP A;  4H9N C;  4QKN A;  1Y64 B;  4A98 A;  3QXI A;  5C8Y E;  3N9O A;  4AKG A;  5C3J A;  2HPJ A;  4UF0 B;  3JCF A;  4JI8 T;  2WAU A;  3RIU C;  3LJC A;  2CRB A;  4IE4 A;  2D0T A;  2VL8 A;  4KP3 C;  3V5U A;  4U18 A;  5FYM A;  5H6Q B;  3CVR A;  5FXW A;  3NWI A;  3ZC1 A;  1WR6 A;  2JRK A;  4P0B A;  3F2E A;  1XMQ T;  4ZOL E;  4F6R C;  4TWD A;  4UF0 A;  4TNV A;  5HEJ A;  4KNP A;  4DVD A;  4B3M T;  2N9D A;  5KJP A;  2ODU A;  4I55 E;  5JBX A;  4YXD A;  3SRZ A;  4YTP A;  4KHZ F;  2KIN B;  2D2S A;  4PW8 A;  4DV0 T;  5CA1 E;  3O1J A;  4DR2 T;  4DV3 T;  5JRC B;  3PTR B;  3EDV A;  4X65 T;  4TWH A;  1ZOY A;  1N34 T;  3BK9 A;  1WCR A;  1QSD A;  2NW7 A;  4XZC A;  3E08 A;  1KNP A;  4IGU A;  3OVU A;  1UCU A;  2XSA A;  4I50 E;  4LF8 T;  2CLY C;  1FIO A;  5JRC A;  4UEL A;  3B5M A;  4JCS A;  1MIV A;  3QK6 A;  3CQG B;  4CI3 B;  2L9Q A;  2V7I A;  2E5L T;  1XDO A;  3QB5 A;  4LF9 T;  4PK5 A;  3U78 A;  1U5P A;  2LRL A;  3AEE A;  4ELW A;  3VR8 A;  4IZC A;  2X9Y A;  3NKZ A;  4YSZ A;  3ZMV B;  2XAQ B;  2WY2 A;  3RRC A;  1E7P A;  4EAH A;  3LK4 2;  3PUS A;  3DP7 A;  5EK2 A;  2GTR A;  4DR4 T;  3N9Q A;  5M4Y A;  3OPC A;  5JR9 C;  2QRX A;  4EZ4 A;  3AE6 A;  4NPP A;  1NZY B;  3CX6 B;  3KVA A;  4K0U A;  4PAG A;  3M3Z B;  4FZW C;  2WBL A;  2V26 A;  5FVL A;  1AJ3 A;  3KV6 A;  2CXF A;  2IDO B;  4TX5 A;  2JQQ A;  4X1K E;  1KFY A;  3C51 A;  1T7S A;  4TN7 B;  2LKH A;  5FXZ A;  1HNX T;  4J2C A;  1XMO T;  5E0O A;  2GK9 A;  2JJ9 A;  4O4H E;  3U3I A;  3ZC0 A;  4P09 A;  4DV2 T;  4BJN A;  1NZY A;  1IJ5 A;  3Q9D A;  3KV5 A;  5IUX A;  2IIU A;  4HKA A;  4OHF A;  2W67 A;  2WQY A;  2IEX A;  2NTX A;  4O4I E;  1HX8 A;  2PBI A;  4DR6 T;  5LJN A;  4U72 A;  2G0U A;  1IBL T;  5JDL A;  5JDQ A;  4LML A;  2A9U A;  4NUV A;  1LVF A;  3FBZ A;  2V5C A;  3KVB A;  2CEA A;  1XNQ T;  4DV5 T;  4X1I E;  1HR0 T;  3RYF E;  2IHR 1;  2WWU A;  3W15 B;  4HFB A;  3AE3 A;  3UUL A;  3MYB A;  2LE8 A;  4ADZ A;  3N9L A;  4DV4 T;  2ACZ A;  5JVD E;  2BG9 B;  2AE9 A;  4IRE A;  1IZN B;  4AQF A;  2W2U A;  1YQ4 A;  3AE5 A;  4UIG A;  2H3R A;  3NZP A;  3PUV F;  2H89 A;  3UU6 A;  3N9M A;  3ADB A;  4ZI3 D;  3T1H T;  4QH5 A;  3RQU A;  1HCI A;  2B1E A;  2BG9 A;  2A72 A;  2VUR A;  4NUU A;  1KNZ A;  3RQE A;  2WCA A;  1US7 B;  1OED E;  1YD8 G;  1HNW T;  4TV9 E;  3QOF A;  2M6B A;  2VKD A;  4U74 A;  2CCQ A;  4COF A;  2BVL A;  4EEB A;  3AA1 B;  3N9P A;  4UV9 B;  2XAG B;  3C4X A;  5AQV B;  4Q25 A;  2DNX A;  2X66 A;  3RYC E;  2BS2 A;  2SPC A;  5IYZ E;  5L4E A;  4MI2 A;  3LSV A;  2XQ6 A;  4KMC A;  3ZN1 B;  4N78 D;  3ZPO A;  4V1A v;  1B7T A;  2LOS A;  2PJQ A;  4CQI A;  4I52 A;  3AAI A;  2QQ3 A;  1UUS A;  1QUU A;  4H9R C;  4JUY A;  4QXB B;  2JQH A;  4B3T T;  1HX1 B;  1N32 T;  2CMR A;  2ACX A;  3K8P C;  3AM1 A;  1GQE A;  2D9D A;  4HTE A;  4EOZ B;  1WRD A;  2BBJ A;  4O8S A;  4A5X A;  3CPZ A;  3PE0 A;  4IE7 A;  2F4V T;  3CIR A;  3V5S A;  2FUP A;  3DJB A;  4LF7 T;  3RIA A;  2HPL A;  4CXY A;  2VKO A;  5HXS A;  2RPA A;  4LF5 T;  3ZT5 A;  1J1J A;  3KBT A;  4QX8 B;  4EYY R;  1WR0 A;  1D1B A;  4ELS A;  3RKO A;  4HWF A;  3NZQ A;  4JEU B;  4A56 A;  2OA5 A;  3SOL A;  2XQ5 A;  4MAL A;  3KV9 A;  3RGL A;  3PZK A;  2Q9Q A;  5LCY A;  1KK7 A;  4IE0 A;  3UUN A;  2HN1 A;  4TZ4 C;  5FL1 A;  1MIY A;  2BZB A;  2FBW A;  3RI5 A;  2W00 A;  3P4R A;  4DR1 T;  5HEH A;  3UT5 E;  3ZSS A;  4UVA B;  5LA6 E;  3IRB A;  2LHR A;  3MJX A;  4PJJ A;  5C2T A;  5F3J A;  2JIW A;  4MBQ A;  5EK3 A;  4HGA A;  2VKH A;  4ZU2 A;  3RF1 A;  3L8I A;  5J2T E;  4HWI B;  1FJG T;  2VQF T;  1OED B;  1MMG A;  2UZF A;  2VRE A;  4AQF C;  1MNE A;  3FB2 A;  5AQG B;  4EB6 E;  3CX8 B;  5HCJ A;  5LBQ B;  3Q0G A;  3A5X A;  4U7I A;  3VKG A;  5HXC A;  3OYZ A;  4JI7 T;  3AXJ B;  1W9R A;  2BG9 C;  1OED A;  3VRB A;  2RP4 A;  1IAP A;  5DQV A;  3RQF A;  2BDE A;  3JC6 C;  4AIU A;  5LMU T;  3Q2M A;  5AQK B;  5C9G A;  4OYK A;  4O2B E;  3WAJ A;  1WYB A;  3ZST A;  4UV8 B;  3B13 A;  2XHE B;  1MMA A;  3AXJ A;  2MAW A;  3PUG A;  4AXP A;  2F6Q A;  1U4Q A;  3HR0 A;  3OYX A;  3W8I B;  1WYC A;  4LFA T;  4FJO A;  4U2Z A;  5KMG P;  3CWZ B;  3KIN B;  4H63 V;  2ZLY A;  3R0O A;  2BKO A;  3SWH A;  4GK5 E;  2MYS A;  3TLU A;  5CGM A;  1UX5 A;  5AQJ B;  2MPK A;  3GWH A;  5HXH A;  3F31 A;  4DR7 T;  4YSY A;  3ESL A;  2XY8 B;  1D1C A;  4YJ3 E;  3UU5 A;  4I4Z A;  2XPK A;  2K9A A;  4PNI A;  2H7V C;  5JDF A;  3Q5W A;  1ZP0 A;  2VKJ A;  2AXD S;  3ZLI A;  3E0Z A;  2PBP A;  2C5I T;  4HEA A;  3A4M A;  4G63 A;  4HFI A;  3ZN0 B;  3A4L A;  4EZH A;  2KMF A;  3O9X A;  2WU2 A;  2WWV A;  1M62 A;  5DQW A;  3RH3 A;  4X20 E;  3ETV A;  3ABV A;  1XNR T;  4A97 A;  4DR5 T;  4JI1 T;  3LK2 B;  3OBV E;  4EIW A;  5FY7 A;  3WAK A;  1BR4 A;  3RHW A;  2XJ7 A;  4OK0 A;  5AQR B;  5ABG A;  2WMO A;  1X9B A;  2LSY A;  1ZHC A;  5HEU A;  5BMV E;  2A2F X;  3FXD B;  2CXL A;  1UK5 A;  2UXB T;  2X67 A;  1NEK A;  4KUM B;  3VU7 H;  2ZQR A;  1H7C A;  5IWA T;  2RA1 A;  3J9X 1;  4U31 A;  1DU2 A;  5JQG E;  3RKG A;  4IE6 A;  4ZXL A;  2CE7 A;  4JOT A;  3JAE A;  3ZCJ A;  3QXZ A;  3R9S A;  2KT9 A;  3K1S A;  3MK7 C;  5L3B B;  3UTK A;  5LB7 B;  4YTN A;  2WMN A;  1VCT A;  2I0M A;  3MAC A;  3PUY F;  4KX6 A;  1D0Y A;  4IDZ A;  2CXD A;  4ILU A;  3OKQ A;  3TLV A;  1HG5 A;  5FMN A;  2ZQQ A;  3P7I A;  4G2A A;  1JXZ A;  3AED A;  2YN6 A;  1RJM A;  1D0Z A;  3KQF A;  1SUM B;  1OED C;  4WCZ A;  3JAD A;  3UFG A;  3OJA A;  3C4W A;  2BG9 E;  4JI5 T;  4NNQ A;  3TKL B;  4WBN E;  4UXN B;  4OX9 T;  2V7L A;  3Q0J A;  3ZMZ B;  2DWG A;  3PUZ F;  4AKH A;  3FDU A;  2ZM2 A;  5AQO B;  5KXJ A;  4AIS A;  4X64 T;  4H9O C;  5LYJ E;  4ZS2 A;  3VKH A;  4I42 A;  1G8X A;  4IT4 A;  1HTJ F;  3PUX F;  4UR9 A;  4QII A;  3FZL B;  2IAK A;  3AE4 A;  4EED A;  2K48 A;  3I9W A;  4H63 H;  4CI1 B;  1ZEE A;  1XZY A;  5A1L A;  3FZK B;  3AVS A;  3FHN A;  4QH1 A;  2XTL A;  5HAX A;  2VB6 A;  3PUQ A;  3AE1 A;  1FMV A;  2KWH A;  3Q5X A;  3UQ7 A;  4YHH T;  1LKX A;  2KZ7 B;  4WBO A;  4NEK A;  2MTQ A;  3T89 A;  2XQ8 A;  1ZV4 X;  3ZEF B;  2Y6X A;  3CQC B;  4IZD A;  4U7Y A;  1EF8 A;  2E9X D;  1W09 A;  2UUA T;  2V7J A;  2W0G A;  1IBM T;  1T98 A;  3NBX X;  4X1Y E;  1YKE B;  3X1D A;  4U33 A;  5L3D B;  2V8S V;  4QXC B;  5LGN B;  1YQ3 A;  4O4J E;  5AQN B;  3IA3 A;  5AQF B;  1KF6 A;  2WSS V;  3ZT6 A;  5KX5 E;  2FJD A;  3QNU A;  4LFC T;  3HKB E;  3A7M A;  2IML A;  2XAJ B;  3CKD A;  3NRY A;  2J62 A;  3RYI E;  2NW9 A;  3L3P A;  5JRE A;  2XM2 A;  3I0Q A;  1R8I A;  4ERR A;  2B76 A;  1VOM A;  3RX6 A;  2VL0 A;  2YKS A;  3AB3 B;  4K3W A;  2XAH B;  3ZMS B;  3AEA A;  5LBM A;  2YDQ A;  3P5M A;  1JNZ A;  1EZ3 A;  1BR0 A;  3ADD A;  5FY0 A;  4DID B;  4B3R T;  1W0B A;  1MJ3 A;  2WB5 A;  1J5E T;  2I6H A;  1I94 T;  3RLF F;  3ZJ2 A;  4LMJ A;  1FMW A;  2HH7 A;  3Q5D A;  3SLL A;  3NVO A;  3TLF A;  3HKE E;  3BQK A;  4NXM T;  4ZI2 C;  4ANJ A;  3PJA J;  2BVM A;  5ABF B;  3FZH B;  3OTO T;  3UU4 A;  1NAF A;  2LHN A;  2OV9 A;  3VRA A;  3B57 A;  4AKL A;  4GKK T;  2EHO D;  3UU8 A;  4JYA T;  3H3A A;  2LT3 A;  4ZI3 C;  5LOV E;  1NWM X;  5ABF A;  1UIY A;  4HWD A;  3L39 A;  1T72 A;  1CUN A;  4DBQ A;  4EGW A;  5FVK A;  3EAM A;  3EHZ A;  4DMW A;  3LDQ B;  3EAB A;  1UX4 A;  2JQ9 A;  4JBW F;  4ZI7 E;  1J5W A;  3MZK B;  3RQG A;  4JI6 T;  1MMD A;  4TWF A;  3SFD A;  3PDY A;  4JI0 T;  2P9B A;  2Q9Q B;  5HWY A;  1S94 A;  3SS1 A;  1XDP A;  3IBP A;  2X9X A;  2CWY A;  2V1D B;  4UEM A;  3P4W A;  4HFH A;  2V6X A;  3UFE A;  3S4U A;  3VR9 A;  2OLT A;  2VX2 A;  4DO0 A;  2P63 A;  4OYJ A;  5HWX A;  2X9W A;  3UU3 A;  3P4P A;  2XQ9 A;  4Z90 A;  4GOU A;  4TNW A;  3ANW B;  3RYH E;  3ZJ1 A;  2KND A;  2M67 A;  3ONX A;  2UU9 T;  5F8P A;  3F57 A;  3HKD E;  1MIW A;  2DI4 A;  4IL4 A;  5JH7 E;  1Q51 A;  2H88 A;  3N5L A;  4HWH A;  2V7M A;  1M7K A;  2YU2 A;  3FBL A;  4CN4 A;  1OWA A;  2DWK A;  4AQY T;  2CHN A;  5DAB A;  5AQT B;  3ANW A;  5LJM A;  3A8Y C;  3CX7 B;  5AQH B;  3HL6 A;  4YSX A;  4HWC A;  4IZB A;  2I59 A;  5L3F B;  3AE7 A;  3MA9 A;  5HEG A;  4WYV A;  4EV6 A;  1KNR A;  2FW2 A;  2YEV C;  3ZKR A;  3QB5 K;  5LGT B;  4F47 A;  3H02 A;  1D0X A;  3N9N A;  3KV4 A;  3H81 A;  2YK0 A;  2LRK A;  2CPT A;  4U2Y A;  2QYW A;  3PU8 A;  3C50 A;  4DR3 T;  5LHG B;  2K5B B;  2LSK A;  3I47 A;  5L3G B;  2YU1 A;  4TV8 E;  3QC9 A;  3ZYM A;  1DUB A;  4ILC A;  4L0R A;  2E8I A;  4KI0 F;  2IC6 A;  2WZI A;  5J0Z A;  3AE8 A;  3ADC A;  1YXR A;  3H37 A;  4YT0 A;  1HNZ T;  5HEO A;  4WNK A;  2WDQ A;  2X9H A;  2X51 A;  3AE9 A;  4GK0 E;  4IDN A;  4YJ2 E;  3H3M A;  3LK3 B;  1MMN A;  1XWM A;  2LM9 A;  1WFD A;  4WW0 A;  5JDN A;  5ABH A;  4X66 T;  2W63 A;  3QK8 A;  5JBW A;  4PJM A;  4Z91 A;  5JDM A;  2C5J A;  4GYS A;  3GA8 A;  2UXD T;  4P1N A;  2X0H A;  5JR9 A;  4AKR B;  3TLW A;  2V5D A;  1WZ8 A;  2BKN A;  2LJL A;  2PG8 A;  5FY1 A;  1ZKE A;  1VRB A;  4CXX A;  4C90 A;  2V6Y B;  4FZW A;  2W4X A;  4BJM A;  3AA6 B;  4P0A A;  4QXH B;  3R9T A;  2UUB T;  1HZD A;  2C5K T;  1HFA A;  3KBU A;  2CBJ A;  2CA5 A;  2YIN A;  2KWI B;  4PFP A;  5CFB A;  3BQI A;  5AQU B;  4DV7 T;  2KLQ A;  3PV0 F;  2Q9Q C;  5FNV E;  4OLQ A;  4EYU A;  3GN5 B;  2DL1 A;  2V6Y A;  5AQI B;  2E9X B;  3AA0 B;  2Y48 B;  4HFD A;  4XBF B;  5EZY E;  3TRR A;  2W66 A;  5TAO A;  4JFC A;  3L8R A;  1Y01 A;  3KFW X;  3UUX B;  2K3W A;  4M1P A;  4ASK A;  4YHJ A;  3O1H A;  4PJN A;  2YDS A;  2NW8 A;  4JI3 T;  3GN5 A;  4IHJ E;  3E22 E;  4FI5 A;  3HIN A;  2E9X A;  2DHR A;  2X0L B;  2IC9 A;  2XQY A;  5JDG A;  1BR2 A;  5IHY A;  2FJA A;  4DV6 T;  3PUW F;  4H9P C;  5AQS B;  3ZT7 A;  2D5U A;  3T8O A;  3UQ4 A;  5FKY A;  4HFE A;  2WZH A;  1JNR A;  1OXZ A;  2JMK A;  1SHZ C;  2LOP A;  5AQL B;  3T1Y T;  3L09 A;  4QX7 B;  4U19 A;  3PJA A;  4HE8 A;  2KXP B;  3P50 A;  1EF9 A;  3UUM A;  3ZYK A;  3HA4 A;  4HFC A;  3RSI A;  4QH4 A;  3MXZ A;  2VVN A;  4EXT A;  1KEY A;  5FP3 A;  3ZMT B;  2HHH T;  3LBX B;  3BQL A;  4ZHQ E;  2CHO A;  4QIJ A;  4Z8X A;  2EHO B;  4LF4 T;  1FEW A;  2W61 A; 
#chains in the Genus database with same CATH homology
 5C8Y E;  4DBR A;  3L8I A;  3N9O A;  4ANJ A;  5J2T E;  1X79 A;  4AKG A;  2BVM A;  2K24 A;  2HPJ A;  5FXV A;  1MMG A;  4UF0 B;  2WAU A;  4YLH A;  4AQF C;  1MNE A;  1NAF A;  2LHN A;  3FB2 A;  3LJC A;  4EB6 E;  3PUA A;  3CX8 B;  4MHC A;  2JPF A;  4IE4 A;  5EK4 A;  2D0T A;  2VL8 A;  3EUH A;  4HGA A;  4KP3 C;  3V5U A;  3B57 A;  3LBX A;  4AKL A;  3AJM A;  5LBQ B;  2W62 A;  5FYM A;  3A5X A;  2N1G A;  5H6Q B;  5ETW A;  2EHO D;  3VKG A;  5HXC A;  2X68 A;  3OYZ A;  3CVR A;  5FXW A;  2EHO A;  3ZC1 A;  3ZCI A;  3H3A A;  1WR6 A;  2LT3 A;  5J2U E;  1HG2 A;  2JRK A;  2N2N A;  1HF8 A;  3DTO A;  4MFR A;  4P0B A;  3F2E A;  4ZI3 C;  5LOV E;  1NWM X;  3LFM A;  4ZOL E;  4F6R C;  3D0T A;  2RP4 A;  4GIW A;  1CUN A;  1IAP A;  2J1D G;  4UF0 A;  5DQV A;  1IJ6 A;  4DBQ A;  2A3D A;  2MOZ A;  4DVD A;  3N2K E;  2N9D A;  3RQF A;  2BDE A;  2ODU A;  4DMW A;  2LSG A;  3JC6 C;  4I55 E;  4JEH B;  2VK9 A;  3Q2M A;  3C64 A;  1UX4 A;  3SRZ A;  4BAY B;  4DND A;  4OYK A;  4O2B E;  4ZI7 E;  3MZK B;  3RQG A;  2KIN B;  3WAJ A;  2D2S A;  2NOX A;  1WYB A;  4PW8 A;  4UV8 B;  1MMD A;  3B13 A;  2XHE B;  5CA1 E;  1MMA A;  3O1J A;  3PDY A;  4CI2 B;  3ETU A;  4I4T E;  2P9B A;  5JRC B;  3PTR B;  3PUG A;  3EDV A;  4AXP A;  2Q9Q B;  5HWY A;  1S94 A;  2MBG A;  1U4Q A;  3SS1 A;  2NP9 A;  2ZM8 A;  3HR0 A;  3BK9 A;  3IBP A;  3OYX A;  2X9X A;  5CB4 E;  3W8I B;  1QSD A;  1WYC A;  2Z6E A;  2VWA A;  4FJO A;  2NW7 A;  5J1G A;  2CWY A;  2V1D B;  3E08 A;  4UEM A;  4XZC A;  4UVC B;  5KMG P;  4IGU A;  3VHL A;  4YFS A;  3CWZ B;  3FXE B;  3KIN B;  3UFE A;  3S4U A;  4H63 V;  2ZLY A;  1YKH B;  5ADX L;  3SWH A;  4GK5 E;  2MYS A;  2P63 A;  1UCU A;  4OYJ A;  4DO0 A;  4I50 E;  5HWX A;  2X9W A;  1UX5 A;  2E9X C;  5KDM C;  2CLY C;  1FIO A;  4ZI2 D;  3GWH A;  5HXH A;  5JRC A;  3F31 A;  4GOU A;  3ESL A;  4PFO A;  3ANW B;  4UEL A;  1D1C A;  3RYH E;  2LSI A;  4YJ3 E;  2KND A;  5DJQ C;  3ZJ1 A;  2M67 A;  1MIV A;  3ONX A;  3QK6 A;  5F8P A;  3F57 A;  2V7K A;  3HKD E;  1MIW A;  2DI4 A;  2K9A A;  3CQG B;  4PNI A;  3LG7 A;  2H7V C;  5JDF A;  4CI3 B;  5JH7 E;  3Q5W A;  2L9Q A;  2IW5 B;  2V7I A;  5L3E B;  2VKJ A;  4PK5 A;  3U78 A;  1U5P A;  3ZLI A;  3CML A;  3HI2 A;  3N5L A;  1SA0 E;  3E0Z A;  2X9Y A;  2XAF B;  2V7M A;  4GYR A;  2CWO A;  2C5I T;  4BA9 A;  4HEA A;  3ZMV B;  2YU2 A;  3A4M A;  4G63 A;  3FBL A;  4O4L E;  4QWN B;  2XAQ B;  3ZN0 B;  3A4L A;  3RRC A;  1OWA A;  4PK6 A;  3K3N A;  4EZH A;  2DWK A;  2KMF A;  4EAH A;  3LK4 2;  2H7O A;  3PUS A;  5DAB A;  4CXW A;  3O9X A;  3ANW A;  5LJM A;  5DQW A;  3RH3 A;  3CX7 B;  3W8H B;  3DP7 A;  5EK2 A;  4X20 E;  1LRZ A;  3R84 B;  3ETV A;  2QA7 A;  3HL6 A;  4AQG A;  3N9Q A;  3LK2 B;  3OBV E;  4EIW A;  5M4Y A;  2CM0 A;  5FY7 A;  5JR9 C;  2XAS B;  5L3C B;  3WAK A;  2I59 A;  5L3F B;  4EZ4 A;  1BR4 A;  4OK0 A;  2L8K A;  3MA9 A;  3R6N A;  2WMO A;  3O4X E;  2LSY A;  1ZHC A;  3CX6 B;  3KVA A;  4K0U A;  3ZYL A;  2A2F X;  5BMV E;  4IST A;  3FXD B;  4PAG A;  2CXL A;  2YEV C;  2WBL A;  2V26 A;  5LGU B;  2X67 A;  4KUM B;  1AJ3 A;  4PK4 A;  3KV6 A;  5LGT B;  2CXF A;  3PU3 A;  3ZMU B;  1D0X A;  3N9N A;  4TX5 A;  3KV4 A;  3VU7 H;  2YK0 A;  3N2G E;  3RC8 A;  2JQQ A;  4X1K E;  1LVK A;  2D0U A;  3IHR A;  1H7C A;  2RA1 A;  4DMV A;  3M65 A;  3PU8 A;  3J9X 1;  3C51 A;  3C50 A;  5JQG E;  4TN7 B;  5LHG B;  1YW0 A;  2K5B B;  4IE6 A;  2LSK A;  2CE7 A;  3K3O A;  2ZMA A;  5FXZ A;  2YU1 A;  4J2C A;  4TV8 E;  3ZCJ A;  5L3G B;  5LHI B;  2KT9 A;  5E0O A;  3MK7 C;  2GK9 A;  3QC9 A;  3ZYM A;  2JJ9 A;  4O4H E;  3RRW A;  3U3I A;  5L3B B;  3ZC0 A;  4P09 A;  4BJN A;  3UTK A;  1IJ5 A;  3Q9D A;  4L0R A;  3KV5 A;  2E8I A;  4OHF A;  4HKA A;  2IC6 A;  2WMN A;  5JDH A;  2ES0 A;  4ZI2 C;  4MLK A;  3MAC A;  2NTY A;  3ADC A;  3K3Q C;  3N2O A;  5HXR A;  2NTX A;  5HXE A;  4O4I E;  1D0Y A;  3J7Y q;  4IDZ A;  3H37 A;  5HYA A;  1HX8 A;  2CXD A;  4ILU A;  3OKQ A;  4HN9 A;  2PBI A;  4WNK A;  5LJN A;  1HG5 A;  5FMN A;  4U72 A;  2X9H A;  2UXX B;  3P7I A;  2G0U A;  2X51 A;  4G2A A;  4GK0 E;  5JDL A;  5JDQ A;  4YJ2 E;  4ZS3 A;  4NUV A;  2EHO C;  1V9D A;  1RJM A;  1LVF A;  3LK3 B;  4IIJ E;  3FBZ A;  4AKI A;  1D0Z A;  3MKD A;  1MMN A;  3KVB A;  2CEA A;  4X1I E;  3RYF E;  3P8C D;  2LM9 A;  2WWU A;  3A4N A;  3W15 B;  3OJA A;  3C4W A;  4TUY E;  4NNQ A;  3EVY A;  3TKL B;  4WW0 A;  4WBN E;  5JDN A;  2UXN B;  4UXN B;  3UUL A;  4E7S A;  3WI3 A;  2LE8 A;  2V7L A;  4ADZ A;  2W63 A;  3ZMZ B;  3N9L A;  1S35 A;  2DWG A;  4PJM A;  5JDM A;  4KBM B;  4AKH A;  3C4Z A;  5JVD E;  2ZM2 A;  2C5J A;  4GYS A;  3GA8 A;  3IF8 B;  5L2L A;  4H9O C;  1IZN B;  4AQF A;  5LYJ E;  5JR9 A;  4ZS2 A;  4AKR B;  3VKH A;  4UIG A;  2JMH A;  2H3R A;  3NZP A;  4ISS A;  1G8X A;  2LJL A;  2PG8 A;  5FY1 A;  2XUE A;  1ZKE A;  1HTJ F;  1VRB A;  4CXX A;  4L9I A;  4C90 A;  1G73 A;  2IAK A;  3I0O A;  5CA0 E;  3N9M A;  3ADB A;  3AA6 B;  4BJM A;  4P0A A;  4XAX B;  4ZI3 D;  4QXH B;  4HFV A;  3QUJ A;  1HCI A;  2B1E A;  4C91 A;  2K48 A;  5GON E;  3I9W A;  2A72 A;  2C5K T;  4H63 H;  1HFA A;  3KBU A;  4CI1 B;  1ZEE A;  4NUU A;  3AA7 B;  2CA5 A;  1KNZ A;  2YIN A;  3GMI A;  2KWI B;  3JC6 D;  1MND A;  3RQE A;  4PFP A;  5FXX A;  1US7 B;  1YD8 G;  3BQI A;  4TV9 E;  1D1A A;  5A1L A;  5AFU L;  3AVS A;  2KLQ A;  2Q9Q C;  3FHN A;  5FNV E;  2VKD A;  4U74 A;  2CCQ A;  3C98 B;  2BVL A;  2XTL A;  5HAX A;  4E7Z A;  2VB6 A;  4EYU A;  3AA1 B;  3PUQ A;  2C0S A;  3N9P A;  4UV9 B;  3GN5 B;  5LHH B;  3AAE B;  2XAG B;  3C4X A;  4AI6 A;  5LG4 A;  2E9X B;  2CLY B;  1FMV A;  1O3X A;  2KWH A;  3AA0 B;  2Y48 B;  2DNX A;  4XBF B;  3Q5X A;  5EZY E;  2X66 A;  3RYC E;  1E1H B;  2VAS A;  2SPC A;  2WM9 A;  5IYZ E;  3AVR A;  5TAO A;  1LKX A;  2KZ7 B;  4WBO A;  2MTQ A;  3KFW X;  3UUX B;  3I1A A;  4M1P A;  4I43 B;  2LSJ A;  4ASK A;  4KMC A;  4YHJ A;  3ZN1 B;  3O1H A;  4QHO A;  4N78 D;  1ZV4 X;  4PJN A;  3ZEF B;  4O2A E;  3ZPO A;  2Y6X A;  4V1A v;  1B7T A;  3CQC B;  2NW8 A;  4IE5 A;  2LOS A;  1WLX A;  3KDS E;  2E9X D;  5LP6 E;  3GN5 A;  2PJQ A;  2V7J A;  4IHJ E;  2W0G A;  4CQI A;  4H9S E;  3L8J A;  3AAI A;  3E22 E;  4FI5 A;  1QUU A;  4PJL A;  2E9X A;  4H9R C;  5LXT E;  1T98 A;  2DHR A;  2X0L B;  4GEH B;  3NBX X;  4X1Y E;  4JUY A;  2IC9 A;  2XQY A;  4QXB B;  4B6X A;  1YKE B;  5JDG A;  1BR2 A;  2PFV A;  3AAA B;  2CMR A;  2ACX A;  5IHY A;  3K8P C;  2DLR A;  5L3D B;  5LGN B;  4QXC B;  3AM1 A;  4O4J E;  4H9P C;  4HTE A;  4EOZ B;  1WRD A;  2D5U A;  2QGS A;  4O8S A;  3O1I A;  2ZM0 A;  3CPZ A;  5JR9 B;  3PE0 A;  4IE7 A;  3T8O A;  2WSS V;  4CZZ B;  3V5S A;  5KX5 E;  3DJB A;  3HKB E;  2Y8D A;  1OXZ A;  2HPL A;  2XAJ B;  3CKD A;  3NRY A;  3RYI E;  4CXY A;  2JMK A;  2NW9 A;  1SHZ C;  4H9Q C;  2LOP A;  2VKO A;  3L3P A;  4L5G A;  5HXS A;  5JRE A;  3I0Q A;  3L09 A;  4UVB B;  4ERR A;  3EDU A;  3RC3 A;  4QX7 B;  1Z0P A;  3KBT A;  4QX8 B;  1VOM A;  3RX6 A;  4EYY R;  3I9Y A;  3RPU A;  1D1B A;  3CQX C;  4OFZ A;  3AB3 B;  3RKO A;  3NZQ A;  2XAH B;  4HE8 A;  3HKC E;  2KXP B;  4JEU B;  3ZMS B;  4A56 A;  3UUM A;  2OA5 A;  3SOL A;  3ZYK A;  4MAL A;  3KV9 A;  2Q9Q D;  2DCF A;  3HA4 A;  1BR1 A;  5LBM A;  1BR0 A;  1EZ3 A;  2Q9Q A;  2NWB A;  5LCY A;  3MXZ A;  1KK7 A;  4IE0 A;  2ODV A;  4EXT A;  3UUN A;  3ADD A;  5FY0 A;  4TZ4 C;  5FP3 A;  3ZMT B;  2LEH A;  3IEE A;  1MIY A;  2BZB A;  1HS7 A;  3ZJ2 A;  2W00 A;  3LBX B;  3UT5 E;  4JLE A;  5LNK A;  3PUR A;  4UVA B;  5LA6 E;  1FMW A;  3BQL A;  3IRB A;  2LHR A;  2HH7 A;  4ZHQ E;  3NRX A;  3MJX A;  4PJJ A;  5H6R B;  5F3J A;  2L3L A;  4H9N C;  4MBQ A;  3HKE E;  1Y64 B;  4QKN A;  2EHO B;  4Z8X A;  3BQK A;  5EK3 A;  1FEW A;  2W61 A;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...