3O4XE

Crystal structure of complex between amino and carboxy terminal fragments of mdia1
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
454
structure length
433
Chain Sequence
VLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a complex between amino and carboxy terminal fragments of mDia1: insights into autoinhibition of diaphanous-related formins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Protein diaphanous homolog 1
total genus 128
structure length 433
sequence length 454
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02181 FH2 Formin Homology 2 Domain
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.80 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3o4xE01
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE03
1Y64B 1V9DA 1UX4A 2Z6EA 2J1DG 4EAHA 1UX5A 3OBVE 3O4XE
chains in the Genus database with same CATH superfamily
5FXVA 1YD8G 5AQNB 4ERRA 4AKIA 4HWHA 3AVRA 3VHLA 4OYKA 4DR7T 3OYXA 4HFEA 4CI3B 3NZPA 2W66A 2KLQA 5AQTB 4EZHA 2VREA 1DU2A 4GEHB 3KINB 1UX4A 2C5JA 3HKDE 3ZMSB 2PG8A 4JI4T 1D1CA 4YLHA 1UX5A 1D1AA 4ZOLE 2YU2A 4H9QC 2HHHT 2YDSA 2CXFA 3AAEB 3TLFA 4MOUA 2XQ3A 3EDUA 3PUGA 5EK2A 3AB3B 2P9BA 3RQWA 4TNWA 1WR0A 3ZMVB 2VKHA 4C91A 4NXNT 3OTOT 5CFBA 2D5UA 4AI6A 2WAUA 1Z8UA 5DJQC 4JEUB 4A97A 3PUZF 3F57A 2PFVA 1EF8A 4IE5A 2CPTA 2CHOA 4HN9A 1DUBA 4IL9A 3MA9A 2VKJA 4JUYA 1XNQT 4U3CA 1H7CA 1JNRA 2K5BB 3EHZA 3I0QA 4HFHA 3JC6C 4QH1A 2BS3A 4KBMB 4I42A 3Q2MA 4ELXA 4NIQA 4DR6T 4FI5A 4JI8T 3MYBA 5H6RB 2IW5B 5CJ5A 5FL0A 2UXXB 4QIIA 3CX7B 4X1IE 5KX5E 5FL1A 1VCSA 1V9DA 2E9XC 3JCFA 4QXBB 4GIWA 3FDUA 2DUBA 5JR9A 1SA0E 5LJNA 3A4NA 5L3DB 4QKNA 5C8YE 3K3QC 2WP9A 3KVBA 3TLVA 1T72A 2HN1A 1ZV4X 4JYAT 2UXDT 2WU5A 4NNQA 1XMQT 5L4HA 2EHOC 1VOMA 4QX7B 2L9QA 3MJXA 2DWKA 2RP4A 3FZLB 1YW0A 2PBIA 1NEKA 1T98A 2ACXA 1HCIA 4CI2B 4CN1A 4B3MT 2Q9QB 4CN6A 4ILCA 4JBWF 4JI3T 4X62T 3AJMA 2BG9C 1D1BA 5AQJB 4AXPA 1UURA 5HEHA 2W61A 4OYJA 5J2TE 1OEDC 2J1DG 4X20E 3O1JA 3VRBA 2LSIA 2JQ9A 2VX2A 4U74A 3PZKA 1LRZA 2DNXA 5CB4E 1UGOA 2X67A 5HAXA 2V6XA 5LJMA 3CQXC 3T8OA 4LFBT 2LKHA 3N9LA 4U33A 5HYAA 4HE8A 1MMGA 2XPKA 3UUXB 5HEJA 3PUXF 3F2EA 1HG5A 4CI1B 3TLSA 3PUAA 1S94A 5HCMA 2W62A 4F6RC 4ZI3D 3QK6A 2HN2A 3JC6D 2N1GA 1NWMX 1MMAA 2JQQA 3M65A 2QRXA 2WWUA 3CKDA 3RQFA 3OBVE 4TWDA 2VVNA 1CUNA 3IF8B 3AECA 4NUUA 3P8CD 4UVBB 4IE4A 2LE8A 3ADBA 4JCSA 1XNRT 4PK6A 1ZKEA 2XM2A 5LYJE 3AE6A 2VWAA 3LJCA 4WZXA 4H9SE 5LHGB 4IREA 5JVDE 4LF4T 4K2NA 5LGUB 4CN4A 4IGUA 4IDZA 2NW7A 3N2GE 4TV8E 4LF6T 3N9QA 4DV6T 1MNEA 3H3AA 3SS1A 2CCQA 2KNDA 2WQYA 2PPYA 4MHCA 4A56A 3RIAA 5LG4A 3KBTA 4K0KT 1KK7A 5C3JA 5M4YA 2VASA 5J2UE 3SOLA 3AXJA 2IUBA 2VB6A 1OEDB 2MOZA 3RH3A 2IAKA 2XHEB 4ADZA 4IZBA 3Q1TA 2V1DB 1IBKT 3ZSTA 3U78A 3GWHA 4EOZB 1ZHCA 5EZYE 4WBNE 4MBQA 1X79A 4NPPA 2H7OA 3HI2A 3Q0GA 2X9WA 3HKBE 5EK3A 3VR8A 4ZI2D 5JBXA 5HXCA 4HGAA 5L4EA 1O3XA 2JQHA 3P4WA 2UXNB 2WZIA 4QH4A 5L3EB 2NW9A 2X9XA 4PJLA 4I52A 3RKOA 5JDMA 2CLYB 4EXTA 4IDNA 3UULA 3AA7B 1OEDE 4LF8T 4X66T 2MYSA 3TRRA 2DI4A 2ZM8A 4P09A 5AQIB 4PK5A 4IE0A 4EYUA 3TKLB 2XQYA 5AQVB 2KINB 4F47A 4Z8XA 4AQGA 3B5MA 3Q5EA 4Z91A 2PJQA 3LK2B 2VK9A 2R6GF 2CMRA 3I9YA 2H88A 1U5PA 3Q0JA 2FJAA 4TWFA 5CGMA 4O4IE 3L3PA 3RKGA 3H3MA 3IEEA 4KNPA 1MMNA 2BS2A 2SPCA 1T7SA 2Q9QA 3ZT6A 4TZ4C 4IDQA 3SFEA 1WRDA 3R9TA 3TLUA 2NTYA 3UFEA 2XQAA 2LSJA 4ZS2A 4DR3T 3ETUA 4L5GA 5E0OA 5AQOB 5ETWA 2WMOA 5GONE 2XQ8A 5FMNA 5J0ZA 1W0BA 4L0RA 5HXSA 2J4GA 3CPZA 4AIUA 5JRCA 4UEMA 3LDQB 3EAMA 3PE0A 1HX8A 4EMLA 4HFBA 3J9X1 4HFVA 4JV5T 2XQ4A 3ZC0A 4GKJT 4MI2A 3HL6A 4PW8A 4JI6T 3W8HB 3C64A 2H7VC 3ANWB 4IZCA 2LHRA 5LB7B 4YTNA 4IHJE 3WI3A 2YEVC 4C90A 3SFDA 3RYHE 1D0XA 4QIJA 3PUSA 1EF9A 2BBJA 4B3ST 4I43B 1WFDA 2W00A 4IE6A 4PK4A 5IYZE 1T8BA 4HWDA 3LSVA 4FZWC 2JPFA 4TNVA 1Y64B 3IRBA 2I59A 4DR4T 2CWOA 4X1KE 1SE7A 3ZCJA 3L8JA 1XDPA 2MPKA 3UQ7A 3ZT5A 3AE9A 5JRCB 2BKOA 1B7TA 3GMIA 2I0MA 1KNRA 1WR6A 3AAIA 4OG1A 2FW2A 2V7LA 1SUMB 2DL1A 4JYLA 4AKHA 2V7MA 2CWYA 5J1GA 3FB2A 3FBZA 3P4RA 5L3CB 1HX1B 2VKDA 2CBJA 3AA0B 4OLQA 4ZU2A 2VL0A 1NZYB 2W2UA 3J7Yq 2K24A 2JRKA 2Q9QD 2D9DA 3RRCA 3KFWX 2H89A 5C9GA 3EABA 2IDOB 5JBWA 2KWIB 2GK9A 5FKYA 4OK0A 4PFPA 2CE7A 3PU3A 1BR1A 3ZSSA 1MIVA 3ABVA 5KDMC 3HRXA 2V5CA 4BAYB 3AEAA 3L39A 2WDQA 3PUQA 5AQRB 5JR9C 3QK8A 2V6YB 3UU6A 3UFGA 4N78D 4IT4A 3ADDA 5AQFB 4IZDA 1M7KA 5FY1A 4DR2T 5AQUB 4EGWA 3ZLIA 3NBXX 3CVRA 2JJ9A 3LG7A 2F6QA 3U3IA 3G06A 4HKAA 2UZFA 2BG9A 4PJNA 2WDRA 3L8RA 3P50A 3H81A 2DLRA 1X9BA 2YKSA 3D0TA 2RPAA 1UCUA 5FY7A 3RYCE 4AKLA 3AA1B 3BQIA 3CIRA 1N36T 1NZYA 5LP6E 4MALA 3ZMUB 3ZYMA 4U2ZA 1DCIA 1BR2A 3AEEA 2KZ7B 1J1JA 3T88A 3PDYA 3MKDA 4KX6A 4EB6E 3KV4A 2VQFT 4O8SA 2ZQRA 3O4XE 5F5WA 2PTFA 3EUHA 4H63H 3P4SA 3QUJA 2XSBA 2JMHA 1QLBA 5JDFA 5AQQB 4DBRA 3ZMZB 3N2KE 2KWHA 4U19A 3NVOA 3ZT7A 4A98A 2XAHB 3A4MA 3N9NA 4DVDA 4DV2T 2K9AA 4DUZT 5L3GB 4GKKT 4ZZBA 1D0YA 4U31A 3OC7A 5LMUT 3RI5A 3K1SA 4YJ2E 3RPUA 3FZKB 3AEFA 5FVLA 2NOXA 1MIYA 2CA5A 4DBQA 4DIDB 2WB5A 3RYFE 1IAPA 4AKGA 5AFUL 3O1IA 3L8IA 5HWYA 1WYBA 1WZ8A 3V5SA 4ASKA 1FJGT 2UU9T 3VKGA 3W8IB 3AEDA 4QH5A 5LGNB 3LFMA 5HXEA 3O9XA 3RQEA 4ILBA 3OJAA 2WWVA 4WBOA 4LF7T 3RSIA 4P0BA 1WYCA 2HPLA 3MXZA 5LBQB 2W63A 4JEHB 3RF1A 1HNXT 2VL8A 2B1EA 2I6HA 3FHNA 2CHNA 3B13A 4HWIB 2EHOD 3EDVA 4O4HE 4AKRB 3HKCE 4HTEA 4OX9T 2FBMA 4YHHT 5AQSB 2UUAT 3UU3A 3PUYF 3UU5A 4PAGA 4KHZF 4ANJA 2VURA 5C2TA 3ZPOA 1R8IA 2B76A 2WZHA 4GYRA 1YQ4A 3AM1A 3PUWF 3ADCA 1FIOA 3LK3B 2W4XA 5LHHB 4CZZB 4KUMB 2UXBT 2NP9A 4FJOA 4EEBA 4ZXLA 4COFA 1JXZA 1FEWA 2E5LT 4GOUA 5LHIB 4UXNB 2LRKA 4ZHQE 3G64A 2YN6A 4ILAA 5HXRA 3NRXA 3ZEFB 4AQYT 3ZYKA 1N33T 3AE1A 2A2FX 4P0AA 2V7JA 2X9HA 5FXZA 5BMVE 2CM0A 3IA3A 4M1PA 1VRBA 1G8XA 1M62A 3AEBA 5JDHA 4U2YA 3SWXA 3AE5A 3QOFA 4QX8B 3AE2A 2ODUA 2C5KT 3RIUA 3C51A 4P1NA 4ILUA 1I94T 4H9NC 2OLTA 5JREA 3C4XA 5KXJA 4PJMA 2LSYA 5ADXL 3L09A 1KNPA 4JI7T 2XAGB 5ABFA 1J5WA 3T1YT 4DV0T 2XJ7A 3CWZB 2NR4A 2FJBA 3MACA 2E9XD 4FZWA 1J5ET 2DWGA 2QQ3A 3CMLA 2DHRA 2XZEA 1FMVA 1UK5A 3VR9A 5JTGA 4DMVA 5JDGA 2X66A 3QB5A 2LHNA 5FNVE 2M6IA 2X9YA 2KT9A 5IWAT 2E8IA 2ZMAA 3N2OA 3K3OA 1IBLT 3NWIA 2LM2A 2IIUA 4IE7A 5AQHB 1SHZC 2X0HA 5LMNT 2XQ6A 1CHUA 3N9PA 1IBMT 2X0YA 2C0SA 2Y6XA 2LT3A 5FY0A 4H9OC 1OWAA 2CLYC 2X0LB 3JAFA 3P4PA 1RJMA 4I55E 2RA1A 4PFOA 4DUYT 1US7B 4DV1T 3BQLA 3NZQA 1HFAA 1XMOT 2E5VA 4DMWA 2E9XA 3DP7A 4DR5T 1NAFA 1OEDA 5CA1E 5ABHA 3EI0A 2V26A 4JI0T 4B6XA 3BQKA 2PBPA 3OKQA 4U7YA 2BG9B 2MBGA 1Q51A 4YSZA 2V8SV 4HWFA 4WCZA 2QA7A 4I4TE 2YINA 3ZCIA 3P5MA 3PV0F 2HPJA 5IUXA 3PU8A 3OPCA 3M3ZB 2H3RA 2IEXA 2EJ5A 3KVAA 4O2BE 3ZJ1A 5JDLA 2QGSA 5FVKA 2EHOB 3GN5B 4UVCB 3PJAA 2IHR1 3ZJ2A 1LKXA 1W0AA 2YK0A 5KMGP 2WBLA 4YJ3E 2OV9A 4ZZCA 3A7MA 2IMLA 1HNWT 2G0UA 2N2NA 4I50E 1IZNB 1LVKA 4OFZA 4ELSA 3R84B 2LOPA 4U7IA 4EV6A 3OYZA 4G63A 2Y48B 3UQ4A 5HXHA 4I0UA 2V5DA 5HCJA 3A8YC 2E9XB 3I1AA 3R6NA 3TLTA 3F31A 4TX5A 3DTOA 2DCFA 4GK0E 5F8PA 3TLWA 2WDVA 3UU4A 5FYMA 5KJPA 4NEKA 2Y8DA 3AVSA 3QXIA 4ZI7E 2EHOA 4UELA 3QB5K 5HEUA 1JNZA 3ZN1B 5BR8T 1VCTA 4PJJA 4CXWA 3R0OA 3I47A 2KMFA 2IC6A 4HFIA 1Z0PA 4YFSA 2CXLA 3LBXB 1AJ3A 4WNKA 2D2SA 4QXCB 4Q25A 2MAWA 4KHPT 4OHFA 1NENA 2P63A 1Y01A 2V7IA 3A5XA 3ESLA 2L3LA 1WLXA 2AE9A 4HFDA 5ABEA 5LA6E 3UTKA 3PTRB 2A3DA 2GTRA 1GQEA 2OA5A 3AXJB 5F3JA 3S4UA 3E22E 4DNDA 3RHWA 2HH7A 4F8HA 3C98B 2ACZA 1KFYA 5EK4A 2QYWA 3ZKRA 5AQGB 2WSSV 4ZEYA 2XQ9A 3K3NA 1QUUA 3VKHA 4JFCA 2XAFB 1ZP0A 4CQIA 3CQCB 2W67A 3SRZA 3SWHA 5L3BB 5ABGA 4YTPA 4DO0A 5JQGE 5LCYA 5DQWA 2LSKA 2XAQB 4KMCA 1HNZT 2UXCT 2LJLA 4HWCA 4CXXA 1QSDA 3H37A 3PJAJ 5TAOA 2KSRA 2NW8A 2XSAA 3RIUC 3T89A 3IHRA 1N34T 3H02A 1UIYA 3EVYA 3CQGB 2YOEA 4LMJA 2FBWA 4MFRA 2ODVA 3NRYA 5L47A 2IC9A 3P7IA 2WM9A 2LM9A 3RQUA 1I6ZA 2F4VT 1UUSA 3VRAA 3KBUA 3Q9DA 4TWHA 4B3RT 4O4JE 4XZCA 3UT5E 3ZN0B 1L0VA 1YXRA 3KV5A 4UF0B 5LG3A 5LGTB 3AAAB 5FXXA 3ZC1A 3UUMA 4YY3T 2QVAA 4EIWA 4QXHB 4AQFC 3ZYLA 5ABFB 3P4QA 4EZ4A 2XQ7A 2XUEA 2BVMA 3RGLA 2Z6EA 2UUBT 2YDQA 3JAEA 3ONLC 4Z90A 5L2LA 4ZI2C 2WMNA 2X51A 3UU8A 2XAJB 2ZLYA 5A1LA 3WAKA 1KF6A 3LBXA 2XY8B 4KI0F 2E2AA 2ZM6T 3K8PC 4TN7B 3BK9A 3ONJA 2C5IT 4TUYE 4X5TA 2A72A 4WW0A 4DV3T 4AISA 1S35A 4JOTA 4V1Av 2BKNA 3X1DA 1IJ6A 3Q5DA 2ZM2A 2JIWA 1BR4A 5H6QB 4B3TT 3ANWA 1MIWA 5LOVE 1W9RA 5AQLB 1HR0T 4HFCA 3KV6A 3JADA 5DABA 4DV5T 1HG2A 3A4LA 2D0UA 2J47A 1YKEB 2X68A 3AE3A 4TV9E 3CX6B 3MZKB 3FZMB 4A5XA 3QC9A 3RC8A 5HEGA 4UV9B 2CXDA 5LBMA 3NKZA 4ISSA 3HINA 3CK6A 4KP3C 4U1AA 4XAXB 4EYYR 2LSGA 4WYVA 3AE7A 4JLEA 1E1HB 3SLLA 4CXYA 1XZYA 1W09A 4QHOA 2J62A 4H9RC 2CRBA 4O4LE 3N5LA 4BJMA 2VQET 3DJBA 3I0OA 4YSYA 2K3WA 2LOSA 4K0UA 4IDPA 4PNIA 2M6BA 3FZFB 5CA0E 5JDQA 2BBHA 4LFAT 1E2AA 4NXMT 1OXZA 4JI5T 3OVUA 4EAHA 1WCRA 4U18A 4ZI3C 4K3WA 4UR9A 2YU1A 1Q52A 3Q5XA 4J2CA 3AE8A 1EZ3A 2WCAA 2V7KA 3ONXA 5JDNA 2ZM0A 2Q9QC 4YXDA 1KEYA 2BG9E 2M67A 2XTLA 3W15B 2W0GA 3GN5A 3PURA 4DV4T 2BS4A 4UIGA 2D0TA 2UUCT 2A9UA 3QXZA 1IJ5A 3GA8A 3ZMTB 3N9OA 4LMLA 3MK7C 3WAJA 3O1HA 4GYSA 4IL4A 3UUBA 3UUNA 4I4ZA 3ETVA 4X1YE 1RJNA 3RQGA 4LFCT 5FXWA 3RX6A 2CBIA 4DV7T 2LEHA 3C50A 4YHJA 4NUVA 4ZS3A 4GK5E 5HWXA 1ZEEA 2YDRA 4YSXA 3HKEE 4UV8B 3MOYA 1N32T 2XQ5A 4JI2T 4LF5T 1YQ3A 3E0ZA 2VKOA 3VU7H 3QNUA 4H63V 1XWMA 5HEOA 3PUVF 5DQVA 2K48A 3KDSE 4IIJE 4BA9A 5LXTE 2XASB 3FZHB 2FJDA 4X64T 3FXDB 4MLKA 2XM1A 3KQFA 3FBLA 4IDOA 1MMDA 2JMKA 4LMKA 5AQKB 1YKHB 5AQMB 3HA4A 2BVLA 3HR0A 1MJ3A 5JH7E 5LNKA 3C4WA 1BR0A 3Q5WA 3R9SA 3N9MA 4ELWA 2L8KA 4E7SA 4XBFB 4JI1T 3V5UA 2WU2A 4YTMA 4JWVA 2BKPA 4U72A 2LLYA 3RLFF 4E7ZA 4QWNB 3C4ZA 2N9DA 1D0ZA 4AQFA 2V6YA 4ISTA 3AE4A 2BDEA 2ZQQA 3RC3A 2FUPA 2HW5A 4G2AA 4UVAB 4O2AE 1E7PA 4FJWD 3RYIE 3KV9A 4X65T 1HZDA 2LKGA 1ZOYA 5IHYA 1EY3A 5JR9B 2MTQA 3T1HT 4YT0A 3AEGA 2VVSA 1HF8A 3LK42 1FMWA 5AQPB 1LVFA 4EEDA 5L3FB 2WY2A 3T8AA 4LF9T 2CEAA 2LRLA 2NTXA 3B57A 2JQKA 1HS7A 3I9WA 2ES0A 2NWBA 1HTJF 3RRWA 4H9PC 4HEAA 3RIFA 1MNDA 4UF0A 3FXEB 1U4QA 5FP3A 1XDOA 2FJEA 2KXPB 3E08A 1G73A 4DR1T 3CX8B 1KNZA 4BJNA 2WS3A 3IBPA 2AXDS 3AA6B 2BZBA 4L9IA
chains in the Genus database with same CATH topology
5FXVA 4Z8XA 1YD8G 4PAGA 4AQGA 4ERRA 4ANJA 4AKIA 2IC9A 3P7IA 3ZPOA 4GYRA 2WM9A 2PJQA 2LM9A 3AM1A 3LK2B 3AVRA 3VHLA 3ADCA 2VK9A 4OYKA 1FIOA 3LK3B 2CMRA 3OYXA 5LHHB 4CI3B 3I9YA 3NZPA 4CZZB 4KUMB 1U5PA 2KLQA 2NP9A 4FJOA 3KBUA 3Q9DA 4O4IE 4EZHA 4O4JE 4XZCA 3L3PA 3UT5E 1FEWA 3ZN0B 4GOUA 5LHIB 4GEHB 3IEEA 4UXNB 3KV5A 1MMNA 3KINB 4UF0B 1UX4A 4ZHQE 5LGTB 2C5JA 3AAAB 5FXXA 3HKDE 2SPCA 3ZMSB 3ZC1A 5HXRA 3NRXA 3ZEFB 3UUMA 2Q9QA 3ZYKA 4TZ4C 2PG8A 2A2FX 1D1CA 1WRDA 4EIWA 4QXHB 4YLHA 4P0AA 1UX5A 1D1AA 2V7JA 4ZOLE 2YU2A 4AQFC 3ZYLA 2X9HA 5FXZA 5BMVE 4H9QC 2CM0A 2NTYA 2CXFA 3AAEB 4EZ4A 2XUEA 4M1PA 3EDUA 2BVMA 3UFEA 1VRBA 2LSJA 1G8XA 3PUGA 4ZS2A 5EK2A 3AB3B 2P9BA 2Z6EA 3ETUA 4L5GA 5E0OA 5JDHA 5ETWA 2WMOA 5GONE 3ZMVB 4QX8B 5FMNA 2ODUA 2VKHA 2C5KT 2WMNA 4C91A 4ZI2C 2X51A 3C51A 5L2LA 2D5UA 4ILUA 4AI6A 4L0RA 4H9NC 5HXSA 5JREA 3CPZA 5JRCA 2XAJB 2ZLYA 2WAUA 4UEMA 3C4XA 3PE0A 5DJQC 1HX8A 5A1LA 4JEUB 3WAKA 3J9X1 4HFVA 3F57A 3LBXA 2PFVA 4PJMA 3ZC0A 2LSYA 5ADXL 3L09A 3HL6A 3NRYA 4PW8A 3W8HB 3K8PC 3C64A 4TN7B 3BK9A 4IE5A 2C5IT 4TUYE 2H7VC 3ANWB 2A72A 4WW0A 2XAGB 1S35A 4HN9A 2LHRA 3MA9A 2VKJA 4IHJE 4JUYA 4V1Av 3WI3A 2YEVC 3CWZB 4C90A 3RYHE 1D0XA 1H7CA 2K5BB 3PUSA 3I0QA 1IJ6A 2ZM2A 3MACA 2E9XD 2DWGA 1BR4A 3JC6C 3CMLA 4I43B 5H6QB 3ANWA 1MIWA 2DHRA 2W00A 1FMVA 4IE6A 4KBMB 4PK4A 5LOVE 5IYZE 3KV6A 3Q2MA 2JPFA 1Y64B 3IRBA 4DMVA 5JDGA 5DABA 2I59A 4FI5A 2CWOA 5H6RB 1HG2A 3A4LA 2D0UA 2X66A 4X1KE 3ZCJA 2IW5B 3L8JA 2LHNA 5FNVE 1YKEB 2UXXB 2KT9A 2X68A 2X9YA 3CX7B 2E8IA 2ZMAA 3N2OA 4X1IE 5KX5E 5JRCB 4TV9E 1B7TA 3CX6B 3GMIA 3K3OA 3MZKB 1V9DA 1WR6A 2E9XC 3AAIA 2V7LA 4QXBB 4GIWA 3QC9A 3RC8A 4UV9B 5JR9A 2CXDA 4AKHA 4IE7A 5LBMA 2V7MA 2CWYA 1SA0E 1SHZC 3FB2A 3A4NA 3FBZA 4ISSA 4L9IA 5J1GA 5L3DB 5LJNA 4KP3C 4QKNA 5C8YE 5L3CB 2VKDA 3K3QC 3KVBA 4XAXB 4EYYR 2LSGA 3AA0B 3N9PA 3J7Yq 2K24A 2JRKA 2Q9QD 4JLEA 2C0SA 1E1HB 4CXYA 1ZV4X 4QHOA 3RRCA 3KFWX 4H9RC 2Y6XA 4O4LE 2LT3A 5FY0A 3N5LA 4BJMA 4NNQA 4H9OC 1OWAA 2CLYC 3DJBA 3I0OA 2KWIB 2X0LB 2GK9A 1RJMA 2LOSA 4I55E 4K0UA 4OK0A 2RA1A 4PNIA 4PFPA 4PFOA 1US7B 2CE7A 5CA0E 2EHOC 5JDQA 1VOMA 4QX7B 3PU3A 1BR1A 2L9QA 1MIVA 1OXZA 3BQLA 3NZQA 1HFAA 5KDMC 3MJXA 4DMWA 2DWKA 4EAHA 2E9XA 2RP4A 1YW0A 4ZI3C 4BAYB 3DP7A 1NAFA 2PBIA 5CA1E 2YU1A 1T98A 2ACXA 2V26A 3Q5XA 5JR9C 3PUQA 4B6XA 1HCIA 4J2CA 3BQKA 4CI2B 3OKQA 1EZ3A 4N78D 3ADDA 2Q9QB 2V7KA 3ONXA 5JDNA 2ZM0A 5FY1A 2MBGA 3ZLIA 3AJMA 3NBXX 2QA7A 4I4TE 1D1BA 2YINA 3ZCIA 3CVRA 4AXPA 2Q9QC 2W61A 4OYJA 5J2TE 2JJ9A 2M67A 3LG7A 2J1DG 4X20E 2XTLA 3O1JA 3W15B 2W0GA 3GN5A 2HPJA 2LSIA 3PURA 4U74A 4HKAA 3U3IA 3PU8A 4UIGA 2D0TA 2H3RA 1LRZA 2DNXA 5CB4E 4PJNA 2X67A 5HAXA 1IJ5A 3GA8A 3ZMTB 3N9OA 5LJMA 3KVAA 4O2BE 3CQXC 3T8OA 3ZJ1A 2DLRA 3MK7C 5JDLA 3WAJA 3D0TA 2QGSA 3O1HA 2EHOB 4GYSA 1UCUA 3UUNA 3ETVA 3GN5B 4UVCB 3N9LA 4X1YE 3RQGA 5FY7A 3RYCE 5HYAA 4HE8A 1MMGA 4AKLA 3ZJ2A 1LKXA 3AA1B 3BQIA 5FXWA 3RX6A 2YK0A 2LEHA 5KMGP 3C50A 3UUXB 5LP6E 4MALA 2WBLA 4NUVA 4YHJA 4GK5E 4ZS3A 3ZMUB 5HWXA 3ZYMA 4YJ3E 1BR2A 3F2EA 1HG5A 4CI1B 1ZEEA 2KZ7B 3PUAA 1S94A 2G0UA 2N2NA 3MKDA 3PDYA 4EB6E 2W62A 4I50E 1IZNB 3HKEE 1LVKA 4OFZA 3KV4A 3R84B 2LOPA 4UV8B 4F6RC 4ZI3D 4O8SA 3QK6A 3JC6D 3OYZA 4G63A 2N1GA 2Y48B 1NWMX 1MMAA 2JQQA 3M65A 5HXHA 3O4XE 3EUHA 3E0ZA 2VKOA 3VU7H 4H63V 4H63H 2WWUA 3CKDA 3QUJA 3RQFA 2E9XB 3OBVE 3I1AA 3R6NA 1CUNA 2JMHA 3IF8B 3F31A 4NUUA 3P8CD 5JDFA 4UVBB 4IE4A 4TX5A 3DTOA 2DCFA 4GK0E 2LE8A 5F8PA 3ZMZB 4DBRA 3ADBA 3N2KE 2KWHA 5FYMA 5DQVA 2Y8DA 4PK6A 1ZKEA 2K48A 3KDSE 4IIJE 4BA9A 3AVSA 2XAHB 4ZI7E 5LXTE 5LYJE 2EHOA 2VWAA 4UELA 2XASB 3A4MA 3N9NA 3FXDB 3LJCA 4DVDA 4MLKA 4H9SE 2K9AA 5LHGB 3ZN1B 3FBLA 5L3GB 5JVDE 4PJJA 4CXWA 1MMDA 2JMKA 2KMFA 2IC6A 1D0YA 5LGUB 1YKHB 1Z0PA 4YFSA 2CXLA 3LBXB 4YJ2E 3RPUA 1AJ3A 3HA4A 4IGUA 2BVLA 4IDZA 4WNKA 2D2SA 3HR0A 4QXCB 2NW7A 5JH7E 3N2GE 4TV8E 5LNKA 3N9QA 4OHFA 3C4WA 1MNEA 2P63A 2NOXA 2V7IA 3H3AA 3SS1A 3A5XA 2CCQA 3ESLA 1MIYA 2L3LA 1WLXA 3Q5WA 2KNDA 1BR0A 3N9MA 2CA5A 4DBQA 4MHCA 4A56A 2L8KA 5LA6E 4E7SA 3UTKA 4XBFB 3PTRB 2A3DA 3RYFE 2OA5A 1IAPA 3V5UA 5F3JA 4AKGA 5AFUL 3S4UA 3E22E 3O1IA 3L8IA 4DNDA 5LG4A 5HWYA 2HH7A 1WYBA 3KBTA 3C98B 3V5SA 4U72A 4ASKA 4E7ZA 1KK7A 4QWNB 3C4ZA 2N9DA 5EK4A 1D0ZA 4AQFA 2WSSV 4ISTA 5M4YA 2BDEA 2VASA 5J2UE 3RC3A 3SOLA 3K3NA 3VKGA 2VB6A 1QUUA 3VKHA 3W8IB 2MOZA 4G2AA 4UVAB 3RH3A 4O2AE 2IAKA 2XHEB 2XAFB 4ADZA 3RYIE 3KV9A 4CQIA 5LGNB 2V1DB 3CQCB 3SRZA 3LFMA 5HXEA 3O9XA 3RQEA 3U78A 3GWHA 3SWHA 5IHYA 3OJAA 4EOZB 5L3BB 1ZHCA 5EZYE 4WBNE 4MBQA 4DO0A 1X79A 5JR9B 2MTQA 5JQGE 4WBOA 5LCYA 2H7OA 5DQWA 2LSKA 4P0BA 1HF8A 3LK42 1FMWA 3HI2A 1LVFA 1WYCA 2X9WA 2HPLA 2XAQB 4KMCA 3MXZA 3HKBE 5EK3A 5LBQB 5L3FB 4ZI2D 2W63A 4JEHB 2LJLA 2CEAA 5HXCA 2NTXA 4HGAA 4CXXA 1O3XA 3B57A 1QSDA 3H37A 1HS7A 3I9WA 2ES0A 2NWBA 2B1EA 2UXNB 2VL8A 5TAOA 5L3EB 2NW9A 1HTJF 2X9XA 3FHNA 2NW8A 4PJLA 3RRWA 3RKOA 4H9PC 5JDMA 2CLYB 4EXTA 4HEAA 3B13A 1MNDA 3AA7B 2EHOD 3UULA 4UF0A 3FXEB 3EDVA 4O4HE 2MYSA 1U4QA 3IHRA 5FP3A 2KXPB 4AKRB 3E08A 1G73A 3HKCE 2DI4A 2ZM8A 4P09A 3EVYA 3CQGB 4HTEA 3CX8B 1KNZA 4BJNA 4PK5A 4MFRA 3IBPA 4IE0A 4EYUA 3AA6B 2ODVA 2BZBA 3TKLB 2XQYA 2KINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y64 B;  1V9D A;  1UX4 A;  2Z6E A;  2J1D G;  4EAH A;  1UX5 A;  3OBV E;  3O4X E; 
#chains in the Genus database with same CATH topology
 5FXV A;  1YD8 G;  5AQN B;  4ERR A;  4AKI A;  4HWH A;  3AVR A;  3VHL A;  4OYK A;  4DR7 T;  3OYX A;  4HFE A;  4CI3 B;  3NZP A;  2W66 A;  2KLQ A;  5AQT B;  4EZH A;  2VRE A;  1DU2 A;  4GEH B;  3KIN B;  1UX4 A;  2C5J A;  3HKD E;  3ZMS B;  2PG8 A;  4JI4 T;  1D1C A;  4YLH A;  1UX5 A;  1D1A A;  4ZOL E;  2YU2 A;  4H9Q C;  2HHH T;  2YDS A;  2CXF A;  3AAE B;  3TLF A;  4MOU A;  2XQ3 A;  3EDU A;  3PUG A;  5EK2 A;  3AB3 B;  2P9B A;  3RQW A;  4TNW A;  1WR0 A;  3ZMV B;  2VKH A;  4C91 A;  4NXN T;  3OTO T;  5CFB A;  2D5U A;  4AI6 A;  2WAU A;  1Z8U A;  5DJQ C;  4JEU B;  4A97 A;  3PUZ F;  3F57 A;  2PFV A;  1EF8 A;  4IE5 A;  2CPT A;  2CHO A;  4HN9 A;  1DUB A;  4IL9 A;  3MA9 A;  2VKJ A;  4JUY A;  1XNQ T;  4U3C A;  1H7C A;  1JNR A;  2K5B B;  3EHZ A;  3I0Q A;  4HFH A;  3JC6 C;  4QH1 A;  2BS3 A;  4KBM B;  4I42 A;  3Q2M A;  4ELX A;  4NIQ A;  4DR6 T;  4FI5 A;  4JI8 T;  3MYB A;  5H6R B;  2IW5 B;  5CJ5 A;  5FL0 A;  2UXX B;  4QII A;  3CX7 B;  4X1I E;  5KX5 E;  5FL1 A;  1VCS A;  1V9D A;  2E9X C;  3JCF A;  4QXB B;  4GIW A;  3FDU A;  2DUB A;  5JR9 A;  1SA0 E;  5LJN A;  3A4N A;  5L3D B;  4QKN A;  5C8Y E;  3K3Q C;  2WP9 A;  3KVB A;  3TLV A;  1T72 A;  2HN1 A;  1ZV4 X;  4JYA T;  2UXD T;  2WU5 A;  4NNQ A;  1XMQ T;  5L4H A;  2EHO C;  1VOM A;  4QX7 B;  2L9Q A;  3MJX A;  2DWK A;  2RP4 A;  3FZL B;  1YW0 A;  2PBI A;  1NEK A;  1T98 A;  2ACX A;  1HCI A;  4CI2 B;  4CN1 A;  4B3M T;  2Q9Q B;  4CN6 A;  4ILC A;  4JBW F;  4JI3 T;  4X62 T;  3AJM A;  2BG9 C;  1D1B A;  5AQJ B;  4AXP A;  1UUR A;  5HEH A;  2W61 A;  4OYJ A;  5J2T E;  1OED C;  2J1D G;  4X20 E;  3O1J A;  3VRB A;  2LSI A;  2JQ9 A;  2VX2 A;  4U74 A;  3PZK A;  1LRZ A;  2DNX A;  5CB4 E;  1UGO A;  2X67 A;  5HAX A;  2V6X A;  5LJM A;  3CQX C;  3T8O A;  4LFB T;  2LKH A;  3N9L A;  4U33 A;  5HYA A;  4HE8 A;  1MMG A;  2XPK A;  3UUX B;  5HEJ A;  3PUX F;  3F2E A;  1HG5 A;  4CI1 B;  3TLS A;  3PUA A;  1S94 A;  5HCM A;  2W62 A;  4F6R C;  4ZI3 D;  3QK6 A;  2HN2 A;  3JC6 D;  2N1G A;  1NWM X;  1MMA A;  2JQQ A;  3M65 A;  2QRX A;  2WWU A;  3CKD A;  3RQF A;  3OBV E;  4TWD A;  2VVN A;  1CUN A;  3IF8 B;  3AEC A;  4NUU A;  3P8C D;  4UVB B;  4IE4 A;  2LE8 A;  3ADB A;  4JCS A;  1XNR T;  4PK6 A;  1ZKE A;  2XM2 A;  5LYJ E;  3AE6 A;  2VWA A;  3LJC A;  4WZX A;  4H9S E;  5LHG B;  4IRE A;  5JVD E;  4LF4 T;  4K2N A;  5LGU B;  4CN4 A;  4IGU A;  4IDZ A;  2NW7 A;  3N2G E;  4TV8 E;  4LF6 T;  3N9Q A;  4DV6 T;  1MNE A;  3H3A A;  3SS1 A;  2CCQ A;  2KND A;  2WQY A;  2PPY A;  4MHC A;  4A56 A;  3RIA A;  5LG4 A;  3KBT A;  4K0K T;  1KK7 A;  5C3J A;  5M4Y A;  2VAS A;  5J2U E;  3SOL A;  3AXJ A;  2IUB A;  2VB6 A;  1OED B;  2MOZ A;  3RH3 A;  2IAK A;  2XHE B;  4ADZ A;  4IZB A;  3Q1T A;  2V1D B;  1IBK T;  3ZST A;  3U78 A;  3GWH A;  4EOZ B;  1ZHC A;  5EZY E;  4WBN E;  4MBQ A;  1X79 A;  4NPP A;  2H7O A;  3HI2 A;  3Q0G A;  2X9W A;  3HKB E;  5EK3 A;  3VR8 A;  4ZI2 D;  5JBX A;  5HXC A;  4HGA A;  5L4E A;  1O3X A;  2JQH A;  3P4W A;  2UXN B;  2WZI A;  4QH4 A;  5L3E B;  2NW9 A;  2X9X A;  4PJL A;  4I52 A;  3RKO A;  5JDM A;  2CLY B;  4EXT A;  4IDN A;  3UUL A;  3AA7 B;  1OED E;  4LF8 T;  4X66 T;  2MYS A;  3TRR A;  2DI4 A;  2ZM8 A;  4P09 A;  5AQI B;  4PK5 A;  4IE0 A;  4EYU A;  3TKL B;  2XQY A;  5AQV B;  2KIN B;  4F47 A;  4Z8X A;  4AQG A;  3B5M A;  3Q5E A;  4Z91 A;  2PJQ A;  3LK2 B;  2VK9 A;  2R6G F;  2CMR A;  3I9Y A;  2H88 A;  1U5P A;  3Q0J A;  2FJA A;  4TWF A;  5CGM A;  4O4I E;  3L3P A;  3RKG A;  3H3M A;  3IEE A;  4KNP A;  1MMN A;  2BS2 A;  2SPC A;  1T7S A;  2Q9Q A;  3ZT6 A;  4TZ4 C;  4IDQ A;  3SFE A;  1WRD A;  3R9T A;  3TLU A;  2NTY A;  3UFE A;  2XQA A;  2LSJ A;  4ZS2 A;  4DR3 T;  3ETU A;  4L5G A;  5E0O A;  5AQO B;  5ETW A;  2WMO A;  5GON E;  2XQ8 A;  5FMN A;  5J0Z A;  1W0B A;  4L0R A;  5HXS A;  2J4G A;  3CPZ A;  4AIU A;  5JRC A;  4UEM A;  3LDQ B;  3EAM A;  3PE0 A;  1HX8 A;  4EML A;  4HFB A;  3J9X 1;  4HFV A;  4JV5 T;  2XQ4 A;  3ZC0 A;  4GKJ T;  4MI2 A;  3HL6 A;  4PW8 A;  4JI6 T;  3W8H B;  3C64 A;  2H7V C;  3ANW B;  4IZC A;  2LHR A;  5LB7 B;  4YTN A;  4IHJ E;  3WI3 A;  2YEV C;  4C90 A;  3SFD A;  3RYH E;  1D0X A;  4QIJ A;  3PUS A;  1EF9 A;  2BBJ A;  4B3S T;  4I43 B;  1WFD A;  2W00 A;  4IE6 A;  4PK4 A;  5IYZ E;  1T8B A;  4HWD A;  3LSV A;  4FZW C;  2JPF A;  4TNV A;  1Y64 B;  3IRB A;  2I59 A;  4DR4 T;  2CWO A;  4X1K E;  1SE7 A;  3ZCJ A;  3L8J A;  1XDP A;  2MPK A;  3UQ7 A;  3ZT5 A;  3AE9 A;  5JRC B;  2BKO A;  1B7T A;  3GMI A;  2I0M A;  1KNR A;  1WR6 A;  3AAI A;  4OG1 A;  2FW2 A;  2V7L A;  1SUM B;  2DL1 A;  4JYL A;  4AKH A;  2V7M A;  2CWY A;  5J1G A;  3FB2 A;  3FBZ A;  3P4R A;  5L3C B;  1HX1 B;  2VKD A;  2CBJ A;  3AA0 B;  4OLQ A;  4ZU2 A;  2VL0 A;  1NZY B;  2W2U A;  3J7Y q;  2K24 A;  2JRK A;  2Q9Q D;  2D9D A;  3RRC A;  3KFW X;  2H89 A;  5C9G A;  3EAB A;  2IDO B;  5JBW A;  2KWI B;  2GK9 A;  5FKY A;  4OK0 A;  4PFP A;  2CE7 A;  3PU3 A;  1BR1 A;  3ZSS A;  1MIV A;  3ABV A;  5KDM C;  3HRX A;  2V5C A;  4BAY B;  3AEA A;  3L39 A;  2WDQ A;  3PUQ A;  5AQR B;  5JR9 C;  3QK8 A;  2V6Y B;  3UU6 A;  3UFG A;  4N78 D;  4IT4 A;  3ADD A;  5AQF B;  4IZD A;  1M7K A;  5FY1 A;  4DR2 T;  5AQU B;  4EGW A;  3ZLI A;  3NBX X;  3CVR A;  2JJ9 A;  3LG7 A;  2F6Q A;  3U3I A;  3G06 A;  4HKA A;  2UZF A;  2BG9 A;  4PJN A;  2WDR A;  3L8R A;  3P50 A;  3H81 A;  2DLR A;  1X9B A;  2YKS A;  3D0T A;  2RPA A;  1UCU A;  5FY7 A;  3RYC E;  4AKL A;  3AA1 B;  3BQI A;  3CIR A;  1N36 T;  1NZY A;  5LP6 E;  4MAL A;  3ZMU B;  3ZYM A;  4U2Z A;  1DCI A;  1BR2 A;  3AEE A;  2KZ7 B;  1J1J A;  3T88 A;  3PDY A;  3MKD A;  4KX6 A;  4EB6 E;  3KV4 A;  2VQF T;  4O8S A;  2ZQR A;  3O4X E;  5F5W A;  2PTF A;  3EUH A;  4H63 H;  3P4S A;  3QUJ A;  2XSB A;  2JMH A;  1QLB A;  5JDF A;  5AQQ B;  4DBR A;  3ZMZ B;  3N2K E;  2KWH A;  4U19 A;  3NVO A;  3ZT7 A;  4A98 A;  2XAH B;  3A4M A;  3N9N A;  4DVD A;  4DV2 T;  2K9A A;  4DUZ T;  5L3G B;  4GKK T;  4ZZB A;  1D0Y A;  4U31 A;  3OC7 A;  5LMU T;  3RI5 A;  3K1S A;  4YJ2 E;  3RPU A;  3FZK B;  3AEF A;  5FVL A;  2NOX A;  1MIY A;  2CA5 A;  4DBQ A;  4DID B;  2WB5 A;  3RYF E;  1IAP A;  4AKG A;  5AFU L;  3O1I A;  3L8I A;  5HWY A;  1WYB A;  1WZ8 A;  3V5S A;  4ASK A;  1FJG T;  2UU9 T;  3VKG A;  3W8I B;  3AED A;  4QH5 A;  5LGN B;  3LFM A;  5HXE A;  3O9X A;  3RQE A;  4ILB A;  3OJA A;  2WWV A;  4WBO A;  4LF7 T;  3RSI A;  4P0B A;  1WYC A;  2HPL A;  3MXZ A;  5LBQ B;  2W63 A;  4JEH B;  3RF1 A;  1HNX T;  2VL8 A;  2B1E A;  2I6H A;  3FHN A;  2CHN A;  3B13 A;  4HWI B;  2EHO D;  3EDV A;  4O4H E;  4AKR B;  3HKC E;  4HTE A;  4OX9 T;  2FBM A;  4YHH T;  5AQS B;  2UUA T;  3UU3 A;  3PUY F;  3UU5 A;  4PAG A;  4KHZ F;  4ANJ A;  2VUR A;  5C2T A;  3ZPO A;  1R8I A;  2B76 A;  2WZH A;  4GYR A;  1YQ4 A;  3AM1 A;  3PUW F;  3ADC A;  1FIO A;  3LK3 B;  2W4X A;  5LHH B;  4CZZ B;  4KUM B;  2UXB T;  2NP9 A;  4FJO A;  4EEB A;  4ZXL A;  4COF A;  1JXZ A;  1FEW A;  2E5L T;  4GOU A;  5LHI B;  4UXN B;  2LRK A;  4ZHQ E;  3G64 A;  2YN6 A;  4ILA A;  5HXR A;  3NRX A;  3ZEF B;  4AQY T;  3ZYK A;  1N33 T;  3AE1 A;  2A2F X;  4P0A A;  2V7J A;  2X9H A;  5FXZ A;  5BMV E;  2CM0 A;  3IA3 A;  4M1P A;  1VRB A;  1G8X A;  1M62 A;  3AEB A;  5JDH A;  4U2Y A;  3SWX A;  3AE5 A;  3QOF A;  4QX8 B;  3AE2 A;  2ODU A;  2C5K T;  3RIU A;  3C51 A;  4P1N A;  4ILU A;  1I94 T;  4H9N C;  2OLT A;  5JRE A;  3C4X A;  5KXJ A;  4PJM A;  2LSY A;  5ADX L;  3L09 A;  1KNP A;  4JI7 T;  2XAG B;  5ABF A;  1J5W A;  3T1Y T;  4DV0 T;  2XJ7 A;  3CWZ B;  2NR4 A;  2FJB A;  3MAC A;  2E9X D;  4FZW A;  1J5E T;  2DWG A;  2QQ3 A;  3CML A;  2DHR A;  2XZE A;  1FMV A;  1UK5 A;  3VR9 A;  5JTG A;  4DMV A;  5JDG A;  2X66 A;  3QB5 A;  2LHN A;  5FNV E;  2M6I A;  2X9Y A;  2KT9 A;  5IWA T;  2E8I A;  2ZMA A;  3N2O A;  3K3O A;  1IBL T;  3NWI A;  2LM2 A;  2IIU A;  4IE7 A;  5AQH B;  1SHZ C;  2X0H A;  5LMN T;  2XQ6 A;  1CHU A;  3N9P A;  1IBM T;  2X0Y A;  2C0S A;  2Y6X A;  2LT3 A;  5FY0 A;  4H9O C;  1OWA A;  2CLY C;  2X0L B;  3JAF A;  3P4P A;  1RJM A;  4I55 E;  2RA1 A;  4PFO A;  4DUY T;  1US7 B;  4DV1 T;  3BQL A;  3NZQ A;  1HFA A;  1XMO T;  2E5V A;  4DMW A;  2E9X A;  3DP7 A;  4DR5 T;  1NAF A;  1OED A;  5CA1 E;  5ABH A;  3EI0 A;  2V26 A;  4JI0 T;  4B6X A;  3BQK A;  2PBP A;  3OKQ A;  4U7Y A;  2BG9 B;  2MBG A;  1Q51 A;  4YSZ A;  2V8S V;  4HWF A;  4WCZ A;  2QA7 A;  4I4T E;  2YIN A;  3ZCI A;  3P5M A;  3PV0 F;  2HPJ A;  5IUX A;  3PU8 A;  3OPC A;  3M3Z B;  2H3R A;  2IEX A;  2EJ5 A;  3KVA A;  4O2B E;  3ZJ1 A;  5JDL A;  2QGS A;  5FVK A;  2EHO B;  3GN5 B;  4UVC B;  3PJA A;  2IHR 1;  3ZJ2 A;  1LKX A;  1W0A A;  2YK0 A;  5KMG P;  2WBL A;  4YJ3 E;  2OV9 A;  4ZZC A;  3A7M A;  2IML A;  1HNW T;  2G0U A;  2N2N A;  4I50 E;  1IZN B;  1LVK A;  4OFZ A;  4ELS A;  3R84 B;  2LOP A;  4U7I A;  4EV6 A;  3OYZ A;  4G63 A;  2Y48 B;  3UQ4 A;  5HXH A;  4I0U A;  2V5D A;  5HCJ A;  3A8Y C;  2E9X B;  3I1A A;  3R6N A;  3TLT A;  3F31 A;  4TX5 A;  3DTO A;  2DCF A;  4GK0 E;  5F8P A;  3TLW A;  2WDV A;  3UU4 A;  5FYM A;  5KJP A;  4NEK A;  2Y8D A;  3AVS A;  3QXI A;  4ZI7 E;  2EHO A;  4UEL A;  3QB5 K;  5HEU A;  1JNZ A;  3ZN1 B;  5BR8 T;  1VCT A;  4PJJ A;  4CXW A;  3R0O A;  3I47 A;  2KMF A;  2IC6 A;  4HFI A;  1Z0P A;  4YFS A;  2CXL A;  3LBX B;  1AJ3 A;  4WNK A;  2D2S A;  4QXC B;  4Q25 A;  2MAW A;  4KHP T;  4OHF A;  1NEN A;  2P63 A;  1Y01 A;  2V7I A;  3A5X A;  3ESL A;  2L3L A;  1WLX A;  2AE9 A;  4HFD A;  5ABE A;  5LA6 E;  3UTK A;  3PTR B;  2A3D A;  2GTR A;  1GQE A;  2OA5 A;  3AXJ B;  5F3J A;  3S4U A;  3E22 E;  4DND A;  3RHW A;  2HH7 A;  4F8H A;  3C98 B;  2ACZ A;  1KFY A;  5EK4 A;  2QYW A;  3ZKR A;  5AQG B;  2WSS V;  4ZEY A;  2XQ9 A;  3K3N A;  1QUU A;  3VKH A;  4JFC A;  2XAF B;  1ZP0 A;  4CQI A;  3CQC B;  2W67 A;  3SRZ A;  3SWH A;  5L3B B;  5ABG A;  4YTP A;  4DO0 A;  5JQG E;  5LCY A;  5DQW A;  2LSK A;  2XAQ B;  4KMC A;  1HNZ T;  2UXC T;  2LJL A;  4HWC A;  4CXX A;  1QSD A;  3H37 A;  3PJA J;  5TAO A;  2KSR A;  2NW8 A;  2XSA A;  3RIU C;  3T89 A;  3IHR A;  1N34 T;  3H02 A;  1UIY A;  3EVY A;  3CQG B;  2YOE A;  4LMJ A;  2FBW A;  4MFR A;  2ODV A;  3NRY A;  5L47 A;  2IC9 A;  3P7I A;  2WM9 A;  2LM9 A;  3RQU A;  1I6Z A;  2F4V T;  1UUS A;  3VRA A;  3KBU A;  3Q9D A;  4TWH A;  4B3R T;  4O4J E;  4XZC A;  3UT5 E;  3ZN0 B;  1L0V A;  1YXR A;  3KV5 A;  4UF0 B;  5LG3 A;  5LGT B;  3AAA B;  5FXX A;  3ZC1 A;  3UUM A;  4YY3 T;  2QVA A;  4EIW A;  4QXH B;  4AQF C;  3ZYL A;  5ABF B;  3P4Q A;  4EZ4 A;  2XQ7 A;  2XUE A;  2BVM A;  3RGL A;  2Z6E A;  2UUB T;  2YDQ A;  3JAE A;  3ONL C;  4Z90 A;  5L2L A;  4ZI2 C;  2WMN A;  2X51 A;  3UU8 A;  2XAJ B;  2ZLY A;  5A1L A;  3WAK A;  1KF6 A;  3LBX A;  2XY8 B;  4KI0 F;  2E2A A;  2ZM6 T;  3K8P C;  4TN7 B;  3BK9 A;  3ONJ A;  2C5I T;  4TUY E;  4X5T A;  2A72 A;  4WW0 A;  4DV3 T;  4AIS A;  1S35 A;  4JOT A;  4V1A v;  2BKN A;  3X1D A;  1IJ6 A;  3Q5D A;  2ZM2 A;  2JIW A;  1BR4 A;  5H6Q B;  4B3T T;  3ANW A;  1MIW A;  5LOV E;  1W9R A;  5AQL B;  1HR0 T;  4HFC A;  3KV6 A;  3JAD A;  5DAB A;  4DV5 T;  1HG2 A;  3A4L A;  2D0U A;  2J47 A;  1YKE B;  2X68 A;  3AE3 A;  4TV9 E;  3CX6 B;  3MZK B;  3FZM B;  4A5X A;  3QC9 A;  3RC8 A;  5HEG A;  4UV9 B;  2CXD A;  5LBM A;  3NKZ A;  4ISS A;  3HIN A;  3CK6 A;  4KP3 C;  4U1A A;  4XAX B;  4EYY R;  2LSG A;  4WYV A;  3AE7 A;  4JLE A;  1E1H B;  3SLL A;  4CXY A;  1XZY A;  1W09 A;  4QHO A;  2J62 A;  4H9R C;  2CRB A;  4O4L E;  3N5L A;  4BJM A;  2VQE T;  3DJB A;  3I0O A;  4YSY A;  2K3W A;  2LOS A;  4K0U A;  4IDP A;  4PNI A;  2M6B A;  3FZF B;  5CA0 E;  5JDQ A;  2BBH A;  4LFA T;  1E2A A;  4NXM T;  1OXZ A;  4JI5 T;  3OVU A;  4EAH A;  1WCR A;  4U18 A;  4ZI3 C;  4K3W A;  4UR9 A;  2YU1 A;  1Q52 A;  3Q5X A;  4J2C A;  3AE8 A;  1EZ3 A;  2WCA A;  2V7K A;  3ONX A;  5JDN A;  2ZM0 A;  2Q9Q C;  4YXD A;  1KEY A;  2BG9 E;  2M67 A;  2XTL A;  3W15 B;  2W0G A;  3GN5 A;  3PUR A;  4DV4 T;  2BS4 A;  4UIG A;  2D0T A;  2UUC T;  2A9U A;  3QXZ A;  1IJ5 A;  3GA8 A;  3ZMT B;  3N9O A;  4LML A;  3MK7 C;  3WAJ A;  3O1H A;  4GYS A;  4IL4 A;  3UUB A;  3UUN A;  4I4Z A;  3ETV A;  4X1Y E;  1RJN A;  3RQG A;  4LFC T;  5FXW A;  3RX6 A;  2CBI A;  4DV7 T;  2LEH A;  3C50 A;  4YHJ A;  4NUV A;  4ZS3 A;  4GK5 E;  5HWX A;  1ZEE A;  2YDR A;  4YSX A;  3HKE E;  4UV8 B;  3MOY A;  1N32 T;  2XQ5 A;  4JI2 T;  4LF5 T;  1YQ3 A;  3E0Z A;  2VKO A;  3VU7 H;  3QNU A;  4H63 V;  1XWM A;  5HEO A;  3PUV F;  5DQV A;  2K48 A;  3KDS E;  4IIJ E;  4BA9 A;  5LXT E;  2XAS B;  3FZH B;  2FJD A;  4X64 T;  3FXD B;  4MLK A;  2XM1 A;  3KQF A;  3FBL A;  4IDO A;  1MMD A;  2JMK A;  4LMK A;  5AQK B;  1YKH B;  5AQM B;  3HA4 A;  2BVL A;  3HR0 A;  1MJ3 A;  5JH7 E;  5LNK A;  3C4W A;  1BR0 A;  3Q5W A;  3R9S A;  3N9M A;  4ELW A;  2L8K A;  4E7S A;  4XBF B;  4JI1 T;  3V5U A;  2WU2 A;  4YTM A;  4JWV A;  2BKP A;  4U72 A;  2LLY A;  3RLF F;  4E7Z A;  4QWN B;  3C4Z A;  2N9D A;  1D0Z A;  4AQF A;  2V6Y A;  4IST A;  3AE4 A;  2BDE A;  2ZQQ A;  3RC3 A;  2FUP A;  2HW5 A;  4G2A A;  4UVA B;  4O2A E;  1E7P A;  4FJW D;  3RYI E;  3KV9 A;  4X65 T;  1HZD A;  2LKG A;  1ZOY A;  5IHY A;  1EY3 A;  5JR9 B;  2MTQ A;  3T1H T;  4YT0 A;  3AEG A;  2VVS A;  1HF8 A;  3LK4 2;  1FMW A;  5AQP B;  1LVF A;  4EED A;  5L3F B;  2WY2 A;  3T8A A;  4LF9 T;  2CEA A;  2LRL A;  2NTX A;  3B57 A;  2JQK A;  1HS7 A;  3I9W A;  2ES0 A;  2NWB A;  1HTJ F;  3RRW A;  4H9P C;  4HEA A;  3RIF A;  1MND A;  4UF0 A;  3FXE B;  1U4Q A;  5FP3 A;  1XDO A;  2FJE A;  2KXP B;  3E08 A;  1G73 A;  4DR1 T;  3CX8 B;  1KNZ A;  4BJN A;  2WS3 A;  3IBP A;  2AXD S;  3AA6 B;  2BZB A;  4L9I A; 
#chains in the Genus database with same CATH homology
 5FXV A;  4Z8X A;  1YD8 G;  4PAG A;  4AQG A;  4ERR A;  4ANJ A;  4AKI A;  2IC9 A;  3P7I A;  3ZPO A;  4GYR A;  2WM9 A;  2PJQ A;  2LM9 A;  3AM1 A;  3LK2 B;  3AVR A;  3VHL A;  3ADC A;  2VK9 A;  4OYK A;  1FIO A;  3LK3 B;  2CMR A;  3OYX A;  5LHH B;  4CI3 B;  3I9Y A;  3NZP A;  4CZZ B;  4KUM B;  1U5P A;  2KLQ A;  2NP9 A;  4FJO A;  3KBU A;  3Q9D A;  4O4I E;  4EZH A;  4O4J E;  4XZC A;  3L3P A;  3UT5 E;  1FEW A;  3ZN0 B;  4GOU A;  5LHI B;  4GEH B;  3IEE A;  4UXN B;  3KV5 A;  1MMN A;  3KIN B;  4UF0 B;  1UX4 A;  4ZHQ E;  5LGT B;  2C5J A;  3AAA B;  5FXX A;  3HKD E;  2SPC A;  3ZMS B;  3ZC1 A;  5HXR A;  3NRX A;  3ZEF B;  3UUM A;  2Q9Q A;  3ZYK A;  4TZ4 C;  2PG8 A;  2A2F X;  1D1C A;  1WRD A;  4EIW A;  4QXH B;  4YLH A;  4P0A A;  1UX5 A;  1D1A A;  2V7J A;  4ZOL E;  2YU2 A;  4AQF C;  3ZYL A;  2X9H A;  5FXZ A;  5BMV E;  4H9Q C;  2CM0 A;  2NTY A;  2CXF A;  3AAE B;  4EZ4 A;  2XUE A;  4M1P A;  3EDU A;  2BVM A;  3UFE A;  1VRB A;  2LSJ A;  1G8X A;  3PUG A;  4ZS2 A;  5EK2 A;  3AB3 B;  2P9B A;  2Z6E A;  3ETU A;  4L5G A;  5E0O A;  5JDH A;  5ETW A;  2WMO A;  5GON E;  3ZMV B;  4QX8 B;  5FMN A;  2ODU A;  2VKH A;  2C5K T;  2WMN A;  4C91 A;  4ZI2 C;  2X51 A;  3C51 A;  5L2L A;  2D5U A;  4ILU A;  4AI6 A;  4L0R A;  4H9N C;  5HXS A;  5JRE A;  3CPZ A;  5JRC A;  2XAJ B;  2ZLY A;  2WAU A;  4UEM A;  3C4X A;  3PE0 A;  5DJQ C;  1HX8 A;  5A1L A;  4JEU B;  3WAK A;  3J9X 1;  4HFV A;  3F57 A;  3LBX A;  2PFV A;  4PJM A;  3ZC0 A;  2LSY A;  5ADX L;  3L09 A;  3HL6 A;  3NRY A;  4PW8 A;  3W8H B;  3K8P C;  3C64 A;  4TN7 B;  3BK9 A;  4IE5 A;  2C5I T;  4TUY E;  2H7V C;  3ANW B;  2A72 A;  4WW0 A;  2XAG B;  1S35 A;  4HN9 A;  2LHR A;  3MA9 A;  2VKJ A;  4IHJ E;  4JUY A;  4V1A v;  3WI3 A;  2YEV C;  3CWZ B;  4C90 A;  3RYH E;  1D0X A;  1H7C A;  2K5B B;  3PUS A;  3I0Q A;  1IJ6 A;  2ZM2 A;  3MAC A;  2E9X D;  2DWG A;  1BR4 A;  3JC6 C;  3CML A;  4I43 B;  5H6Q B;  3ANW A;  1MIW A;  2DHR A;  2W00 A;  1FMV A;  4IE6 A;  4KBM B;  4PK4 A;  5LOV E;  5IYZ E;  3KV6 A;  3Q2M A;  2JPF A;  1Y64 B;  3IRB A;  4DMV A;  5JDG A;  5DAB A;  2I59 A;  4FI5 A;  2CWO A;  5H6R B;  1HG2 A;  3A4L A;  2D0U A;  2X66 A;  4X1K E;  3ZCJ A;  2IW5 B;  3L8J A;  2LHN A;  5FNV E;  1YKE B;  2UXX B;  2KT9 A;  2X68 A;  2X9Y A;  3CX7 B;  2E8I A;  2ZMA A;  3N2O A;  4X1I E;  5KX5 E;  5JRC B;  4TV9 E;  1B7T A;  3CX6 B;  3GMI A;  3K3O A;  3MZK B;  1V9D A;  1WR6 A;  2E9X C;  3AAI A;  2V7L A;  4QXB B;  4GIW A;  3QC9 A;  3RC8 A;  4UV9 B;  5JR9 A;  2CXD A;  4AKH A;  4IE7 A;  5LBM A;  2V7M A;  2CWY A;  1SA0 E;  1SHZ C;  3FB2 A;  3A4N A;  3FBZ A;  4ISS A;  4L9I A;  5J1G A;  5L3D B;  5LJN A;  4KP3 C;  4QKN A;  5C8Y E;  5L3C B;  2VKD A;  3K3Q C;  3KVB A;  4XAX B;  4EYY R;  2LSG A;  3AA0 B;  3N9P A;  3J7Y q;  2K24 A;  2JRK A;  2Q9Q D;  4JLE A;  2C0S A;  1E1H B;  4CXY A;  1ZV4 X;  4QHO A;  3RRC A;  3KFW X;  4H9R C;  2Y6X A;  4O4L E;  2LT3 A;  5FY0 A;  3N5L A;  4BJM A;  4NNQ A;  4H9O C;  1OWA A;  2CLY C;  3DJB A;  3I0O A;  2KWI B;  2X0L B;  2GK9 A;  1RJM A;  2LOS A;  4I55 E;  4K0U A;  4OK0 A;  2RA1 A;  4PNI A;  4PFP A;  4PFO A;  1US7 B;  2CE7 A;  5CA0 E;  2EHO C;  5JDQ A;  1VOM A;  4QX7 B;  3PU3 A;  1BR1 A;  2L9Q A;  1MIV A;  1OXZ A;  3BQL A;  3NZQ A;  1HFA A;  5KDM C;  3MJX A;  4DMW A;  2DWK A;  4EAH A;  2E9X A;  2RP4 A;  1YW0 A;  4ZI3 C;  4BAY B;  3DP7 A;  1NAF A;  2PBI A;  5CA1 E;  2YU1 A;  1T98 A;  2ACX A;  2V26 A;  3Q5X A;  5JR9 C;  3PUQ A;  4B6X A;  1HCI A;  4J2C A;  3BQK A;  4CI2 B;  3OKQ A;  1EZ3 A;  4N78 D;  3ADD A;  2Q9Q B;  2V7K A;  3ONX A;  5JDN A;  2ZM0 A;  5FY1 A;  2MBG A;  3ZLI A;  3AJM A;  3NBX X;  2QA7 A;  4I4T E;  1D1B A;  2YIN A;  3ZCI A;  3CVR A;  4AXP A;  2Q9Q C;  2W61 A;  4OYJ A;  5J2T E;  2JJ9 A;  2M67 A;  3LG7 A;  2J1D G;  4X20 E;  2XTL A;  3O1J A;  3W15 B;  2W0G A;  3GN5 A;  2HPJ A;  2LSI A;  3PUR A;  4U74 A;  4HKA A;  3U3I A;  3PU8 A;  4UIG A;  2D0T A;  2H3R A;  1LRZ A;  2DNX A;  5CB4 E;  4PJN A;  2X67 A;  5HAX A;  1IJ5 A;  3GA8 A;  3ZMT B;  3N9O A;  5LJM A;  3KVA A;  4O2B E;  3CQX C;  3T8O A;  3ZJ1 A;  2DLR A;  3MK7 C;  5JDL A;  3WAJ A;  3D0T A;  2QGS A;  3O1H A;  2EHO B;  4GYS A;  1UCU A;  3UUN A;  3ETV A;  3GN5 B;  4UVC B;  3N9L A;  4X1Y E;  3RQG A;  5FY7 A;  3RYC E;  5HYA A;  4HE8 A;  1MMG A;  4AKL A;  3ZJ2 A;  1LKX A;  3AA1 B;  3BQI A;  5FXW A;  3RX6 A;  2YK0 A;  2LEH A;  5KMG P;  3C50 A;  3UUX B;  5LP6 E;  4MAL A;  2WBL A;  4NUV A;  4YHJ A;  4GK5 E;  4ZS3 A;  3ZMU B;  5HWX A;  3ZYM A;  4YJ3 E;  1BR2 A;  3F2E A;  1HG5 A;  4CI1 B;  1ZEE A;  2KZ7 B;  3PUA A;  1S94 A;  2G0U A;  2N2N A;  3MKD A;  3PDY A;  4EB6 E;  2W62 A;  4I50 E;  1IZN B;  3HKE E;  1LVK A;  4OFZ A;  3KV4 A;  3R84 B;  2LOP A;  4UV8 B;  4F6R C;  4ZI3 D;  4O8S A;  3QK6 A;  3JC6 D;  3OYZ A;  4G63 A;  2N1G A;  2Y48 B;  1NWM X;  1MMA A;  2JQQ A;  3M65 A;  5HXH A;  3O4X E;  3EUH A;  3E0Z A;  2VKO A;  3VU7 H;  4H63 V;  4H63 H;  2WWU A;  3CKD A;  3QUJ A;  3RQF A;  2E9X B;  3OBV E;  3I1A A;  3R6N A;  1CUN A;  2JMH A;  3IF8 B;  3F31 A;  4NUU A;  3P8C D;  5JDF A;  4UVB B;  4IE4 A;  4TX5 A;  3DTO A;  2DCF A;  4GK0 E;  2LE8 A;  5F8P A;  3ZMZ B;  4DBR A;  3ADB A;  3N2K E;  2KWH A;  5FYM A;  5DQV A;  2Y8D A;  4PK6 A;  1ZKE A;  2K48 A;  3KDS E;  4IIJ E;  4BA9 A;  3AVS A;  2XAH B;  4ZI7 E;  5LXT E;  5LYJ E;  2EHO A;  2VWA A;  4UEL A;  2XAS B;  3A4M A;  3N9N A;  3FXD B;  3LJC A;  4DVD A;  4MLK A;  4H9S E;  2K9A A;  5LHG B;  3ZN1 B;  3FBL A;  5L3G B;  5JVD E;  4PJJ A;  4CXW A;  1MMD A;  2JMK A;  2KMF A;  2IC6 A;  1D0Y A;  5LGU B;  1YKH B;  1Z0P A;  4YFS A;  2CXL A;  3LBX B;  4YJ2 E;  3RPU A;  1AJ3 A;  3HA4 A;  4IGU A;  2BVL A;  4IDZ A;  4WNK A;  2D2S A;  3HR0 A;  4QXC B;  2NW7 A;  5JH7 E;  3N2G E;  4TV8 E;  5LNK A;  3N9Q A;  4OHF A;  3C4W A;  1MNE A;  2P63 A;  2NOX A;  2V7I A;  3H3A A;  3SS1 A;  3A5X A;  2CCQ A;  3ESL A;  1MIY A;  2L3L A;  1WLX A;  3Q5W A;  2KND A;  1BR0 A;  3N9M A;  2CA5 A;  4DBQ A;  4MHC A;  4A56 A;  2L8K A;  5LA6 E;  4E7S A;  3UTK A;  4XBF B;  3PTR B;  2A3D A;  3RYF E;  2OA5 A;  1IAP A;  3V5U A;  5F3J A;  4AKG A;  5AFU L;  3S4U A;  3E22 E;  3O1I A;  3L8I A;  4DND A;  5LG4 A;  5HWY A;  2HH7 A;  1WYB A;  3KBT A;  3C98 B;  3V5S A;  4U72 A;  4ASK A;  4E7Z A;  1KK7 A;  4QWN B;  3C4Z A;  2N9D A;  5EK4 A;  1D0Z A;  4AQF A;  2WSS V;  4IST A;  5M4Y A;  2BDE A;  2VAS A;  5J2U E;  3RC3 A;  3SOL A;  3K3N A;  3VKG A;  2VB6 A;  1QUU A;  3VKH A;  3W8I B;  2MOZ A;  4G2A A;  4UVA B;  3RH3 A;  4O2A E;  2IAK A;  2XHE B;  2XAF B;  4ADZ A;  3RYI E;  3KV9 A;  4CQI A;  5LGN B;  2V1D B;  3CQC B;  3SRZ A;  3LFM A;  5HXE A;  3O9X A;  3RQE A;  3U78 A;  3GWH A;  3SWH A;  5IHY A;  3OJA A;  4EOZ B;  5L3B B;  1ZHC A;  5EZY E;  4WBN E;  4MBQ A;  4DO0 A;  1X79 A;  5JR9 B;  2MTQ A;  5JQG E;  4WBO A;  5LCY A;  2H7O A;  5DQW A;  2LSK A;  4P0B A;  1HF8 A;  3LK4 2;  1FMW A;  3HI2 A;  1LVF A;  1WYC A;  2X9W A;  2HPL A;  2XAQ B;  4KMC A;  3MXZ A;  3HKB E;  5EK3 A;  5LBQ B;  5L3F B;  4ZI2 D;  2W63 A;  4JEH B;  2LJL A;  2CEA A;  5HXC A;  2NTX A;  4HGA A;  4CXX A;  1O3X A;  3B57 A;  1QSD A;  3H37 A;  1HS7 A;  3I9W A;  2ES0 A;  2NWB A;  2B1E A;  2UXN B;  2VL8 A;  5TAO A;  5L3E B;  2NW9 A;  1HTJ F;  2X9X A;  3FHN A;  2NW8 A;  4PJL A;  3RRW A;  3RKO A;  4H9P C;  5JDM A;  2CLY B;  4EXT A;  4HEA A;  3B13 A;  1MND A;  3AA7 B;  2EHO D;  3UUL A;  4UF0 A;  3FXE B;  3EDV A;  4O4H E;  2MYS A;  1U4Q A;  3IHR A;  5FP3 A;  2KXP B;  4AKR B;  3E08 A;  1G73 A;  3HKC E;  2DI4 A;  2ZM8 A;  4P09 A;  3EVY A;  3CQG B;  4HTE A;  3CX8 B;  1KNZ A;  4BJN A;  4PK5 A;  4MFR A;  3IBP A;  4IE0 A;  4EYU A;  3AA6 B;  2ODV A;  2BZB A;  3TKL B;  2XQY A;  2KIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...