3O4XE

Crystal structure of complex between amino and carboxy terminal fragments of mdia1
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
454
structure length
433
Chain Sequence
VLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Protein diaphanous homolog 1
publication title Crystal structure of a complex between amino and carboxy terminal fragments of mDia1: insights into autoinhibition of diaphanous-related formins.
pubmed doi rcsb
source organism Mus musculus
total genus 128
structure length 433
sequence length 454
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02181 FH2 Formin Homology 2 Domain
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.80 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3o4xE01
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE03
1UX5A 2Z6EA 2J1DG 3O4XE 1UX4A 4EAHA 1V9DA 3OBVE 1Y64B
chains in the Genus database with same CATH superfamily
2EHOD 4HTEA 4GKKT 2WU5A 2K48A 4YHHT 4O2AE 2V7KA 5FY1A 4DVDA 5LHHB 3V5UA 2XAFB 4DV1T 1MIVA 2RPAA 4JI7T 2R6GF 1BR0A 2L8KA 4HFBA 4AQFC 4H63H 5FY0A 3TLSA 1X9BA 2YU2A 3FZMB 2NTXA 4YSYA 3J7Yq 2I59A 2W0GA 3RYFE 2WM9A 1W0BA 5IYZE 1OEDE 2V8SV 3R6NA 3RQGA 3RC3A 3HI2A 4AQYT 3R9SA 3PUSA 2UZFA 3AE2A 3EUHA 4IT4A 3F31A 4F47A 1HZDA 3KINB 2IEXA 3CX8B 5HWYA 4ZZBA 2LRKA 3KV9A 4I42A 5JR9B 4DNDA 3B13A 2W61A 4DR7T 4LF9T 1N33T 4U1AA 5KXJA 4HE8A 3OPCA 3G06A 4UF0B 3AM1A 1I6ZA 3E22E 1MNEA 1VCTA 2V7MA 2CBIA 4ISTA 2B76A 2MTQA 1LVFA 3QXZA 4C90A 4I43B 4OYKA 4IE5A 2IHR1 3ZT6A 3SS1A 1J5WA 2L3LA 4ZI2D 2YDQA 5FNVE 2ZM6T 2IMLA 3N2KE 3HA4A 1AJ3A 5AQOB 3Q5XA 4EZ4A 2RP4A 4I4TE 2N1GA 3F57A 2JQKA 2M67A 2PJQA 4EB6E 4IZCA 4DV2T 3O9XA 4EMLA 3GA8A 2CLYB 4YLHA 5FVLA 1SUMB 3IA3A 3PU3A 3Q0GA 2A9UA 2M6IA 3O1HA 3RQEA 4ELWA 2W63A 2LT3A 4G63A 5JDQA 1BR2A 4DBQA 3Q1TA 4Z91A 4F8HA 2EHOA 4YJ3E 2CPTA 2XQ4A 2K3WA 3ZT5A 4MI2A 4KMCA 2LSIA 4CXXA 5C8YE 2W00A 1S35A 1YKEB 2XJ7A 2XQ6A 3VKGA 5F8PA 1YD8G 1DUBA 1E2AA 4QH4A 2ZLYA 4HKAA 2KWHA 4JOTA 4IDOA 4X64T 2UXDT 5AQTB 2V5CA 3MXZA 4X1YE 3GN5B 1X79A 1N32T 3PUXF 3T1HT 3ADBA 4GK5E 2XQ9A 3N9MA 2OV9A 5DABA 2BDEA 5LG4A 2D2SA 3CMLA 4LMKA 5KJPA 3D0TA 4B3RT 2JMHA 2CHOA 3Q5WA 4YSXA 5AQNB 3PJAA 4MLKA 4G2AA 3A4NA 2WAUA 1M7KA 5LBMA 2YEVC 4HWIB 2CRBA 2IUBA 5F5WA 4DV4T 2WDRA 1MMNA 2E9XB 2X0HA 3JAEA 2GK9A 4A56A 2WQYA 3H81A 3PUQA 4WNKA 1KEYA 4PJJA 2SPCA 3JAFA 3KV5A 2A72A 3C4ZA 3RC8A 2QQ3A 1IBKT 3NBXX 4TV9E 4TWHA 4DV5T 3T1YT 4U72A 1OXZA 4Z90A 5AQJB 2UXCT 3AE7A 2HN2A 4NEKA 2IIUA 2KNDA 5JRCA 3AE8A 2C0SA 3ONJA 1NENA 2VVSA 5TAOA 2XQ5A 4ILBA 3NWIA 2V7IA 2HW5A 4HFDA 2KSRA 4YFSA 4PK4A 4LF6T 3PDYA 3CQXC 3AAEB 3T88A 2EHOC 2Y6XA 5JREA 5FXVA 4GIWA 3UFEA 1Z0PA 4OHFA 4K0KT 5LGNB 1KK7A 3TRRA 4OYJA 1RJMA 2WWUA 5HXCA 5AQSB 2VQET 2P63A 2LOSA 1Y64B 1CUNA 4H9SE 3EDVA 4ZS3A 4AI6A 3IEEA 5EK4A 3AA0B 1IBMT 4GKJT 2NR4A 4DUYT 3NZQA 4YTNA 3RQFA 4UELA 3RHWA 1MJ3A 3MOYA 1Q51A 1WRDA 5ABHA 4X1KE 2PBIA 4U19A 3L09A 2BS4A 2LKHA 4DR3T 1IJ5A 3QUJA 5AQRB 4QX8B 2BKNA 2BVMA 1HFAA 1W9RA 1G8XA 1KFYA 4Z8XA 3UUMA 2D0TA 2AE9A 5E0OA 1XMQT 1HNZT 4JCSA 1U5PA 3EABA 4BAYB 3ONLC 3AE9A 3I9WA 4JI5T 3AEFA 1SHZC 4XBFB 2C5KT 3Q9DA 3SOLA 4TNWA 3IBPA 3X1DA 4JI6T 3QK8A 1XDPA 2VK9A 3WI3A 2XSBA 3MK7C 2D0UA 4BJMA 5IUXA 1D0XA 5FKYA 2M6BA 2JIWA 3AEEA 3LK2B 1QSDA 2XPKA 5AQIB 2WDVA 2E9XD 3QK6A 1IBLT 2HPLA 4JV5T 3LSVA 1W09A 4PK5A 2NWBA 3ZSTA 5AQVB 2UXXB 5LYJE 2WBLA 2CWYA 1HG2A 3UTKA 1EY3A 5CA0E 3G64A 3ZLIA 2X0LB 2JPFA 2A2FX 3KDSE 5JR9A 5AQQB 2DNXA 3S4UA 3FDUA 2IC9A 4XAXB 4NNQA 1LKXA 4UF0A 2WSSV 1JXZA 4MFRA 3PUGA 4AKGA 4PFOA 3E08A 5H6QB 4DR6T 2BKOA 3H37A 1HNWT 3I1AA 3M3ZB 4YTPA 4NXMT 1O3XA 3SWXA 2XAQB 2LE8A 3BQLA 1JNZA 4HFHA 4UXNB 4DR1T 2WU2A 1IZNB 2CE7A 2V26A 3ADCA 4ZEYA 1WYBA 1MMGA 3RH3A 2Q9QB 4ZU2A 4HFCA 4ILAA 4HFEA 3KBTA 2VKDA 3GWHA 3NRXA 1NWMX 2IAKA 3A7MA 3UU5A 1U4QA 3K3NA 4BA9A 4HWDA 3EAMA 3AXJB 1MIWA 5FY7A 3SWHA 3IF8B 3W15B 2WY2A 3AVSA 3ABVA 2W4XA 2X68A 4WCZA 4UV9B 5L4HA 3L8RA 4JI0T 5L3DB 2L9QA 1QLBA 1ZOYA 4ZHQE 2KT9A 4DR4T 1HF8A 3UFGA 3NRYA 2CCQA 3W8IB 2ES0A 4IL4A 3VU7H 1WR0A 2K24A 2XQ7A 3ZEFB 5IWAT 4P1NA 1ZHCA 2KLQA 3TLFA 1UX5A 2YN6A 3A4LA 4IREA 3GN5A 3AEBA 5JR9C 1MNDA 3RRCA 5C9GA 4IL9A 2E8IA 2Y48B 4JI4T 3C98B 5L3EB 1OEDB 2ODVA 2FUPA 4QIJA 1N36T 4YHJA 5FP3A 3RYCE 3O4XE 2WWVA 3VHLA 3SFDA 4ILUA 2E9XA 3P5MA 2WMNA 2NW9A 3TLTA 4JEUB 3CVRA 2NTYA 4E7ZA 3KV6A 2CXLA 4F6RC 2H89A 2PG8A 2LM9A 3RKOA 3QOFA 2CWOA 2H7VC 4JI1T 1ZEEA 5HWXA 3QNUA 3TLVA 4I0UA 4TUYE 2G0UA 4O4JE 3T89A 3UT5E 3VKHA 4WZXA 4XZCA 2BG9E 2CLYC 4MALA 3FZHB 3RI5A 2V5DA 4ILCA 2V6YB 4DO0A 2KINB 4HGAA 4ZXLA 2HN1A 3PUVF 4EZHA 4CI3B 5JTGA 4K0UA 5HEOA 4WW0A 2K9AA 4L5GA 4M1PA 3KVAA 2X9XA 5J2UE 2Q9QD 2WCAA 5HEJA 4WBOA 5KDMC 2BBHA 5JH7E 3R9TA 1FMVA 3N9OA 1DU2A 3ZC1A 3EDUA 4HWCA 3HKEE 2H3RA 2E2AA 3FZFB 3SFEA 3GMIA 2DWKA 5AQGB 2VURA 4JI8T 3N9PA 3BQIA 2H7OA 1VCSA 3L8IA 2WMOA 4UVCB 2JQHA 4CZZB 2UUCT 3AE5A 5AFUL 2PBPA 3IRBA 4K2NA 4NUUA 2CBJA 2E9XC 4LF8T 5AQKB 4ZZCA 3KQFA 2NW8A 5ABFB 4I50E 2EJ5A 4CI1B 3RQWA 2RA1A 2ODUA 3UUXB 3WAKA 2XQAA 5CGMA 4IE6A 4LF5T 4DR2T 3OJAA 4GEHB 3UUNA 5L3GB 4AISA 3FZKB 1BR1A 4IZBA 2J47A 2MPKA 3CKDA 3UULA 2FJAA 3CWZB 3P4WA 1J5ET 4DV7T 4PFPA 4PAGA 2X9WA 2W62A 4C91A 2WB5A 3K3QC 2ZMAA 1XNRT 2KMFA 5FXWA 5LGTB 2QYWA 3PUZF 1V9DA 2LKGA 4X1IE 5CA1E 4K3WA 4X20E 3UU3A 2CHNA 2PTFA 4HEAA 4ZI7E 3H3MA 4HWHA 4JBWF 1ZV4X 1ZP0A 4IDQA 3LDQB 4EEDA 5M4YA 1UX4A 1S94A 3EHZA 4CI2B 4KX6A 4ZI3D 2ZQRA 3N5LA 2LRLA 3RIUA 2DL1A 3ZN1B 5HCMA 4ASKA 1D1BA 3HR0A 2BBJA 2Y8DA 2XAJB 2UU9T 3V5SA 2ACZA 4V1Av 3BK9A 2V1DB 3ZJ1A 3LJCA 5EK3A 3AE3A 4E7SA 4H9NC 2VWAA 4OX9T 2Q9QA 4IZDA 4U3CA 3P4SA 1E1HB 4P0BA 5JDLA 3C4XA 5L2LA 3T8AA 2YDSA 4TX5A 1FJGT 4NIQA 5LBQB 2FJDA 4DMWA 3ESLA 3AXJA 3RLFF 3I0OA 1MIYA 1HX1B 1J1JA 2CEAA 3F2EA 2VQFT 5A1LA 5JQGE 4GK0E 2XZEA 5FVKA 3VR9A 4IE7A 2VB6A 4L0RA 2W2UA 3MA9A 3ADDA 5AQLB 5CB4E 3ONXA 1HX8A 4QXBB 3ZYKA 3ZYLA 3L39A 4AQGA 3J9X1 3ZPOA 3C4WA 5LNKA 3OYXA 2I6HA 3KBUA 4JWVA 1UURA 4AKLA 4QHOA 4X5TA 1UCUA 3A4MA 3RIUC 5L3FB 1OEDA 2FJEA 2WS3A 5JBWA 2DLRA 1VRBA 3LK3B 2VL0A 4PJNA 4X66T 3P50A 4NUVA 5LP6E 3O1JA 2VASA 2C5JA 2X0YA 2LSKA 4AKHA 4IGUA 1EF9A 4OFZA 3P7IA 3ZSSA 2Q9QC 3RYHE 1SE7A 2JJ9A 2VKOA 4IIJE 1L0VA 2J1DG 4ZS2A 1B7TA 4CN1A 1KF6A 3Q0JA 1VOMA 3QC9A 5FL0A 3OBVE 1CHUA 5LXTE 3N2OA 4AIUA 3CK6A 1T98A 3RX6A 4PK6A 4LF4T 2V6YA 1WFDA 4CN6A 4IHJE 5L4EA 4KP3C 3AE4A 4DBRA 5AQMB 1YQ4A 3AA6B 4ZI2C 2F4VT 2LOPA 3JC6D 1LVKA 4EV6A 4I55E 2DCFA 3RRWA 4BJNA 4UV8B 2P9BA 2PFVA 4O2BE 4EIWA 3M65A 3P4QA 4FZWA 2F6QA 5AQUB 4EOZB 2XM2A 3ANWB 2N9DA 2H88A 4QWNB 4IDPA 3PURA 2XM1A 2CXDA 4JI2T 1G73A 2NOXA 3A5XA 3OTOT 1QUUA 5HAXA 2E5VA 3MYBA 1OEDC 4TN7B 2VVNA 3O1IA 4MHCA 3H3AA 4TZ4C 3FZLB 2MBGA 4CQIA 1XWMA 5FL1A 5ABFA 1XDOA 4IDZA 1FEWA 3VR8A 5JDNA 5LMNT 4EEBA 3AEAA 3QXIA 3EI0A 1KNZA 4FI5A 4KHPT 1KNRA 2B1EA 4ANJA 5DJQC 3ZMTB 3SRZA 5EZYE 4ZI3C 5JVDE 4DR5T 2XUEA 2IC6A 4YTMA 4GYSA 3RQUA 5HEHA 4AKIA 5LOVE 2QGSA 5J0ZA 2BS3A 4EYYR 5JDHA 2X9HA 1WR6A 5EK2A 3AB3B 4QKNA 3UQ7A 3EVYA 5FYMA 4B6XA 2XQ8A 2ZM8A 3ZCIA 5FMNA 3PE0A 4QIIA 3FXDB 4UR9A 5HXHA 1RJNA 1IAPA 5LGUB 2J62A 2OA5A 2JRKA 3QB5A 3ZJ2A 2V6XA 1UUSA 5AQFB 5CJ5A 4FZWC 3RIAA 4LFCT 4X65T 5LG3A 4ELSA 2V7JA 3P4RA 5F3JA 4H9QC 1E7PA 3C64A 2BG9B 2NP9A 1HTJF 4HFIA 4ISSA 2ZM2A 3PUAA 3ZMUB 3R84B 5LHGB 1GQEA 4LFBT 2IW5B 3OC7A 2C5IT 3AE6A 1T7SA 2MAWA 4ELXA 4EAHA 4L9IA 1NAFA 5C2TA 3RIFA 3RSIA 5L3CB 3JCFA 2WZHA 3ZYMA 3TLWA 1T72A 4OLQA 2YDRA 3ZKRA 3HKCE 5ABGA 2X67A 4I52A 4ERRA 1YKHB 1EF8A 3B5MA 2KXPB 3AJMA 3E0ZA 4GYRA 4LFAT 3DP7A 5FXXA 2CM0A 3PUYF 2CMRA 2WP9A 2VREA 3PV0F 4HFVA 1HR0T 3N2GE 3ZMVB 2KWIB 3OVUA 3OYZA 2UUBT 4KBMB 3I0QA 3AAAB 1W0AA 3AEDA 3R0OA 3HKBE 4PW8A 5BMVE 2FBWA 3MKDA 2XASB 2LM2A 2XAHB 5LA6E 1D1AA 3CQCB 2BKPA 1H7CA 3AEGA 5FXZA 4U2YA 3PUWF 4QXCB 2DUBA 4DIDB 4OG1A 4LF7T 4IE0A 4H9PC 3SLLA 5HEGA 4P0AA 3U3IA 2J4GA 3IHRA 2D5UA 4J2CA 4A98A 4NPPA 5LB7B 1XNQT 3LBXB 3P8CD 2JQ9A 1US7B 3CIRA 3FBZA 4JYLA 3DTOA 5ETWA 3QB5K 2LLYA 2PPYA 4QH5A 3CPZA 5AQPB 3JC6C 1N34T 3K8PC 2YINA 5HXSA 4QXHB 5DQWA 4DV6T 4JI3T 1I94T 3I47A 1NZYB 2LHRA 4YJ2E 4JYAT 1WZ8A 4HWFA 2XTLA 5J1GA 2ACXA 4U31A 2GTRA 4U2ZA 4ZOLE 1EZ3A 4LMLA 4EYUA 3ETVA 4B3ST 3NVOA 3ETUA 2HH7A 4U33A 4O4LE 3LFMA 4CXYA 3K1SA 3VRBA 2YK0A 3ZT7A 4H9OC 2QVAA 3N9NA 4LMJA 2FW2A 3A8YC 4U74A 2MYSA 4AXPA 4EXTA 5AQHB 3ZMZB 3ZC0A 2DHRA 4COFA 2XSAA 4JLEA 5HXEA 3KV4A 3PZKA 3C50A 5JBXA 2BZBA 1UGOA 4AKRB 1HG5A 4DV3T 3ANWA 3KFWX 2XQ3A 1WCRA 4O4HE 4KHZF 1Q52A 3K3OA 5KX5E 5LHIB 4TWDA 3T8OA 5JDGA 2X9YA 2UUAT 3MJXA 4DUZT 3AA7B 5LJMA 1D0YA 4KI0F 1XZYA 2X51A 1UK5A 1FMWA 5J2TE 1DCIA 3NKZA 3RYIE 4TV8E 3H02A 3AA1B 1HS7A 4N78D 4JUYA 3DJBA 4CXWA 4FJOA 1BR4A 2I0MA 2UXNB 3TKLB 5LJNA 5JDMA 2NW7A 2E5LT 5CFBA 2XQYA 2QA7A 4H63V 5C3JA 2XHEB 4UIGA 3CQGB 4QX7B 3AE1A 4YSZA 1FIOA 3AVRA 2DWGA 3C51A 2YU1A 2LSGA 2LJLA 1YQ3A 3RPUA 3ZN0B 1MMAA 2HPJA 2LSJA 4JEHB 4PJMA 1HNXT 3MZKB 3LG7A 2W67A 4OK0A 1D0ZA 3PTRB 4TWFA 2XY8B 4UEMA 2ZQQA 2WDQA 5JDFA 3W8HB 4CN4A 3MACA 3AECA 1YW0A 5BR8T 3Q2MA 4O8SA 2YKSA 3RKGA 3PU8A 4PJLA 2HHHT 4ADZA 2LHNA 1LRZA 4X62T 2LEHA 2OLTA 3CX6B 4U7YA 4WYVA 2D9DA 2BG9A 3UU8A 2KZ7B 1MMDA 4DV0T 4NXNT 3UQ4A 3OKQA 1T8BA 5KMGP 2K5BB 5IHYA 4GOUA 3Q5EA 3Q5DA 4QH1A 3FHNA 3PJAJ 5GONE 1SA0E 1OWAA 3B57A 4JFCA 3ZCJA 5ADXL 3HINA 3WAJA 5HEUA 1YXRA 5L3BB 3BQKA 2EHOB 2W66A 1IJ6A 3KVBA 4KNPA 1XMOT 5LCYA 3FBLA 2V7LA 2AXDS 3CX7B 3FB2A 2XAGB 1Y01A 1UIYA 4EGWA 2VL8A 2MOZA 3U78A 3HL6A 3RF1A 2BS2A 2YOEA 5HCJA 4O4IE 3NZPA 2CXFA 1HCIA 4U18A 4HN9A 3P4PA 1Z8UA 3RGLA 2IDOB 5H6RB 3UU6A 3UUBA 5HYAA 4B3MT 3JADA 2LSYA 5HXRA 4U7IA 4Q25A 3N9QA 4MBQA 5ABEA 3LBXA 4FJWD 3FXEB 4YY3T 2BG9C 3UU4A 4AQFA 3HKDE 4MOUA 1WYCA 4YT0A 3LK42 1JNRA 4PNIA 3I9YA 4I4ZA 2WZIA 5L47A 5JRCB 2FJBA 4IE4A 5LMUT 3VRAA 1WLXA 2VKHA 4A5XA 4IDNA 1M62A 3ZMSB 4UVAB 1NZYA 1ZKEA 1NEKA 2X66A 2VX2A 3TLUA 1D1CA 2UXBT 4B3TT 2N2NA 1KNPA 4YXDA 3L8JA 2JMKA 2VKJA 4A97A 2Z6EA 5DQVA 3HRXA 4UVBB 4DMVA 4P09A 2DI4A 3AAIA 1R8IA 4H9RC 2JQQA 4KUMB 3N9LA 4WBNE 4TNVA 2FBMA 2CA5A 3L3PA 2QRXA 2ZM0A 2BVLA 2A3DA
chains in the Genus database with same CATH topology
3UTKA 2EHOD 3I0OA 4HTEA 5CA0E 3CPZA 3ZLIA 2X0LB 1MIYA 2JPFA 2A2FX 3KDSE 5JR9A 3JC6C 2DNXA 2K48A 2CEAA 3S4UA 3K8PC 3F2EA 4O2AE 2YINA 2V7KA 2IC9A 4XAXB 5FY1A 5HXSA 4DVDA 4QXHB 5A1LA 5LHHB 4NNQA 5JQGE 5DQWA 4GK0E 1LKXA 4UF0A 2WSSV 3V5UA 4MFRA 2XAFB 1MIVA 3PUGA 4AKGA 4PFOA 4YJ2E 2LHRA 3E08A 4IE7A 2VB6A 5H6QB 4L0RA 1BR0A 2XTLA 5J1GA 2ACXA 2L8KA 3MA9A 4AQFC 3H37A 4H63H 5FY0A 3ADDA 4ZOLE 5CB4E 1EZ3A 3ONXA 4EYUA 1HX8A 3I1AA 1O3XA 2YU2A 3ETVA 2NTXA 4QXBB 2XAQB 2LE8A 3BQLA 3J7Yq 3ETUA 3ZYKA 3ZYLA 2HH7A 2I59A 4O4LE 2W0GA 4UXNB 4AQGA 3J9X1 3RYFE 3LFMA 2WM9A 3ZPOA 4CXYA 5IYZE 1IZNB 2CE7A 2V26A 3ADCA 2YK0A 3C4WA 5LNKA 1WYBA 1MMGA 3OYXA 3R6NA 3RQGA 3RH3A 3RC3A 3KBUA 4H9OC 2Q9QB 4AKLA 4QHOA 3HI2A 3N9NA 1UCUA 3KBTA 2VKDA 3GWHA 3NRXA 1NWMX 3A4MA 2IAKA 2MYSA 4U74A 5L3FB 1U4QA 4AXPA 4EXTA 3PUSA 3ZC0A 3ZMZB 2DHRA 3K3NA 4JLEA 5HXEA 2DLRA 3KV4A 4BA9A 3EUHA 1VRBA 3LK3B 3C50A 3F31A 2BZBA 1MIWA 5FY7A 3SWHA 4PJNA 3IF8B 3W15B 4AKRB 3AVSA 1HG5A 4NUVA 3ANWA 3KINB 5LP6E 2X68A 3KFWX 4UV9B 3CX8B 3O1JA 5HWYA 5L3DB 2VASA 2C5JA 3KV9A 4O4HE 2LSKA 5JR9B 3K3OA 4AKHA 4IGUA 5KX5E 4DNDA 2L9QA 3B13A 2W61A 4ZHQE 5LHIB 3T8OA 2KT9A 4OFZA 1HF8A 3P7IA 4HE8A 2Q9QC 3RYHE 5JDGA 2X9YA 3NRYA 2JJ9A 2VKOA 3MJXA 4IIJE 2CCQA 4UF0B 3AM1A 2J1DG 3AA7B 5LJMA 3E22E 1D0YA 4ZS2A 1B7TA 3W8IB 1MNEA 2ES0A 1VOMA 2V7MA 3QC9A 2X51A 3VU7H 3OBVE 5LXTE 1FMWA 3N2OA 4ISTA 5J2TE 2K24A 2MTQA 1LVFA 3ZEFB 3RYIE 1ZHCA 2KLQA 4TV8E 4C90A 1UX5A 3AA1B 1HS7A 1T98A 4N78D 4OYKA 4IE5A 4JUYA 4I43B 3DJBA 3RX6A 4PK6A 4CXWA 3SS1A 3A4LA 1BR4A 2L3LA 4FJOA 4IHJE 2UXNB 3GN5A 4KP3C 3TKLB 5JR9C 1MNDA 3RRCA 5LJNA 5JDMA 4ZI2D 2NW7A 5FNVE 4DBRA 2E8IA 3N2KE 2XQYA 3AA6B 4ZI2C 3HA4A 1AJ3A 2LOPA 2Y48B 2QA7A 3C98B 3JC6D 3Q5XA 4H63V 4EZ4A 2RP4A 1LVKA 4I4TE 2XHEB 2N1GA 4UIGA 3CQGB 4QX7B 4I55E 3F57A 5L3EB 2ODVA 2DCFA 3RRWA 4BJNA 4UV8B 2A3DA 2P9BA 2PFVA 4YHJA 2M67A 2PJQA 5FP3A 4EB6E 3RYCE 3O9XA 4O2BE 4EIWA 3GA8A 1FIOA 3M65A 3O4XE 3AVRA 2DWGA 3VHLA 2CLYB 3C51A 2YU1A 2LSGA 4YLHA 2LJLA 4ILUA 2E9XA 4EOZB 3PU3A 3O1HA 3RPUA 3RQEA 2WMNA 2W63A 3ANWB 3ZN0B 2LT3A 2N9DA 2NW9A 1MMAA 4G63A 5JDQA 2HPJA 4QWNB 1BR2A 4JEUB 2LSJA 4DBQA 4JEHB 3PURA 4PJMA 3CVRA 2CXDA 2NTYA 3MZKB 4E7ZA 3KV6A 2CXLA 2EHOA 1G73A 4F6RC 3LG7A 4YJ3E 2PG8A 2NOXA 2LM9A 3RKOA 4OK0A 1D0ZA 3A5XA 2CWOA 3PTRB 4UEMA 2H7VC 1ZEEA 4KMCA 5HWXA 1QUUA 2LSIA 5JDFA 5HAXA 4CXXA 3W8HB 5C8YE 2W00A 3MACA 1S35A 1YKEB 4TUYE 1YW0A 4TN7B 2G0UA 5F8PA 3VKGA 3Q2MA 4O4JE 1YD8G 3UT5E 4O8SA 3O1IA 3VKHA 2ZLYA 3PU8A 4MHCA 4HKAA 4PJLA 4XZCA 4ADZA 2CLYC 4MALA 3H3AA 2KWHA 2LHNA 4TZ4C 1LRZA 2MBGA 4CQIA 2LEHA 3MXZA 4X1YE 4DO0A 4IDZA 3CX6B 2KINB 1FEWA 3GN5B 4HGAA 4EZHA 1X79A 5JDNA 4CI3B 4K0UA 2KZ7B 1MMDA 4WW0A 3ADBA 4GK5E 2K9AA 3N9MA 4FI5A 4L5GA 3OKQA 1KNZA 4M1PA 5DABA 2BDEA 5LG4A 2D2SA 3KVAA 2X9XA 3CMLA 3D0TA 5KMGP 2K5BB 5IHYA 5J2UE 4GOUA 2B1EA 2JMHA 2Q9QD 4WBOA 3Q5WA 4MLKA 4ANJA 4G2AA 5DJQC 5KDMC 3ZMTB 3A4NA 5JH7E 3SRZA 2WAUA 5LBMA 5EZYE 2YEVC 4ZI3C 3FHNA 1FMVA 3N9OA 5JVDE 2XUEA 3ZC1A 2IC6A 1MMNA 2E9XB 3EDUA 5GONE 2GK9A 4A56A 1SA0E 3HKEE 1OWAA 4GYSA 3B57A 3PUQA 4WNKA 4AKIA 3ZCJA 4PJJA 2SPCA 5LOVE 2H3RA 5ADXL 3KV5A 2QGSA 3WAJA 2A72A 3C4ZA 3RC8A 3GMIA 4EYYR 5JDHA 2X9HA 3NBXX 5L3BB 3BQKA 2EHOB 1WR6A 4TV9E 1IJ6A 2DWKA 3KVBA 5EK2A 4U72A 1OXZA 3AB3B 4QKNA 3EVYA 5FYMA 4B6XA 3N9PA 3BQIA 2ZM8A 3ZCIA 5FMNA 2H7OA 3PE0A 3L8IA 3FXDB 2WMOA 5LCYA 2KNDA 3FBLA 2V7LA 5HXHA 3CX7B 3FB2A 4UVCB 1IAPA 5LGUB 5JRCA 2OA5A 2JRKA 4CZZB 2XAGB 3ZJ2A 2VL8A 2C0SA 5AFUL 2MOZA 3IRBA 3U78A 4NUUA 5TAOA 2E9XC 3HL6A 2NW8A 2V7IA 4O4IE 4I50E 3NZPA 2V7JA 5F3JA 4YFSA 2CXFA 4PK4A 3PDYA 1HCIA 3CQXC 4CI1B 4H9QC 2RA1A 3AAEB 2ODUA 3C64A 3UUXB 2NP9A 1HTJF 2EHOC 2Y6XA 4ISSA 3WAKA 4HN9A 5JREA 4IE6A 2ZM2A 3PUAA 5FXVA 4GIWA 3UFEA 1Z0PA 3ZMUB 3OJAA 4OHFA 3R84B 4GEHB 3UUNA 5LGNB 5LHGB 1KK7A 2IW5B 5L3GB 2C5IT 4OYJA 1RJMA 2WWUA 1BR1A 5HXCA 2P63A 2LOSA 1Y64B 5H6RB 4L9IA 1NAFA 1CUNA 3CKDA 4H9SE 4EAHA 3UULA 3EDVA 4ZS3A 4AI6A 3CWZB 3IEEA 5EK4A 3AA0B 4PFPA 5HYAA 5L3CB 2LSYA 5HXRA 4PAGA 3ZYMA 2X9WA 3NZQA 2W62A 3N9QA 3RQFA 4C91A 3K3QC 4MBQA 4UELA 3LBXA 2ZMAA 3FXEB 2KMFA 5FXWA 5LGTB 1WRDA 3HKCE 1V9DA 4AQFA 4X1KE 4X1IE 2PBIA 3HKDE 3L09A 5CA1E 2X67A 4X20E 1IJ5A 1WYCA 3QUJA 4ERRA 3LK42 4HEAA 4QX8B 1YKHB 4ZI7E 2BVMA 4PNIA 3I9YA 1HFAA 1G8XA 1ZV4X 2KXPB 3AJMA 3E0ZA 5JRCB 4Z8XA 4GYRA 3DP7A 4IE4A 5FXXA 3UUMA 2CM0A 1WLXA 2D0TA 5M4YA 5E0OA 2VKHA 1UX4A 1S94A 2CMRA 4CI2B 3ZMSB 4ZI3D 1U5PA 3N5LA 4UVAB 1ZKEA 3ZN1B 4HFVA 4ASKA 4BAYB 1D1BA 3HR0A 3I9WA 2X66A 3N2GE 3ZMVB 2KWIB 1D1CA 3OYZA 2Y8DA 1SHZC 4XBFB 2C5KT 2XAJB 3Q9DA 2N2NA 4KBMB 3I0QA 3AAAB 3V5SA 4V1Av 3SOLA 3L8JA 3HKBE 4PW8A 2JMKA 2VKJA 5BMVE 3MKDA 3BK9A 2Z6EA 2XASB 2V1DB 3ZJ1A 3IBPA 3LJCA 5EK3A 2XAHB 5LA6E 1D1AA 5DQVA 3CQCB 4UVBB 4E7SA 5FXZA 1H7CA 2VK9A 4DMVA 3WI3A 4H9NC 4QXCB 4P09A 2DI4A 3AAIA 4H9PC 4IE0A 2VWAA 3MK7C 2D0UA 4H9RC 4BJMA 4P0AA 2JQQA 2Q9QA 3U3IA 3IHRA 1D0XA 1E1HB 2D5UA 4P0BA 4KUMB 3LK2B 3N9LA 4J2CA 5JDLA 1QSDA 3C4XA 4WBNE 5L2LA 4TX5A 2E9XD 3LBXB 3QK6A 2HPLA 3P8CD 1US7B 3FBZA 4PK5A 2CA5A 2NWBA 5LBQB 4DMWA 3ESLA 3L3PA 2UXXB 2ZM0A 5LYJE 3DTOA 2BVLA 2CWYA 2WBLA 5ETWA 1HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX5 A;  2Z6E A;  2J1D G;  3O4X E;  1UX4 A;  4EAH A;  1V9D A;  3OBV E;  1Y64 B; 
#chains in the Genus database with same CATH topology
 2EHO D;  4HTE A;  4GKK T;  2WU5 A;  2K48 A;  4YHH T;  4O2A E;  2V7K A;  5FY1 A;  4DVD A;  5LHH B;  3V5U A;  2XAF B;  4DV1 T;  1MIV A;  2RPA A;  4JI7 T;  2R6G F;  1BR0 A;  2L8K A;  4HFB A;  4AQF C;  4H63 H;  5FY0 A;  3TLS A;  1X9B A;  2YU2 A;  3FZM B;  2NTX A;  4YSY A;  3J7Y q;  2I59 A;  2W0G A;  3RYF E;  2WM9 A;  1W0B A;  5IYZ E;  1OED E;  2V8S V;  3R6N A;  3RQG A;  3RC3 A;  3HI2 A;  4AQY T;  3R9S A;  3PUS A;  2UZF A;  3AE2 A;  3EUH A;  4IT4 A;  3F31 A;  4F47 A;  1HZD A;  3KIN B;  2IEX A;  3CX8 B;  5HWY A;  4ZZB A;  2LRK A;  3KV9 A;  4I42 A;  5JR9 B;  4DND A;  3B13 A;  2W61 A;  4DR7 T;  4LF9 T;  1N33 T;  4U1A A;  5KXJ A;  4HE8 A;  3OPC A;  3G06 A;  4UF0 B;  3AM1 A;  1I6Z A;  3E22 E;  1MNE A;  1VCT A;  2V7M A;  2CBI A;  4IST A;  2B76 A;  2MTQ A;  1LVF A;  3QXZ A;  4C90 A;  4I43 B;  4OYK A;  4IE5 A;  2IHR 1;  3ZT6 A;  3SS1 A;  1J5W A;  2L3L A;  4ZI2 D;  2YDQ A;  5FNV E;  2ZM6 T;  2IML A;  3N2K E;  3HA4 A;  1AJ3 A;  5AQO B;  3Q5X A;  4EZ4 A;  2RP4 A;  4I4T E;  2N1G A;  3F57 A;  2JQK A;  2M67 A;  2PJQ A;  4EB6 E;  4IZC A;  4DV2 T;  3O9X A;  4EML A;  3GA8 A;  2CLY B;  4YLH A;  5FVL A;  1SUM B;  3IA3 A;  3PU3 A;  3Q0G A;  2A9U A;  2M6I A;  3O1H A;  3RQE A;  4ELW A;  2W63 A;  2LT3 A;  4G63 A;  5JDQ A;  1BR2 A;  4DBQ A;  3Q1T A;  4Z91 A;  4F8H A;  2EHO A;  4YJ3 E;  2CPT A;  2XQ4 A;  2K3W A;  3ZT5 A;  4MI2 A;  4KMC A;  2LSI A;  4CXX A;  5C8Y E;  2W00 A;  1S35 A;  1YKE B;  2XJ7 A;  2XQ6 A;  3VKG A;  5F8P A;  1YD8 G;  1DUB A;  1E2A A;  4QH4 A;  2ZLY A;  4HKA A;  2KWH A;  4JOT A;  4IDO A;  4X64 T;  2UXD T;  5AQT B;  2V5C A;  3MXZ A;  4X1Y E;  3GN5 B;  1X79 A;  1N32 T;  3PUX F;  3T1H T;  3ADB A;  4GK5 E;  2XQ9 A;  3N9M A;  2OV9 A;  5DAB A;  2BDE A;  5LG4 A;  2D2S A;  3CML A;  4LMK A;  5KJP A;  3D0T A;  4B3R T;  2JMH A;  2CHO A;  3Q5W A;  4YSX A;  5AQN B;  3PJA A;  4MLK A;  4G2A A;  3A4N A;  2WAU A;  1M7K A;  5LBM A;  2YEV C;  4HWI B;  2CRB A;  2IUB A;  5F5W A;  4DV4 T;  2WDR A;  1MMN A;  2E9X B;  2X0H A;  3JAE A;  2GK9 A;  4A56 A;  2WQY A;  3H81 A;  3PUQ A;  4WNK A;  1KEY A;  4PJJ A;  2SPC A;  3JAF A;  3KV5 A;  2A72 A;  3C4Z A;  3RC8 A;  2QQ3 A;  1IBK T;  3NBX X;  4TV9 E;  4TWH A;  4DV5 T;  3T1Y T;  4U72 A;  1OXZ A;  4Z90 A;  5AQJ B;  2UXC T;  3AE7 A;  2HN2 A;  4NEK A;  2IIU A;  2KND A;  5JRC A;  3AE8 A;  2C0S A;  3ONJ A;  1NEN A;  2VVS A;  5TAO A;  2XQ5 A;  4ILB A;  3NWI A;  2V7I A;  2HW5 A;  4HFD A;  2KSR A;  4YFS A;  4PK4 A;  4LF6 T;  3PDY A;  3CQX C;  3AAE B;  3T88 A;  2EHO C;  2Y6X A;  5JRE A;  5FXV A;  4GIW A;  3UFE A;  1Z0P A;  4OHF A;  4K0K T;  5LGN B;  1KK7 A;  3TRR A;  4OYJ A;  1RJM A;  2WWU A;  5HXC A;  5AQS B;  2VQE T;  2P63 A;  2LOS A;  1Y64 B;  1CUN A;  4H9S E;  3EDV A;  4ZS3 A;  4AI6 A;  3IEE A;  5EK4 A;  3AA0 B;  1IBM T;  4GKJ T;  2NR4 A;  4DUY T;  3NZQ A;  4YTN A;  3RQF A;  4UEL A;  3RHW A;  1MJ3 A;  3MOY A;  1Q51 A;  1WRD A;  5ABH A;  4X1K E;  2PBI A;  4U19 A;  3L09 A;  2BS4 A;  2LKH A;  4DR3 T;  1IJ5 A;  3QUJ A;  5AQR B;  4QX8 B;  2BKN A;  2BVM A;  1HFA A;  1W9R A;  1G8X A;  1KFY A;  4Z8X A;  3UUM A;  2D0T A;  2AE9 A;  5E0O A;  1XMQ T;  1HNZ T;  4JCS A;  1U5P A;  3EAB A;  4BAY B;  3ONL C;  3AE9 A;  3I9W A;  4JI5 T;  3AEF A;  1SHZ C;  4XBF B;  2C5K T;  3Q9D A;  3SOL A;  4TNW A;  3IBP A;  3X1D A;  4JI6 T;  3QK8 A;  1XDP A;  2VK9 A;  3WI3 A;  2XSB A;  3MK7 C;  2D0U A;  4BJM A;  5IUX A;  1D0X A;  5FKY A;  2M6B A;  2JIW A;  3AEE A;  3LK2 B;  1QSD A;  2XPK A;  5AQI B;  2WDV A;  2E9X D;  3QK6 A;  1IBL T;  2HPL A;  4JV5 T;  3LSV A;  1W09 A;  4PK5 A;  2NWB A;  3ZST A;  5AQV B;  2UXX B;  5LYJ E;  2WBL A;  2CWY A;  1HG2 A;  3UTK A;  1EY3 A;  5CA0 E;  3G64 A;  3ZLI A;  2X0L B;  2JPF A;  2A2F X;  3KDS E;  5JR9 A;  5AQQ B;  2DNX A;  3S4U A;  3FDU A;  2IC9 A;  4XAX B;  4NNQ A;  1LKX A;  4UF0 A;  2WSS V;  1JXZ A;  4MFR A;  3PUG A;  4AKG A;  4PFO A;  3E08 A;  5H6Q B;  4DR6 T;  2BKO A;  3H37 A;  1HNW T;  3I1A A;  3M3Z B;  4YTP A;  4NXM T;  1O3X A;  3SWX A;  2XAQ B;  2LE8 A;  3BQL A;  1JNZ A;  4HFH A;  4UXN B;  4DR1 T;  2WU2 A;  1IZN B;  2CE7 A;  2V26 A;  3ADC A;  4ZEY A;  1WYB A;  1MMG A;  3RH3 A;  2Q9Q B;  4ZU2 A;  4HFC A;  4ILA A;  4HFE A;  3KBT A;  2VKD A;  3GWH A;  3NRX A;  1NWM X;  2IAK A;  3A7M A;  3UU5 A;  1U4Q A;  3K3N A;  4BA9 A;  4HWD A;  3EAM A;  3AXJ B;  1MIW A;  5FY7 A;  3SWH A;  3IF8 B;  3W15 B;  2WY2 A;  3AVS A;  3ABV A;  2W4X A;  2X68 A;  4WCZ A;  4UV9 B;  5L4H A;  3L8R A;  4JI0 T;  5L3D B;  2L9Q A;  1QLB A;  1ZOY A;  4ZHQ E;  2KT9 A;  4DR4 T;  1HF8 A;  3UFG A;  3NRY A;  2CCQ A;  3W8I B;  2ES0 A;  4IL4 A;  3VU7 H;  1WR0 A;  2K24 A;  2XQ7 A;  3ZEF B;  5IWA T;  4P1N A;  1ZHC A;  2KLQ A;  3TLF A;  1UX5 A;  2YN6 A;  3A4L A;  4IRE A;  3GN5 A;  3AEB A;  5JR9 C;  1MND A;  3RRC A;  5C9G A;  4IL9 A;  2E8I A;  2Y48 B;  4JI4 T;  3C98 B;  5L3E B;  1OED B;  2ODV A;  2FUP A;  4QIJ A;  1N36 T;  4YHJ A;  5FP3 A;  3RYC E;  3O4X E;  2WWV A;  3VHL A;  3SFD A;  4ILU A;  2E9X A;  3P5M A;  2WMN A;  2NW9 A;  3TLT A;  4JEU B;  3CVR A;  2NTY A;  4E7Z A;  3KV6 A;  2CXL A;  4F6R C;  2H89 A;  2PG8 A;  2LM9 A;  3RKO A;  3QOF A;  2CWO A;  2H7V C;  4JI1 T;  1ZEE A;  5HWX A;  3QNU A;  3TLV A;  4I0U A;  4TUY E;  2G0U A;  4O4J E;  3T89 A;  3UT5 E;  3VKH A;  4WZX A;  4XZC A;  2BG9 E;  2CLY C;  4MAL A;  3FZH B;  3RI5 A;  2V5D A;  4ILC A;  2V6Y B;  4DO0 A;  2KIN B;  4HGA A;  4ZXL A;  2HN1 A;  3PUV F;  4EZH A;  4CI3 B;  5JTG A;  4K0U A;  5HEO A;  4WW0 A;  2K9A A;  4L5G A;  4M1P A;  3KVA A;  2X9X A;  5J2U E;  2Q9Q D;  2WCA A;  5HEJ A;  4WBO A;  5KDM C;  2BBH A;  5JH7 E;  3R9T A;  1FMV A;  3N9O A;  1DU2 A;  3ZC1 A;  3EDU A;  4HWC A;  3HKE E;  2H3R A;  2E2A A;  3FZF B;  3SFE A;  3GMI A;  2DWK A;  5AQG B;  2VUR A;  4JI8 T;  3N9P A;  3BQI A;  2H7O A;  1VCS A;  3L8I A;  2WMO A;  4UVC B;  2JQH A;  4CZZ B;  2UUC T;  3AE5 A;  5AFU L;  2PBP A;  3IRB A;  4K2N A;  4NUU A;  2CBJ A;  2E9X C;  4LF8 T;  5AQK B;  4ZZC A;  3KQF A;  2NW8 A;  5ABF B;  4I50 E;  2EJ5 A;  4CI1 B;  3RQW A;  2RA1 A;  2ODU A;  3UUX B;  3WAK A;  2XQA A;  5CGM A;  4IE6 A;  4LF5 T;  4DR2 T;  3OJA A;  4GEH B;  3UUN A;  5L3G B;  4AIS A;  3FZK B;  1BR1 A;  4IZB A;  2J47 A;  2MPK A;  3CKD A;  3UUL A;  2FJA A;  3CWZ B;  3P4W A;  1J5E T;  4DV7 T;  4PFP A;  4PAG A;  2X9W A;  2W62 A;  4C91 A;  2WB5 A;  3K3Q C;  2ZMA A;  1XNR T;  2KMF A;  5FXW A;  5LGT B;  2QYW A;  3PUZ F;  1V9D A;  2LKG A;  4X1I E;  5CA1 E;  4K3W A;  4X20 E;  3UU3 A;  2CHN A;  2PTF A;  4HEA A;  4ZI7 E;  3H3M A;  4HWH A;  4JBW F;  1ZV4 X;  1ZP0 A;  4IDQ A;  3LDQ B;  4EED A;  5M4Y A;  1UX4 A;  1S94 A;  3EHZ A;  4CI2 B;  4KX6 A;  4ZI3 D;  2ZQR A;  3N5L A;  2LRL A;  3RIU A;  2DL1 A;  3ZN1 B;  5HCM A;  4ASK A;  1D1B A;  3HR0 A;  2BBJ A;  2Y8D A;  2XAJ B;  2UU9 T;  3V5S A;  2ACZ A;  4V1A v;  3BK9 A;  2V1D B;  3ZJ1 A;  3LJC A;  5EK3 A;  3AE3 A;  4E7S A;  4H9N C;  2VWA A;  4OX9 T;  2Q9Q A;  4IZD A;  4U3C A;  3P4S A;  1E1H B;  4P0B A;  5JDL A;  3C4X A;  5L2L A;  3T8A A;  2YDS A;  4TX5 A;  1FJG T;  4NIQ A;  5LBQ B;  2FJD A;  4DMW A;  3ESL A;  3AXJ A;  3RLF F;  3I0O A;  1MIY A;  1HX1 B;  1J1J A;  2CEA A;  3F2E A;  2VQF T;  5A1L A;  5JQG E;  4GK0 E;  2XZE A;  5FVK A;  3VR9 A;  4IE7 A;  2VB6 A;  4L0R A;  2W2U A;  3MA9 A;  3ADD A;  5AQL B;  5CB4 E;  3ONX A;  1HX8 A;  4QXB B;  3ZYK A;  3ZYL A;  3L39 A;  4AQG A;  3J9X 1;  3ZPO A;  3C4W A;  5LNK A;  3OYX A;  2I6H A;  3KBU A;  4JWV A;  1UUR A;  4AKL A;  4QHO A;  4X5T A;  1UCU A;  3A4M A;  3RIU C;  5L3F B;  1OED A;  2FJE A;  2WS3 A;  5JBW A;  2DLR A;  1VRB A;  3LK3 B;  2VL0 A;  4PJN A;  4X66 T;  3P50 A;  4NUV A;  5LP6 E;  3O1J A;  2VAS A;  2C5J A;  2X0Y A;  2LSK A;  4AKH A;  4IGU A;  1EF9 A;  4OFZ A;  3P7I A;  3ZSS A;  2Q9Q C;  3RYH E;  1SE7 A;  2JJ9 A;  2VKO A;  4IIJ E;  1L0V A;  2J1D G;  4ZS2 A;  1B7T A;  4CN1 A;  1KF6 A;  3Q0J A;  1VOM A;  3QC9 A;  5FL0 A;  3OBV E;  1CHU A;  5LXT E;  3N2O A;  4AIU A;  3CK6 A;  1T98 A;  3RX6 A;  4PK6 A;  4LF4 T;  2V6Y A;  1WFD A;  4CN6 A;  4IHJ E;  5L4E A;  4KP3 C;  3AE4 A;  4DBR A;  5AQM B;  1YQ4 A;  3AA6 B;  4ZI2 C;  2F4V T;  2LOP A;  3JC6 D;  1LVK A;  4EV6 A;  4I55 E;  2DCF A;  3RRW A;  4BJN A;  4UV8 B;  2P9B A;  2PFV A;  4O2B E;  4EIW A;  3M65 A;  3P4Q A;  4FZW A;  2F6Q A;  5AQU B;  4EOZ B;  2XM2 A;  3ANW B;  2N9D A;  2H88 A;  4QWN B;  4IDP A;  3PUR A;  2XM1 A;  2CXD A;  4JI2 T;  1G73 A;  2NOX A;  3A5X A;  3OTO T;  1QUU A;  5HAX A;  2E5V A;  3MYB A;  1OED C;  4TN7 B;  2VVN A;  3O1I A;  4MHC A;  3H3A A;  4TZ4 C;  3FZL B;  2MBG A;  4CQI A;  1XWM A;  5FL1 A;  5ABF A;  1XDO A;  4IDZ A;  1FEW A;  3VR8 A;  5JDN A;  5LMN T;  4EEB A;  3AEA A;  3QXI A;  3EI0 A;  1KNZ A;  4FI5 A;  4KHP T;  1KNR A;  2B1E A;  4ANJ A;  5DJQ C;  3ZMT B;  3SRZ A;  5EZY E;  4ZI3 C;  5JVD E;  4DR5 T;  2XUE A;  2IC6 A;  4YTM A;  4GYS A;  3RQU A;  5HEH A;  4AKI A;  5LOV E;  2QGS A;  5J0Z A;  2BS3 A;  4EYY R;  5JDH A;  2X9H A;  1WR6 A;  5EK2 A;  3AB3 B;  4QKN A;  3UQ7 A;  3EVY A;  5FYM A;  4B6X A;  2XQ8 A;  2ZM8 A;  3ZCI A;  5FMN A;  3PE0 A;  4QII A;  3FXD B;  4UR9 A;  5HXH A;  1RJN A;  1IAP A;  5LGU B;  2J62 A;  2OA5 A;  2JRK A;  3QB5 A;  3ZJ2 A;  2V6X A;  1UUS A;  5AQF B;  5CJ5 A;  4FZW C;  3RIA A;  4LFC T;  4X65 T;  5LG3 A;  4ELS A;  2V7J A;  3P4R A;  5F3J A;  4H9Q C;  1E7P A;  3C64 A;  2BG9 B;  2NP9 A;  1HTJ F;  4HFI A;  4ISS A;  2ZM2 A;  3PUA A;  3ZMU B;  3R84 B;  5LHG B;  1GQE A;  4LFB T;  2IW5 B;  3OC7 A;  2C5I T;  3AE6 A;  1T7S A;  2MAW A;  4ELX A;  4EAH A;  4L9I A;  1NAF A;  5C2T A;  3RIF A;  3RSI A;  5L3C B;  3JCF A;  2WZH A;  3ZYM A;  3TLW A;  1T72 A;  4OLQ A;  2YDR A;  3ZKR A;  3HKC E;  5ABG A;  2X67 A;  4I52 A;  4ERR A;  1YKH B;  1EF8 A;  3B5M A;  2KXP B;  3AJM A;  3E0Z A;  4GYR A;  4LFA T;  3DP7 A;  5FXX A;  2CM0 A;  3PUY F;  2CMR A;  2WP9 A;  2VRE A;  3PV0 F;  4HFV A;  1HR0 T;  3N2G E;  3ZMV B;  2KWI B;  3OVU A;  3OYZ A;  2UUB T;  4KBM B;  3I0Q A;  3AAA B;  1W0A A;  3AED A;  3R0O A;  3HKB E;  4PW8 A;  5BMV E;  2FBW A;  3MKD A;  2XAS B;  2LM2 A;  2XAH B;  5LA6 E;  1D1A A;  3CQC B;  2BKP A;  1H7C A;  3AEG A;  5FXZ A;  4U2Y A;  3PUW F;  4QXC B;  2DUB A;  4DID B;  4OG1 A;  4LF7 T;  4IE0 A;  4H9P C;  3SLL A;  5HEG A;  4P0A A;  3U3I A;  2J4G A;  3IHR A;  2D5U A;  4J2C A;  4A98 A;  4NPP A;  5LB7 B;  1XNQ T;  3LBX B;  3P8C D;  2JQ9 A;  1US7 B;  3CIR A;  3FBZ A;  4JYL A;  3DTO A;  5ETW A;  3QB5 K;  2LLY A;  2PPY A;  4QH5 A;  3CPZ A;  5AQP B;  3JC6 C;  1N34 T;  3K8P C;  2YIN A;  5HXS A;  4QXH B;  5DQW A;  4DV6 T;  4JI3 T;  1I94 T;  3I47 A;  1NZY B;  2LHR A;  4YJ2 E;  4JYA T;  1WZ8 A;  4HWF A;  2XTL A;  5J1G A;  2ACX A;  4U31 A;  2GTR A;  4U2Z A;  4ZOL E;  1EZ3 A;  4LML A;  4EYU A;  3ETV A;  4B3S T;  3NVO A;  3ETU A;  2HH7 A;  4U33 A;  4O4L E;  3LFM A;  4CXY A;  3K1S A;  3VRB A;  2YK0 A;  3ZT7 A;  4H9O C;  2QVA A;  3N9N A;  4LMJ A;  2FW2 A;  3A8Y C;  4U74 A;  2MYS A;  4AXP A;  4EXT A;  5AQH B;  3ZMZ B;  3ZC0 A;  2DHR A;  4COF A;  2XSA A;  4JLE A;  5HXE A;  3KV4 A;  3PZK A;  3C50 A;  5JBX A;  2BZB A;  1UGO A;  4AKR B;  1HG5 A;  4DV3 T;  3ANW A;  3KFW X;  2XQ3 A;  1WCR A;  4O4H E;  4KHZ F;  1Q52 A;  3K3O A;  5KX5 E;  5LHI B;  4TWD A;  3T8O A;  5JDG A;  2X9Y A;  2UUA T;  3MJX A;  4DUZ T;  3AA7 B;  5LJM A;  1D0Y A;  4KI0 F;  1XZY A;  2X51 A;  1UK5 A;  1FMW A;  5J2T E;  1DCI A;  3NKZ A;  3RYI E;  4TV8 E;  3H02 A;  3AA1 B;  1HS7 A;  4N78 D;  4JUY A;  3DJB A;  4CXW A;  4FJO A;  1BR4 A;  2I0M A;  2UXN B;  3TKL B;  5LJN A;  5JDM A;  2NW7 A;  2E5L T;  5CFB A;  2XQY A;  2QA7 A;  4H63 V;  5C3J A;  2XHE B;  4UIG A;  3CQG B;  4QX7 B;  3AE1 A;  4YSZ A;  1FIO A;  3AVR A;  2DWG A;  3C51 A;  2YU1 A;  2LSG A;  2LJL A;  1YQ3 A;  3RPU A;  3ZN0 B;  1MMA A;  2HPJ A;  2LSJ A;  4JEH B;  4PJM A;  1HNX T;  3MZK B;  3LG7 A;  2W67 A;  4OK0 A;  1D0Z A;  3PTR B;  4TWF A;  2XY8 B;  4UEM A;  2ZQQ A;  2WDQ A;  5JDF A;  3W8H B;  4CN4 A;  3MAC A;  3AEC A;  1YW0 A;  5BR8 T;  3Q2M A;  4O8S A;  2YKS A;  3RKG A;  3PU8 A;  4PJL A;  2HHH T;  4ADZ A;  2LHN A;  1LRZ A;  4X62 T;  2LEH A;  2OLT A;  3CX6 B;  4U7Y A;  4WYV A;  2D9D A;  2BG9 A;  3UU8 A;  2KZ7 B;  1MMD A;  4DV0 T;  4NXN T;  3UQ4 A;  3OKQ A;  1T8B A;  5KMG P;  2K5B B;  5IHY A;  4GOU A;  3Q5E A;  3Q5D A;  4QH1 A;  3FHN A;  3PJA J;  5GON E;  1SA0 E;  1OWA A;  3B57 A;  4JFC A;  3ZCJ A;  5ADX L;  3HIN A;  3WAJ A;  5HEU A;  1YXR A;  5L3B B;  3BQK A;  2EHO B;  2W66 A;  1IJ6 A;  3KVB A;  4KNP A;  1XMO T;  5LCY A;  3FBL A;  2V7L A;  2AXD S;  3CX7 B;  3FB2 A;  2XAG B;  1Y01 A;  1UIY A;  4EGW A;  2VL8 A;  2MOZ A;  3U78 A;  3HL6 A;  3RF1 A;  2BS2 A;  2YOE A;  5HCJ A;  4O4I E;  3NZP A;  2CXF A;  1HCI A;  4U18 A;  4HN9 A;  3P4P A;  1Z8U A;  3RGL A;  2IDO B;  5H6R B;  3UU6 A;  3UUB A;  5HYA A;  4B3M T;  3JAD A;  2LSY A;  5HXR A;  4U7I A;  4Q25 A;  3N9Q A;  4MBQ A;  5ABE A;  3LBX A;  4FJW D;  3FXE B;  4YY3 T;  2BG9 C;  3UU4 A;  4AQF A;  3HKD E;  4MOU A;  1WYC A;  4YT0 A;  3LK4 2;  1JNR A;  4PNI A;  3I9Y A;  4I4Z A;  2WZI A;  5L47 A;  5JRC B;  2FJB A;  4IE4 A;  5LMU T;  3VRA A;  1WLX A;  2VKH A;  4A5X A;  4IDN A;  1M62 A;  3ZMS B;  4UVA B;  1NZY A;  1ZKE A;  1NEK A;  2X66 A;  2VX2 A;  3TLU A;  1D1C A;  2UXB T;  4B3T T;  2N2N A;  1KNP A;  4YXD A;  3L8J A;  2JMK A;  2VKJ A;  4A97 A;  2Z6E A;  5DQV A;  3HRX A;  4UVB B;  4DMV A;  4P09 A;  2DI4 A;  3AAI A;  1R8I A;  4H9R C;  2JQQ A;  4KUM B;  3N9L A;  4WBN E;  4TNV A;  2FBM A;  2CA5 A;  3L3P A;  2QRX A;  2ZM0 A;  2BVL A;  2A3D A; 
#chains in the Genus database with same CATH homology
 3UTK A;  2EHO D;  3I0O A;  4HTE A;  5CA0 E;  3CPZ A;  3ZLI A;  2X0L B;  1MIY A;  2JPF A;  2A2F X;  3KDS E;  5JR9 A;  3JC6 C;  2DNX A;  2K48 A;  2CEA A;  3S4U A;  3K8P C;  3F2E A;  4O2A E;  2YIN A;  2V7K A;  2IC9 A;  4XAX B;  5FY1 A;  5HXS A;  4DVD A;  4QXH B;  5A1L A;  5LHH B;  4NNQ A;  5JQG E;  5DQW A;  4GK0 E;  1LKX A;  4UF0 A;  2WSS V;  3V5U A;  4MFR A;  2XAF B;  1MIV A;  3PUG A;  4AKG A;  4PFO A;  4YJ2 E;  2LHR A;  3E08 A;  4IE7 A;  2VB6 A;  5H6Q B;  4L0R A;  1BR0 A;  2XTL A;  5J1G A;  2ACX A;  2L8K A;  3MA9 A;  4AQF C;  3H37 A;  4H63 H;  5FY0 A;  3ADD A;  4ZOL E;  5CB4 E;  1EZ3 A;  3ONX A;  4EYU A;  1HX8 A;  3I1A A;  1O3X A;  2YU2 A;  3ETV A;  2NTX A;  4QXB B;  2XAQ B;  2LE8 A;  3BQL A;  3J7Y q;  3ETU A;  3ZYK A;  3ZYL A;  2HH7 A;  2I59 A;  4O4L E;  2W0G A;  4UXN B;  4AQG A;  3J9X 1;  3RYF E;  3LFM A;  2WM9 A;  3ZPO A;  4CXY A;  5IYZ E;  1IZN B;  2CE7 A;  2V26 A;  3ADC A;  2YK0 A;  3C4W A;  5LNK A;  1WYB A;  1MMG A;  3OYX A;  3R6N A;  3RQG A;  3RH3 A;  3RC3 A;  3KBU A;  4H9O C;  2Q9Q B;  4AKL A;  4QHO A;  3HI2 A;  3N9N A;  1UCU A;  3KBT A;  2VKD A;  3GWH A;  3NRX A;  1NWM X;  3A4M A;  2IAK A;  2MYS A;  4U74 A;  5L3F B;  1U4Q A;  4AXP A;  4EXT A;  3PUS A;  3ZC0 A;  3ZMZ B;  2DHR A;  3K3N A;  4JLE A;  5HXE A;  2DLR A;  3KV4 A;  4BA9 A;  3EUH A;  1VRB A;  3LK3 B;  3C50 A;  3F31 A;  2BZB A;  1MIW A;  5FY7 A;  3SWH A;  4PJN A;  3IF8 B;  3W15 B;  4AKR B;  3AVS A;  1HG5 A;  4NUV A;  3ANW A;  3KIN B;  5LP6 E;  2X68 A;  3KFW X;  4UV9 B;  3CX8 B;  3O1J A;  5HWY A;  5L3D B;  2VAS A;  2C5J A;  3KV9 A;  4O4H E;  2LSK A;  5JR9 B;  3K3O A;  4AKH A;  4IGU A;  5KX5 E;  4DND A;  2L9Q A;  3B13 A;  2W61 A;  4ZHQ E;  5LHI B;  3T8O A;  2KT9 A;  4OFZ A;  1HF8 A;  3P7I A;  4HE8 A;  2Q9Q C;  3RYH E;  5JDG A;  2X9Y A;  3NRY A;  2JJ9 A;  2VKO A;  3MJX A;  4IIJ E;  2CCQ A;  4UF0 B;  3AM1 A;  2J1D G;  3AA7 B;  5LJM A;  3E22 E;  1D0Y A;  4ZS2 A;  1B7T A;  3W8I B;  1MNE A;  2ES0 A;  1VOM A;  2V7M A;  3QC9 A;  2X51 A;  3VU7 H;  3OBV E;  5LXT E;  1FMW A;  3N2O A;  4IST A;  5J2T E;  2K24 A;  2MTQ A;  1LVF A;  3ZEF B;  3RYI E;  1ZHC A;  2KLQ A;  4TV8 E;  4C90 A;  1UX5 A;  3AA1 B;  1HS7 A;  1T98 A;  4N78 D;  4OYK A;  4IE5 A;  4JUY A;  4I43 B;  3DJB A;  3RX6 A;  4PK6 A;  4CXW A;  3SS1 A;  3A4L A;  1BR4 A;  2L3L A;  4FJO A;  4IHJ E;  2UXN B;  3GN5 A;  4KP3 C;  3TKL B;  5JR9 C;  1MND A;  3RRC A;  5LJN A;  5JDM A;  4ZI2 D;  2NW7 A;  5FNV E;  4DBR A;  2E8I A;  3N2K E;  2XQY A;  3AA6 B;  4ZI2 C;  3HA4 A;  1AJ3 A;  2LOP A;  2Y48 B;  2QA7 A;  3C98 B;  3JC6 D;  3Q5X A;  4H63 V;  4EZ4 A;  2RP4 A;  1LVK A;  4I4T E;  2XHE B;  2N1G A;  4UIG A;  3CQG B;  4QX7 B;  4I55 E;  3F57 A;  5L3E B;  2ODV A;  2DCF A;  3RRW A;  4BJN A;  4UV8 B;  2A3D A;  2P9B A;  2PFV A;  4YHJ A;  2M67 A;  2PJQ A;  5FP3 A;  4EB6 E;  3RYC E;  3O9X A;  4O2B E;  4EIW A;  3GA8 A;  1FIO A;  3M65 A;  3O4X E;  3AVR A;  2DWG A;  3VHL A;  2CLY B;  3C51 A;  2YU1 A;  2LSG A;  4YLH A;  2LJL A;  4ILU A;  2E9X A;  4EOZ B;  3PU3 A;  3O1H A;  3RPU A;  3RQE A;  2WMN A;  2W63 A;  3ANW B;  3ZN0 B;  2LT3 A;  2N9D A;  2NW9 A;  1MMA A;  4G63 A;  5JDQ A;  2HPJ A;  4QWN B;  1BR2 A;  4JEU B;  2LSJ A;  4DBQ A;  4JEH B;  3PUR A;  4PJM A;  3CVR A;  2CXD A;  2NTY A;  3MZK B;  4E7Z A;  3KV6 A;  2CXL A;  2EHO A;  1G73 A;  4F6R C;  3LG7 A;  4YJ3 E;  2PG8 A;  2NOX A;  2LM9 A;  3RKO A;  4OK0 A;  1D0Z A;  3A5X A;  2CWO A;  3PTR B;  4UEM A;  2H7V C;  1ZEE A;  4KMC A;  5HWX A;  1QUU A;  2LSI A;  5JDF A;  5HAX A;  4CXX A;  3W8H B;  5C8Y E;  2W00 A;  3MAC A;  1S35 A;  1YKE B;  4TUY E;  1YW0 A;  4TN7 B;  2G0U A;  5F8P A;  3VKG A;  3Q2M A;  4O4J E;  1YD8 G;  3UT5 E;  4O8S A;  3O1I A;  3VKH A;  2ZLY A;  3PU8 A;  4MHC A;  4HKA A;  4PJL A;  4XZC A;  4ADZ A;  2CLY C;  4MAL A;  3H3A A;  2KWH A;  2LHN A;  4TZ4 C;  1LRZ A;  2MBG A;  4CQI A;  2LEH A;  3MXZ A;  4X1Y E;  4DO0 A;  4IDZ A;  3CX6 B;  2KIN B;  1FEW A;  3GN5 B;  4HGA A;  4EZH A;  1X79 A;  5JDN A;  4CI3 B;  4K0U A;  2KZ7 B;  1MMD A;  4WW0 A;  3ADB A;  4GK5 E;  2K9A A;  3N9M A;  4FI5 A;  4L5G A;  3OKQ A;  1KNZ A;  4M1P A;  5DAB A;  2BDE A;  5LG4 A;  2D2S A;  3KVA A;  2X9X A;  3CML A;  3D0T A;  5KMG P;  2K5B B;  5IHY A;  5J2U E;  4GOU A;  2B1E A;  2JMH A;  2Q9Q D;  4WBO A;  3Q5W A;  4MLK A;  4ANJ A;  4G2A A;  5DJQ C;  5KDM C;  3ZMT B;  3A4N A;  5JH7 E;  3SRZ A;  2WAU A;  5LBM A;  5EZY E;  2YEV C;  4ZI3 C;  3FHN A;  1FMV A;  3N9O A;  5JVD E;  2XUE A;  3ZC1 A;  2IC6 A;  1MMN A;  2E9X B;  3EDU A;  5GON E;  2GK9 A;  4A56 A;  1SA0 E;  3HKE E;  1OWA A;  4GYS A;  3B57 A;  3PUQ A;  4WNK A;  4AKI A;  3ZCJ A;  4PJJ A;  2SPC A;  5LOV E;  2H3R A;  5ADX L;  3KV5 A;  2QGS A;  3WAJ A;  2A72 A;  3C4Z A;  3RC8 A;  3GMI A;  4EYY R;  5JDH A;  2X9H A;  3NBX X;  5L3B B;  3BQK A;  2EHO B;  1WR6 A;  4TV9 E;  1IJ6 A;  2DWK A;  3KVB A;  5EK2 A;  4U72 A;  1OXZ A;  3AB3 B;  4QKN A;  3EVY A;  5FYM A;  4B6X A;  3N9P A;  3BQI A;  2ZM8 A;  3ZCI A;  5FMN A;  2H7O A;  3PE0 A;  3L8I A;  3FXD B;  2WMO A;  5LCY A;  2KND A;  3FBL A;  2V7L A;  5HXH A;  3CX7 B;  3FB2 A;  4UVC B;  1IAP A;  5LGU B;  5JRC A;  2OA5 A;  2JRK A;  4CZZ B;  2XAG B;  3ZJ2 A;  2VL8 A;  2C0S A;  5AFU L;  2MOZ A;  3IRB A;  3U78 A;  4NUU A;  5TAO A;  2E9X C;  3HL6 A;  2NW8 A;  2V7I A;  4O4I E;  4I50 E;  3NZP A;  2V7J A;  5F3J A;  4YFS A;  2CXF A;  4PK4 A;  3PDY A;  1HCI A;  3CQX C;  4CI1 B;  4H9Q C;  2RA1 A;  3AAE B;  2ODU A;  3C64 A;  3UUX B;  2NP9 A;  1HTJ F;  2EHO C;  2Y6X A;  4ISS A;  3WAK A;  4HN9 A;  5JRE A;  4IE6 A;  2ZM2 A;  3PUA A;  5FXV A;  4GIW A;  3UFE A;  1Z0P A;  3ZMU B;  3OJA A;  4OHF A;  3R84 B;  4GEH B;  3UUN A;  5LGN B;  5LHG B;  1KK7 A;  2IW5 B;  5L3G B;  2C5I T;  4OYJ A;  1RJM A;  2WWU A;  1BR1 A;  5HXC A;  2P63 A;  2LOS A;  1Y64 B;  5H6R B;  4L9I A;  1NAF A;  1CUN A;  3CKD A;  4H9S E;  4EAH A;  3UUL A;  3EDV A;  4ZS3 A;  4AI6 A;  3CWZ B;  3IEE A;  5EK4 A;  3AA0 B;  4PFP A;  5HYA A;  5L3C B;  2LSY A;  5HXR A;  4PAG A;  3ZYM A;  2X9W A;  3NZQ A;  2W62 A;  3N9Q A;  3RQF A;  4C91 A;  3K3Q C;  4MBQ A;  4UEL A;  3LBX A;  2ZMA A;  3FXE B;  2KMF A;  5FXW A;  5LGT B;  1WRD A;  3HKC E;  1V9D A;  4AQF A;  4X1K E;  4X1I E;  2PBI A;  3HKD E;  3L09 A;  5CA1 E;  2X67 A;  4X20 E;  1IJ5 A;  1WYC A;  3QUJ A;  4ERR A;  3LK4 2;  4HEA A;  4QX8 B;  1YKH B;  4ZI7 E;  2BVM A;  4PNI A;  3I9Y A;  1HFA A;  1G8X A;  1ZV4 X;  2KXP B;  3AJM A;  3E0Z A;  5JRC B;  4Z8X A;  4GYR A;  3DP7 A;  4IE4 A;  5FXX A;  3UUM A;  2CM0 A;  1WLX A;  2D0T A;  5M4Y A;  5E0O A;  2VKH A;  1UX4 A;  1S94 A;  2CMR A;  4CI2 B;  3ZMS B;  4ZI3 D;  1U5P A;  3N5L A;  4UVA B;  1ZKE A;  3ZN1 B;  4HFV A;  4ASK A;  4BAY B;  1D1B A;  3HR0 A;  3I9W A;  2X66 A;  3N2G E;  3ZMV B;  2KWI B;  1D1C A;  3OYZ A;  2Y8D A;  1SHZ C;  4XBF B;  2C5K T;  2XAJ B;  3Q9D A;  2N2N A;  4KBM B;  3I0Q A;  3AAA B;  3V5S A;  4V1A v;  3SOL A;  3L8J A;  3HKB E;  4PW8 A;  2JMK A;  2VKJ A;  5BMV E;  3MKD A;  3BK9 A;  2Z6E A;  2XAS B;  2V1D B;  3ZJ1 A;  3IBP A;  3LJC A;  5EK3 A;  2XAH B;  5LA6 E;  1D1A A;  5DQV A;  3CQC B;  4UVB B;  4E7S A;  5FXZ A;  1H7C A;  2VK9 A;  4DMV A;  3WI3 A;  4H9N C;  4QXC B;  4P09 A;  2DI4 A;  3AAI A;  4H9P C;  4IE0 A;  2VWA A;  3MK7 C;  2D0U A;  4H9R C;  4BJM A;  4P0A A;  2JQQ A;  2Q9Q A;  3U3I A;  3IHR A;  1D0X A;  1E1H B;  2D5U A;  4P0B A;  4KUM B;  3LK2 B;  3N9L A;  4J2C A;  5JDL A;  1QSD A;  3C4X A;  4WBN E;  5L2L A;  4TX5 A;  2E9X D;  3LBX B;  3QK6 A;  2HPL A;  3P8C D;  1US7 B;  3FBZ A;  4PK5 A;  2CA5 A;  2NWB A;  5LBQ B;  4DMW A;  3ESL A;  3L3P A;  2UXX B;  2ZM0 A;  5LYJ E;  3DTO A;  2BVL A;  2CWY A;  2WBL A;  5ETW A;  1HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...