3O4XE

Crystal structure of complex between amino and carboxy terminal fragments of mdia1
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
454
structure length
433
Chain Sequence
VLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a complex between amino and carboxy terminal fragments of mDia1: insights into autoinhibition of diaphanous-related formins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Protein diaphanous homolog 1
total genus 128
structure length 433
sequence length 454
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02181 FH2 Formin Homology 2 Domain
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.80 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3o4xE01
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3o4xE03
3OBVE 3O4XE 2J1DG 2Z6EA 1Y64B 4EAHA 1V9DA 1UX5A 1UX4A
chains in the Genus database with same CATH superfamily
3RRWA 3T88A 2UXXB 1IZNB 2X67A 4A98A 4UR9A 1D0YA 4O4HE 3UU4A 1BR2A 3AAEB 5FY7A 4LF9T 3KV9A 2BG9A 2WDRA 4ZI3D 3ZT6A 4DMVA 3RYIE 3RYHE 4HFEA 5KDMC 4CN6A 4LFCT 4X1YE 2N9DA 1U5PA 4QWNB 5DQWA 5KXJA 5C2TA 4DR3T 3RC8A 1J1JA 3AAIA 4PK5A 2X9XA 3Q5XA 4ANJA 3EDVA 4WNKA 3RQEA 2X9WA 1T8BA 3P8CD 1Y64B 3J7Yq 3RYCE 2B1EA 4CI3B 1YKEB 4TWHA 4DBRA 3LK3B 4LFBT 4QX7B 2XQ5A 3AE3A 4HWFA 1D1AA 5JDNA 4K3WA 2LSKA 5FVKA 4AQFC 3H37A 5FL0A 1V9DA 4HEAA 2VK9A 2BVLA 3OBVE 5HYAA 4B3ST 4WZXA 2BKOA 2W66A 3ZJ1A 5FKYA 3RIUA 3ADCA 3I0OA 4X62T 1MMGA 3F31A 4HFVA 3EVYA 3RPUA 1HG5A 5KMGP 4GYRA 3GWHA 3PTRB 2V6YB 2LLYA 5LXTE 1XNRT 2Q9QB 2WCAA 1KK7A 3FHNA 3I0QA 4G63A 4CI1B 4TUYE 4EYUA 3AA0B 3AA7B 4ZZCA 4HWIB 1KNZA 2CLYC 3H3AA 1SE7A 4H9OC 1IAPA 3I1AA 2R6GF 4ILAA 3CVRA 2V1DB 2A3DA 3RF1A 4OFZA 2C5KT 4K2NA 1MNEA 5AQSB 2VURA 5LMNT 3HL6A 3LJCA 5ABGA 2XQ9A 2WMNA 2JIWA 3QK6A 5JDHA 1RJMA 2MYSA 2ZLYA 3H3MA 5BMVE 1VCTA 4IDZA 4ZU2A 2LOSA 3QUJA 5JTGA 4HE8A 2ACXA 3N9QA 1T7SA 4DR1T 2EHOD 3CK6A 3OVUA 5FP3A 4YJ3E 5LMUT 1HNWT 1DCIA 3KVBA 3UU6A 4ZS3A 5L3DB 4G2AA 4I43B 5ABFB 2LRLA 1UUSA 5IHYA 3UUBA 3PUAA 2I6HA 4TX5A 3FZLB 2ZM8A 3ANWB 3RQGA 2J1DG 3DTOA 4Z91A 3QXZA 3BQKA 3LDQB 4JI3T 3A5XA 5FXWA 2XAGB 2LHNA 2WSSV 1LVKA 5AQTB 1HFAA 3AEBA 4MALA 3MACA 4AIUA 3K3NA 2WWVA 4WBOA 2HPJA 3MA9A 2W62A 1N34T 5FXVA 4YHJA 4ZI7E 2JQHA 2W63A 4TN7B 4IE4A 1X9BA 3ADDA 3N9NA 5F3JA 4DUYT 4OYKA 2HW5A 3UQ4A 1HR0T 2ES0A 5HEUA 4EMLA 3KDSE 5LG4A 3AEFA 3SFDA 5L3GB 3P7IA 5L3CB 4I42A 4AXPA 1AJ3A 4JI5T 3SWXA 3RHWA 4IDNA 2VKHA 4DR5T 4HTEA 5J0ZA 2V5DA 2VVSA 5FYMA 4YSZA 3P4RA 3R84B 3U78A 4U19A 3HKEE 2K9AA 5DQVA 1I6ZA 4XBFB 3N9MA 4MOUA 2FJEA 2V7IA 2PFVA 3ANWA 2L8KA 3NZQA 5HCMA 3VRBA 3V5SA 3RYFE 1G73A 1E7PA 3A4LA 1US7B 4DO0A 4UXNB 3JC6D 4DNDA 2D5UA 4YT0A 4A5XA 2NW8A 2ODVA 5F8PA 5GONE 2BKPA 3AAAB 3TLWA 3Q0GA 2MTQA 3J9X1 3ZYKA 3SLLA 2PPYA 3EI0A 2YEVC 4O2BE 1OEDA 4ISSA 1Y01A 4AQGA 5ABEA 2YKSA 4ZOLE 2DNXA 1LKXA 3AE7A 2JQ9A 2ZM6T 3O1IA 3PE0A 4Q25A 2VL8A 3DJBA 2FBWA 4DV0T 2VREA 2IAKA 3EAMA 5E0OA 2KINB 4NXNT 2UUCT 4ZI3C 5HEOA 4JI1T 4C91A 3C98B 1NWMX 2BZBA 2CWYA 4EOZB 2JPFA 5AQHB 5EZYE 1QUUA 2XSAA 4ZHQE 2CHNA 4OG1A 5AQJB 3ZN1B 2WU5A 4L5GA 2D9DA 5LA6E 3ZMVB 1MIYA 3M3ZB 4OX9T 3PUZF 3JAFA 4N78D 2BS2A 3ONXA 4UF0B 3Q1TA 5CA1E 4B6XA 5ADXL 3ZT5A 4CXWA 2Y48B 3OPCA 3N2OA 1OWAA 1YQ4A 4JV5T 3A4MA 4I50E 1EF8A 4U3CA 3TLVA 3C51A 4B3MT 1J5ET 2WS3A 4WCZA 2QYWA 3UQ7A 5ETWA 3T89A 5FVLA 2XAFB 1CHUA 3MK7C 4YXDA 2OLTA 4GKKT 2NR4A 4F8HA 2JJ9A 5LHHB 4TV9E 3IBPA 2XAQB 2CBIA 2YDQA 4ZS2A 5TAOA 4ASKA 1YKHB 4AKLA 2NW7A 3X1DA 1KNRA 3OC7A 4GKJT 4DUZT 2LJLA 1MIWA 2V6XA 4IDOA 4EB6E 2BS4A 4PW8A 3NRYA 4UF0A 2Y6XA 3CQXC 2LSIA 4QHOA 3N2GE 4IDPA 2UXDT 2CRBA 3UUXB 2W61A 4HFIA 1WLXA 4Z8XA 4BJNA 2N1GA 4KMCA 4EYYR 3PUSA 5HWYA 3MKDA 2Z6EA 5L3FB 4OHFA 1QLBA 4ZEYA 4CN1A 4YY3T 4O4LE 1NEKA 5HEHA 2XSBA 3O9XA 2IEXA 4I4ZA 1WR0A 5JBWA 2VB6A 2J47A 1MNDA 3WI3A 3ZMSB 4IE6A 2NTYA 5AQRB 4UEMA 1IBKT 4TV8E 2C5JA 3IF8B 3RQUA 3BQIA 5H6RB 4JI6T 2FJDA 3AEAA 2XUEA 2Q9QA 5CA0E 1UGOA 2VQET 2W2UA 4AKIA 5H6QB 2QA7A 3PJAA 4XAXB 2Y8DA 5AQNB 2W67A 3FZHB 5ABFA 4ILBA 4JEUB 4TWDA 4MBQA 3P4SA 4JI0T 2LOPA 5J1GA 3HR0A 2XQ4A 1J5WA 2PBPA 2WWUA 4QH1A 3AVRA 3PUQA 3D0TA 2VKOA 2YU1A 4I4TE 2ACZA 3P4WA 4U7IA 1MIVA 1RJNA 3R9SA 5AQFB 2K24A 3L8RA 2M6BA 3AVSA 2M67A 4UV8B 5LHGB 3UU3A 1VRBA 1FJGT 4MI2A 2LRKA 3Q5EA 4WW0A 5LNKA 5JRCA 4U2ZA 2C5IT 3AE4A 5LJMA 4YHHT 2VX2A 1LRZA 3FZKB 3KBTA 3ZC0A 2V7KA 3BK9A 3QB5K 1MJ3A 5EK3A 1Q52A 3AEEA 1UK5A 1W0AA 3MOYA 3CPZA 2I59A 2IIUA 4LMJA 2V26A 2BVMA 4EXTA 5LGNB 2HN2A 3FDUA 2EHOC 4X65T 1NAFA 4YSYA 2XASB 3CQGB 4ELXA 5LBMA 4OK0A 4U72A 4U1AA 2W0GA 2JMKA 1BR1A 2CLYB 1IJ5A 4C90A 3FXDB 1KFYA 3A4NA 3RQWA 1DUBA 4HWHA 1WFDA 3K8PC 1MMDA 2HH7A 3PV0F 3K3QC 3ADBA 3VHLA 3AXJA 4K0KT 3UUMA 5HXCA 4BJMA 1NENA 5JVDE 4GEHB 4TNWA 3FB2A 1E2AA 3KBUA 1OEDB 1UCUA 2XQ3A 3JC6C 4QIIA 1T98A 1M62A 3SOLA 2VKDA 2XTLA 5AQLB 2NW9A 5CJ5A 3ZMZB 3MZKB 1XMOT 3W8IB 2W00A 3UT5E 3ETVA 4ISTA 1WRDA 2BDEA 3I9YA 4NUUA 4DV5T 4PJLA 5LOVE 3RSIA 2XQ6A 4U31A 3AJMA 4F6RC 5F5WA 3FXEB 3KFWX 3TKLB 4EIWA 2L3LA 3T1HT 3PUVF 5AQUB 1KF6A 4EV6A 5JDGA 2GK9A 3PUYF 5FY1A 1R8IA 5JDMA 2IDOB 3A8YC 4HWDA 3KINB 4O8SA 2CM0A 1Z0PA 1WYBA 3H02A 3E22E 3R6NA 5C9GA 4A56A 2AXDS 1W09A 4HGAA 1KEYA 3TLTA 2LM2A 3FZMB 5LGTB 5KJPA 5EK2A 2LE8A 4BA9A 2QVAA 1OEDC 3FBZA 4GOUA 3MJXA 3UU8A 3Q0JA 2BKNA 3UULA 4J2CA 3TRRA 3ZC1A 1IBLT 3AE5A 1FMVA 2DCFA 2KSRA 4TZ4C 4JBWF 3NKZA 1XDPA 2D0UA 5JBXA 2IW5B 2Q9QD 4QXBB 4AQYT 1Q51A 5JQGE 2WMOA 4M1PA 4H9QC 4DMWA 3ZYLA 3UFGA 4ELWA 3AB3B 4PK6A 3CX6B 3CQCB 4GK0E 3ZPOA 2MOZA 4QXCB 3KQFA 5IYZE 3AEGA 4CXYA 2H89A 2FUPA 3FBLA 4UVBB 2DLRA 2OA5A 1EY3A 3ZJ2A 3IA3A 2BG9B 3C4ZA 3H81A 2IC6A 2A9UA 2H88A 3CMLA 1QSDA 1S35A 5JREA 2WB5A 3QC9A 3Q5DA 5IWAT 2PG8A 3LK42 1SHZC 3NVOA 3ZCJA 3L8IA 1XDOA 5A1LA 4TWFA 4LF7T 4FZWA 1W0BA 2V7LA 5JR9C 1N33T 1OEDE 4PFOA 5L47A 4JI2T 5CFBA 4DR4T 5HXRA 5BR8T 3ZSSA 4IDQA 2H3RA 3N9OA 2P63A 4CI2B 4NNQA 2CEAA 2XM2A 3WAKA 3VRAA 2J4GA 1Z8UA 3KV4A 4QX8B 4PJJA 4KNPA 3OKQA 2M6IA 2RA1A 2H7VC 4WYVA 1M7KA 4DV1T 4XZCA 2V8SV 3LSVA 4AKGA 4H9SE 2D0TA 2K3WA 2IMLA 4DIDB 3RIUC 4P0BA 3TLFA 3JADA 4QH4A 3L8JA 5J2UE 2CXFA 3JAEA 3IRBA 1IBMT 4UELA 4ILUA 2E5LT 3ZSTA 2UZFA 4U18A 2KWIB 2YU2A 1G8XA 3N2KE 5C8YE 3F2EA 4COFA 1L0VA 1X79A 2NOXA 2XHEB 2BS3A 3RLFF 3AE6A 1E1HB 3P4QA 4DR2T 4PJMA 3R0OA 4E7SA 1SA0E 4IREA 4L9IA 4Z90A 4IT4A 2CHOA 4UVCB 4ADZA 2YDRA 4HFBA 4DR6T 3C4WA 4YTMA 3GA8A 3PUGA 2LSJA 4JI7T 5HXSA 4JI4T 4YLHA 4WBNE 3C50A 2YOEA 3PZKA 1ZEEA 5IUXA 4L0RA 4HWCA 3N9PA 4X20E 3Q2MA 4NPPA 5LGUB 4LF6T 4P1NA 3NWIA 2A2FX 3AXJB 4V1Av 1XNQT 2XQYA 1YW0A 3GMIA 1EZ3A 5JR9B 3P4PA 3QB5A 4CXXA 3EDUA 2CXLA 3ABVA 1FIOA 1UX5A 1MMAA 2UXCT 2CBJA 1DU2A 4ILCA 3CKDA 2X0LB 1HTJF 2XAHB 2DI4A 2QGSA 2PBIA 5AQQB 3LFMA 1ZHCA 2X0HA 2BG9C 4PJNA 2KNDA 3RRCA 3SFEA 4CN4A 4IL9A 5HEGA 2WU2A 1O3XA 4AKHA 4EZ4A 1JNZA 4YTPA 3CIRA 2LKGA 3CX7B 4F47A 3ZT7A 3HKCE 3NBXX 3LK2B 3E08A 2PTFA 1I94T 1YD8G 4PK4A 2XPKA 3AE8A 2LHRA 1D1CA 5HWXA 5AQOB 5LYJE 4ELSA 4B3RT 2BBHA 5HXHA 2FBMA 2KT9A 1GQEA 4BAYB 2JRKA 5AQGB 3B13A 4IE5A 4X66T 1UIYA 3KV5A 5JR9A 2UU9T 1NZYA 1ZOYA 4LFAT 3OYZA 1WZ8A 2VVNA 4HFDA 2YN6A 2JMHA 5FXXA 2KWHA 3MXZA 4IE7A 3LG7A 2XZEA 3N9LA 3MYBA 4HFHA 5AQPB 2IHR1 1HNXT 3VR8A 3RC3A 3RGLA 4QIJA 4CZZB 2UXNB 4EAHA 3RIFA 5HXEA 3UTKA 2ZM2A 2HHHT 4U7YA 1ZP0A 2JQKA 1ZKEA 2VL0A 2QRXA 2LKHA 2DHRA 2P9BA 1WCRA 3AE1A 3SWHA 2X0YA 4ZI2C 2BG9E 3EHZA 1D1BA 4FJOA 1LVFA 1NZYB 2C0SA 5FXZA 2MPKA 2AE9A 2MBGA 4MHCA 5C3JA 4EZHA 2B76A 3ETUA 3TLSA 4O2AE 4X1KE 3T8AA 1HCIA 4FI5A 4OYJA 4KI0F 5FNVE 2WQYA 3FZFB 4TNVA 1HF8A 2L9QA 3WAJA 2WM9A 1H7CA 3E0ZA 3IHRA 1HG2A 3HKBE 1UURA 2ZMAA 1T72A 3ZCIA 5LB7B 3QXIA 4EGWA 3B57A 1FEWA 3GN5A 2X9YA 3L3PA 5HAXA 1U4QA 5CGMA 1BR0A 2UUBT 2F4VT 1KNPA 3RX6A 2VQFT 3P5MA 5LBQB 2IC9A 3T1YT 5L4HA 4DV6T 4UIGA 4NUVA 5L2LA 4DBQA 3QK8A 3T8OA 3Q9DA 4X5TA 4JWVA 4IIJE 4B3TT 3PU8A 2XQ7A 3AE2A 2MAWA 3HI2A 2ODUA 2A72A 2XJ7A 5JDQA 3PU3A 4P09A 4LF4T 1OXZA 3TLUA 1JNRA 5DABA 4IZBA 4O4JE 5JH7E 1YQ3A 3F57A 4JOTA 3EUHA 4KBMB 2E9XC 3NZPA 4DV4T 4PFPA 5LHIB 2DUBA 2ZQQA 2CA5A 4U2YA 4YSXA 3PDYA 2VASA 2LEHA 4QXHB 2UUAT 4DV3T 5LJNA 4IZCA 4GYSA 2H7OA 2I0MA 4YTNA 2ZQRA 4PNIA 2D2SA 4AKRB 1IJ6A 3A7MA 3VU7H 4JFCA 4KP3C 4IGUA 3PUWF 3V5UA 3LBXA 4I55E 2KMFA 1XWMA 2F6QA 2XAJB 2JQQA 1XMQT 3W8HB 4AISA 1YXRA 1FMWA 2V7JA 3C4XA 3QOFA 4LF8T 4DV2T 4JCSA 2Q9QC 1HZDA 3ZMTB 1UX4A 5AQIB 2YDSA 2CXDA 4KHZF 3PUXF 2EHOB 4LMKA 4U74A 5AQMB 3ZLIA 2FW2A 3QNUA 4IE0A 5FMNA 3VKGA 4A97A 1WYCA 3B5MA 2GTRA 3SRZA 4JYAT 3VR9A 2CWOA 2E2AA 2VKJA 3K1SA 3RKGA 4DV7T 2CE7A 2N2NA 5JRCB 3G06A 3KV6A 3L09A 3Q5WA 5AFUL 3DP7A 4P0AA 2KXPB 2YINA 3OYXA 3RQFA 2V7MA 3N5LA 5AQVB 2J62A 4H63H 1BR4A 3ZMUB 4ZI2D 4FJWD 5LG3A 2WP9A 4E7ZA 3R9TA 3SS1A 5M4YA 5FY0A 4UVAB 2X66A 3KVAA 3W15B 4I52A 4GIWA 4H9NC 5HCJA 1HX1B 4IHJE 2KLQA 2EHOA 3UU5A 2YK0A 5JDFA 2NTXA 4KUMB 3RKOA 1HS7A 4KX6A 3CWZB 3G64A 3HRXA 2E9XD 1HNZT 2RPAA 4DVDA 4AI6A 3EABA 5LP6E 1CUNA 2ZM0A 2DL1A 2OV9A 3VKHA 4HN9A 5L3BB 4PAGA 2QQ3A 2FJBA 4NXMT 4HFCA 4X1IE 3O1JA 2UXBT 4OLQA 4I0UA 3S4UA 2WZIA 2K48A 2HN1A 3UFEA 3O1HA 3AEDA 2DWKA 4EEDA 2KZ7B 3JCFA 3RIAA 4NIQA 5LCYA 2NWBA 4EEBA 2SPCA 4K0UA 3M65A 4UV9B 5JDLA 2E9XB 2XQAA 1VCSA 1S94A 5L4EA 5KX5E 2K5BB 4CQIA 2LSGA 4H63V 3I47A 3AM1A 2E5VA 1W9RA 4ZZBA 1XZYA 3K3OA 2CCQA 2G0UA 4H9PC 2XQ8A 3O4XE 2PJQA 3HKDE 4ERRA 4O4IE 4YJ2E 3RH3A 4HKAA 4QH5A 3RI5A 4FZWC 2LT3A 1D0XA 4U33A 3OJAA 5DJQC 5ABHA 3IEEA 2WDVA 3ZYMA 2DWGA 3ONLC 1JXZA 1HX8A 2HPLA 4JUYA 2IUBA 2CPTA 4JLEA 4LMLA 1WR6A 2NP9A 5HEJA 4MLKA 1ZV4X 2V5CA 2V6YA 4QKNA 2EJ5A 3GN5B 1MMNA 2X9HA 2WBLA 2CMRA 3AA1B 4IL4A 2E9XA 3ESLA 4JYLA 3CX8B 4DR7T 5CB4E 3OTOT 3HA4A 4AQFA 2RP4A 2XY8B 5FL1A 5EK4A 3U3IA 2FJAA 3AA6B 2WY2A 3PJAJ 3AE9A 4GK5E 3HINA 4H9RC 3AECA 1SUMB 3BQLA 4KHPT 1B7TA 3ZKRA 5AQKB 1EF9A 3L39A 2X51A 1N32T 1VOMA 3LBXB 1D0ZA 5L3EB 4X64T 2W4XA 4IZDA 3NRXA 4JI8T 4NEKA 2LSYA 4YFSA 2LM9A 1N36T 3ZN0B 4LF5T 3P50A 2WAUA 2X68A 3PURA 4MFRA 2WDQA 4JEHB 2XM1A 2E8IA 5J2TE 3UUNA 3ONJA 3I9WA 2BBJA 2WZHA 2VWAA 4ZXLA 3C64A 3ZEFB
chains in the Genus database with same CATH topology
5L2LA 3RRWA 4CXYA 5ETWA 4DBQA 3FBLA 4UVBB 2DLRA 2XAFB 2UXXB 1IZNB 2X67A 3MK7C 2OA5A 1D0YA 4O4HE 3T8OA 3Q9DA 1BR2A 3ZJ2A 3AAEB 2JJ9A 5FY7A 5LHHB 4TV9E 4IIJE 3IBPA 2XAQB 3KV9A 4ZI3D 3C4ZA 4DMVA 3RYIE 3RYHE 3PU8A 2IC6A 3HI2A 2ODUA 5KDMC 3CMLA 4ZS2A 5TAOA 1QSDA 2A72A 4ASKA 1S35A 5JREA 1YKHB 3QC9A 4AKLA 5JDQA 2NW7A 3PU3A 2PG8A 3LK42 4X1YE 4P09A 2N9DA 1SHZC 1U5PA 1OXZA 4QWNB 5DQWA 2LJLA 1MIWA 3ZCJA 3RC8A 5DABA 5JH7E 4O4JE 3L8IA 5A1LA 3AAIA 4PK5A 2X9XA 3F57A 4EB6E 4PW8A 3EUHA 3Q5XA 4ANJA 3EDVA 3NRYA 4UF0A 4WNKA 3RQEA 4KBMB 2E9XC 2Y6XA 2V7LA 2X9WA 3CQXC 2LSIA 3NZPA 4PFPA 5JR9C 4QHOA 5LHIB 3P8CD 3N2GE 1Y64B 3J7Yq 4PFOA 3RYCE 2B1EA 4CI3B 5HXRA 1YKEB 3UUXB 4DBRA 2CA5A 2W61A 2H3RA 1WLXA 3LK3B 4Z8XA 3N9OA 4BJNA 2P63A 2N1GA 4KMCA 3PUSA 4CI2B 4EYYR 4NNQA 3PDYA 5HWYA 3MKDA 2CEAA 2VASA 2Z6EA 5L3FB 4QX7B 2LEHA 4OHFA 1D1AA 4QXHB 5JDNA 3WAKA 5LJNA 4O4LE 4GYSA 2LSKA 2H7OA 4AQFC 3KV4A 4QX8B 3H37A 1V9DA 4PJJA 4HEAA 2VK9A 2BVLA 3OKQA 3OBVE 3O9XA 2RA1A 2H7VC 5HYAA 4XZCA 4PNIA 4H9SE 4AKGA 3ZJ1A 2VB6A 2D2SA 3ADCA 2D0TA 3I0OA 4AKRB 1MNDA 3WI3A 3ZMSB 1MMGA 3F31A 4HFVA 1IJ6A 4IE6A 3VU7H 3EVYA 2NTYA 4KP3C 4IGUA 4UEMA 3RPUA 4P0BA 1HG5A 4TV8E 3V5UA 5KMGP 2C5JA 3IF8B 3BQIA 3LBXA 4I55E 2KMFA 4GYRA 5H6RB 3GWHA 3L8JA 3PTRB 5J2UE 2XAJB 2Q9QA 2XUEA 5CA0E 5LXTE 2JQQA 2Q9QB 3W8HB 4AKIA 2CXFA 1FMWA 5H6QB 2V7JA 3C4XA 1KK7A 3FHNA 2QA7A 3IRBA 3I0QA 4G63A 4UELA 2Q9QC 4XAXB 4ILUA 3ZMTB 4CI1B 1UX4A 2Y8DA 4TUYE 4EYUA 3AA0B 2KWIB 2YU2A 1G8XA 3AA7B 2CXDA 4JEUB 1KNZA 4MBQA 3N2KE 2CLYC 3H3AA 5C8YE 3F2EA 4H9OC 2LOPA 1IAPA 5J1GA 3HR0A 1X79A 2WWUA 2NOXA 3I1AA 3CVRA 2V1DB 2XHEB 2EHOB 3AVRA 2A3DA 4OFZA 4U74A 3PUQA 3D0TA 2VKOA 2C5KT 1E1HB 2YU1A 1MNEA 4I4TE 3ZLIA 3HL6A 3LJCA 4PJMA 4E7SA 1SA0E 1MIVA 4L9IA 4IE0A 5FMNA 3VKGA 1WYCA 2K24A 2WMNA 3QK6A 4UVCB 3SRZA 5JDHA 1RJMA 2MYSA 3AVSA 2ZLYA 5BMVE 4ADZA 2M67A 4UV8B 4IDZA 2CWOA 5LHGB 2LOSA 3QUJA 1VRBA 4HE8A 2VKJA 3C4WA 3GA8A 3PUGA 2ACXA 3N9QA 2LSJA 2CE7A 2N2NA 5JRCB 5HXSA 3KV6A 3L09A 3Q5WA 4WW0A 5AFUL 5LNKA 4YLHA 2EHOD 5JRCA 2C5IT 3DP7A 4WBNE 4P0AA 2KXPB 3C50A 5FP3A 2YINA 3OYXA 3RQFA 5LJMA 2V7MA 1LRZA 3N5LA 4YJ3E 3KBTA 4H63H 1BR4A 3ZMUB 4ZI2D 3ZC0A 1ZEEA 2V7KA 4L0RA 4E7ZA 3SS1A 3KVBA 5M4YA 3N9PA 4ZS3A 5L3DB 4X20E 4G2AA 4I43B 3BK9A 3Q2MA 5FY0A 4UVAB 2X66A 3KVAA 3W15B 5EK3A 5LGUB 4GIWA 4H9NC 2A2FX 4V1Av 5IHYA 3PUAA 4IHJE 4TX5A 2XQYA 1YW0A 2I59A 3CPZA 3GMIA 1EZ3A 2ZM8A 3ANWB 5JR9B 3RQGA 2KLQA 2J1DG 2EHOA 3DTOA 2V26A 3EDUA 2BVMA 4CXXA 2CXLA 4EXTA 5LGNB 1FIOA 1UX5A 3BQKA 1MMAA 3A5XA 2EHOC 5FXWA 2XAGB 2LHNA 2YK0A 2WSSV 5JDFA 1NAFA 2NTXA 4KUMB 3RKOA 1LVKA 1HFAA 1HS7A 2XASB 3CWZB 3CKDA 2X0LB 4MALA 3MACA 2E9XD 3CQGB 3K3NA 1HTJF 4WBOA 2HPJA 3MA9A 2XAHB 4DVDA 5LBMA 2W62A 4OK0A 4U72A 4AI6A 2W0GA 5LP6E 2JMKA 5FXVA 2DI4A 1BR1A 2QGSA 1CUNA 4YHJA 2ZM0A 3VKHA 2PBIA 2CLYB 4ZI7E 1IJ5A 4HN9A 2W63A 4TN7B 5L3BB 4PAGA 4IE4A 4C90A 3FXDB 3ADDA 3N9NA 4X1IE 5F3JA 3LFMA 1ZHCA 3A4NA 3O1JA 4PJNA 4OYKA 2KNDA 3RRCA 2ES0A 3K8PC 3S4UA 1MMDA 1O3XA 2HH7A 2K48A 4AKHA 3K3QC 4EZ4A 3ADBA 3VHLA 3CX7B 3KDSE 5LG4A 3UFEA 3O1HA 3UUMA 5HXCA 4BJMA 5L3GB 2DWKA 5JVDE 3P7IA 4GEHB 5L3CB 4AXPA 3HKCE 3NBXX 2KZ7B 3LK2B 3E08A 1AJ3A 3FB2A 1YD8G 3KBUA 1UCUA 4PK4A 5LCYA 2LHRA 1D1CA 3JC6C 2NWBA 5HWXA 2VKHA 2SPCA 5LYJE 1T98A 4K0UA 5HXHA 4HTEA 3M65A 3SOLA 2KT9A 2VKDA 4UV9B 2XTLA 5JDLA 2E9XB 5FYMA 2NW9A 3R84B 3U78A 3HKEE 4BAYB 2K9AA 1S94A 3ZMZB 5DQVA 2JRKA 4XBFB 5KX5E 3N9MA 3MZKB 2K5BB 4CQIA 2LSGA 4H63V 3W8IB 3AM1A 2W00A 3B13A 4IE5A 2V7IA 2PFVA 3K3OA 3UT5E 3ETVA 2CCQA 2G0UA 4H9PC 4ISTA 3O4XE 3KV5A 1WRDA 3ANWA 2L8KA 5JR9A 3NZQA 2BDEA 3I9YA 2PJQA 3HKDE 4ERRA 4NUUA 3V5SA 4O4IE 3RYFE 4YJ2E 3RH3A 1G73A 4HKAA 3OYZA 4PJLA 5LOVE 3A4LA 2LT3A 3AJMA 1US7B 1D0XA 4DO0A 4UXNB 4F6RC 3JC6D 4DNDA 2D5UA 2JMHA 5FXXA 2NW8A 3OJAA 3FXEB 5DJQC 2KWHA 2ODVA 3KFWX 3MXZA 4IE7A 5F8PA 5GONE 3IEEA 3LG7A 3TKLB 4EIWA 2L3LA 3ZYMA 2DWGA 3AAAB 3N9LA 1HX8A 2HPLA 4JUYA 2MTQA 3J9X1 3ZYKA 4JLEA 5JDGA 2GK9A 1WR6A 2NP9A 3RC3A 5FY1A 2YEVC 1ZV4X 4MLKA 4O2BE 2UXNB 4CZZB 4EAHA 5JDMA 5HXEA 3UTKA 2ZM2A 4ISSA 4AQGA 4QKNA 3GN5B 1MMNA 1ZKEA 2X9HA 2DHRA 2P9BA 3KINB 2WBLA 4ZOLE 2CMRA 4O8SA 3AA1B 2DNXA 2E9XA 1LKXA 3ESLA 2CM0A 3SWHA 1Z0PA 1WYBA 4ZI2C 3CX8B 3O1IA 3PE0A 2VL8A 3E22E 3DJBA 3R6NA 5CB4E 1D1BA 4A56A 4HGAA 2IAKA 3HA4A 4FJOA 4AQFA 2RP4A 5E0OA 2KINB 1LVFA 5EK4A 2C0SA 4ZI3C 3U3IA 5FXZA 4C91A 3AA6B 5LGTB 3C98B 5EK2A 1NWMX 2BZBA 2CWYA 4GK5E 4EOZB 2LE8A 2MBGA 4MHCA 4BA9A 4H9RC 2JPFA 3BQLA 5EZYE 1B7TA 1QUUA 3FBZA 4GOUA 4ZHQE 4EZHA 3ETUA 4O2AE 4X1KE 3MJXA 2X51A 1HCIA 4FI5A 3ZN1B 4L5GA 4OYJA 5LA6E 5FNVE 3ZMVB 3UULA 4J2CA 1HF8A 2L9QA 3ZC1A 3WAJA 2WM9A 1H7CA 1VOMA 1MIYA 1FMVA 2DCFA 3E0ZA 4TZ4C 3LBXB 3IHRA 1D0ZA 5L3EB 1HG2A 3HKBE 2ZMAA 3NRXA 4N78D 2D0UA 3ONXA 2LSYA 2IW5B 2Q9QD 3B57A 1FEWA 4QXBB 3ZCIA 4YFSA 2WMOA 3GN5A 4UF0B 2X9YA 3L3PA 5JQGE 4M1PA 5HAXA 4H9QC 5CA1E 1U4QA 1BR0A 2LM9A 4B6XA 4DMWA 5ADXL 3ZN0B 4CXWA 3ZYLA 2Y48B 3RX6A 3AB3B 2WAUA 3N2OA 2X68A 3PURA 4PK6A 1OWAA 3CX6B 4MFRA 5LBQB 3CQCB 2IC9A 4GK0E 3ZPOA 4JEHB 3A4MA 4I50E 2MOZA 2E8IA 5J2TE 4QXCB 3UUNA 3C51A 3I9WA 5IYZE 4UIGA 2VWAA 4NUVA 3C64A 3ZEFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBV E;  3O4X E;  2J1D G;  2Z6E A;  1Y64 B;  4EAH A;  1V9D A;  1UX5 A;  1UX4 A; 
#chains in the Genus database with same CATH topology
 3RRW A;  3T88 A;  2UXX B;  1IZN B;  2X67 A;  4A98 A;  4UR9 A;  1D0Y A;  4O4H E;  3UU4 A;  1BR2 A;  3AAE B;  5FY7 A;  4LF9 T;  3KV9 A;  2BG9 A;  2WDR A;  4ZI3 D;  3ZT6 A;  4DMV A;  3RYI E;  3RYH E;  4HFE A;  5KDM C;  4CN6 A;  4LFC T;  4X1Y E;  2N9D A;  1U5P A;  4QWN B;  5DQW A;  5KXJ A;  5C2T A;  4DR3 T;  3RC8 A;  1J1J A;  3AAI A;  4PK5 A;  2X9X A;  3Q5X A;  4ANJ A;  3EDV A;  4WNK A;  3RQE A;  2X9W A;  1T8B A;  3P8C D;  1Y64 B;  3J7Y q;  3RYC E;  2B1E A;  4CI3 B;  1YKE B;  4TWH A;  4DBR A;  3LK3 B;  4LFB T;  4QX7 B;  2XQ5 A;  3AE3 A;  4HWF A;  1D1A A;  5JDN A;  4K3W A;  2LSK A;  5FVK A;  4AQF C;  3H37 A;  5FL0 A;  1V9D A;  4HEA A;  2VK9 A;  2BVL A;  3OBV E;  5HYA A;  4B3S T;  4WZX A;  2BKO A;  2W66 A;  3ZJ1 A;  5FKY A;  3RIU A;  3ADC A;  3I0O A;  4X62 T;  1MMG A;  3F31 A;  4HFV A;  3EVY A;  3RPU A;  1HG5 A;  5KMG P;  4GYR A;  3GWH A;  3PTR B;  2V6Y B;  2LLY A;  5LXT E;  1XNR T;  2Q9Q B;  2WCA A;  1KK7 A;  3FHN A;  3I0Q A;  4G63 A;  4CI1 B;  4TUY E;  4EYU A;  3AA0 B;  3AA7 B;  4ZZC A;  4HWI B;  1KNZ A;  2CLY C;  3H3A A;  1SE7 A;  4H9O C;  1IAP A;  3I1A A;  2R6G F;  4ILA A;  3CVR A;  2V1D B;  2A3D A;  3RF1 A;  4OFZ A;  2C5K T;  4K2N A;  1MNE A;  5AQS B;  2VUR A;  5LMN T;  3HL6 A;  3LJC A;  5ABG A;  2XQ9 A;  2WMN A;  2JIW A;  3QK6 A;  5JDH A;  1RJM A;  2MYS A;  2ZLY A;  3H3M A;  5BMV E;  1VCT A;  4IDZ A;  4ZU2 A;  2LOS A;  3QUJ A;  5JTG A;  4HE8 A;  2ACX A;  3N9Q A;  1T7S A;  4DR1 T;  2EHO D;  3CK6 A;  3OVU A;  5FP3 A;  4YJ3 E;  5LMU T;  1HNW T;  1DCI A;  3KVB A;  3UU6 A;  4ZS3 A;  5L3D B;  4G2A A;  4I43 B;  5ABF B;  2LRL A;  1UUS A;  5IHY A;  3UUB A;  3PUA A;  2I6H A;  4TX5 A;  3FZL B;  2ZM8 A;  3ANW B;  3RQG A;  2J1D G;  3DTO A;  4Z91 A;  3QXZ A;  3BQK A;  3LDQ B;  4JI3 T;  3A5X A;  5FXW A;  2XAG B;  2LHN A;  2WSS V;  1LVK A;  5AQT B;  1HFA A;  3AEB A;  4MAL A;  3MAC A;  4AIU A;  3K3N A;  2WWV A;  4WBO A;  2HPJ A;  3MA9 A;  2W62 A;  1N34 T;  5FXV A;  4YHJ A;  4ZI7 E;  2JQH A;  2W63 A;  4TN7 B;  4IE4 A;  1X9B A;  3ADD A;  3N9N A;  5F3J A;  4DUY T;  4OYK A;  2HW5 A;  3UQ4 A;  1HR0 T;  2ES0 A;  5HEU A;  4EML A;  3KDS E;  5LG4 A;  3AEF A;  3SFD A;  5L3G B;  3P7I A;  5L3C B;  4I42 A;  4AXP A;  1AJ3 A;  4JI5 T;  3SWX A;  3RHW A;  4IDN A;  2VKH A;  4DR5 T;  4HTE A;  5J0Z A;  2V5D A;  2VVS A;  5FYM A;  4YSZ A;  3P4R A;  3R84 B;  3U78 A;  4U19 A;  3HKE E;  2K9A A;  5DQV A;  1I6Z A;  4XBF B;  3N9M A;  4MOU A;  2FJE A;  2V7I A;  2PFV A;  3ANW A;  2L8K A;  3NZQ A;  5HCM A;  3VRB A;  3V5S A;  3RYF E;  1G73 A;  1E7P A;  3A4L A;  1US7 B;  4DO0 A;  4UXN B;  3JC6 D;  4DND A;  2D5U A;  4YT0 A;  4A5X A;  2NW8 A;  2ODV A;  5F8P A;  5GON E;  2BKP A;  3AAA B;  3TLW A;  3Q0G A;  2MTQ A;  3J9X 1;  3ZYK A;  3SLL A;  2PPY A;  3EI0 A;  2YEV C;  4O2B E;  1OED A;  4ISS A;  1Y01 A;  4AQG A;  5ABE A;  2YKS A;  4ZOL E;  2DNX A;  1LKX A;  3AE7 A;  2JQ9 A;  2ZM6 T;  3O1I A;  3PE0 A;  4Q25 A;  2VL8 A;  3DJB A;  2FBW A;  4DV0 T;  2VRE A;  2IAK A;  3EAM A;  5E0O A;  2KIN B;  4NXN T;  2UUC T;  4ZI3 C;  5HEO A;  4JI1 T;  4C91 A;  3C98 B;  1NWM X;  2BZB A;  2CWY A;  4EOZ B;  2JPF A;  5AQH B;  5EZY E;  1QUU A;  2XSA A;  4ZHQ E;  2CHN A;  4OG1 A;  5AQJ B;  3ZN1 B;  2WU5 A;  4L5G A;  2D9D A;  5LA6 E;  3ZMV B;  1MIY A;  3M3Z B;  4OX9 T;  3PUZ F;  3JAF A;  4N78 D;  2BS2 A;  3ONX A;  4UF0 B;  3Q1T A;  5CA1 E;  4B6X A;  5ADX L;  3ZT5 A;  4CXW A;  2Y48 B;  3OPC A;  3N2O A;  1OWA A;  1YQ4 A;  4JV5 T;  3A4M A;  4I50 E;  1EF8 A;  4U3C A;  3TLV A;  3C51 A;  4B3M T;  1J5E T;  2WS3 A;  4WCZ A;  2QYW A;  3UQ7 A;  5ETW A;  3T89 A;  5FVL A;  2XAF B;  1CHU A;  3MK7 C;  4YXD A;  2OLT A;  4GKK T;  2NR4 A;  4F8H A;  2JJ9 A;  5LHH B;  4TV9 E;  3IBP A;  2XAQ B;  2CBI A;  2YDQ A;  4ZS2 A;  5TAO A;  4ASK A;  1YKH B;  4AKL A;  2NW7 A;  3X1D A;  1KNR A;  3OC7 A;  4GKJ T;  4DUZ T;  2LJL A;  1MIW A;  2V6X A;  4IDO A;  4EB6 E;  2BS4 A;  4PW8 A;  3NRY A;  4UF0 A;  2Y6X A;  3CQX C;  2LSI A;  4QHO A;  3N2G E;  4IDP A;  2UXD T;  2CRB A;  3UUX B;  2W61 A;  4HFI A;  1WLX A;  4Z8X A;  4BJN A;  2N1G A;  4KMC A;  4EYY R;  3PUS A;  5HWY A;  3MKD A;  2Z6E A;  5L3F B;  4OHF A;  1QLB A;  4ZEY A;  4CN1 A;  4YY3 T;  4O4L E;  1NEK A;  5HEH A;  2XSB A;  3O9X A;  2IEX A;  4I4Z A;  1WR0 A;  5JBW A;  2VB6 A;  2J47 A;  1MND A;  3WI3 A;  3ZMS B;  4IE6 A;  2NTY A;  5AQR B;  4UEM A;  1IBK T;  4TV8 E;  2C5J A;  3IF8 B;  3RQU A;  3BQI A;  5H6R B;  4JI6 T;  2FJD A;  3AEA A;  2XUE A;  2Q9Q A;  5CA0 E;  1UGO A;  2VQE T;  2W2U A;  4AKI A;  5H6Q B;  2QA7 A;  3PJA A;  4XAX B;  2Y8D A;  5AQN B;  2W67 A;  3FZH B;  5ABF A;  4ILB A;  4JEU B;  4TWD A;  4MBQ A;  3P4S A;  4JI0 T;  2LOP A;  5J1G A;  3HR0 A;  2XQ4 A;  1J5W A;  2PBP A;  2WWU A;  4QH1 A;  3AVR A;  3PUQ A;  3D0T A;  2VKO A;  2YU1 A;  4I4T E;  2ACZ A;  3P4W A;  4U7I A;  1MIV A;  1RJN A;  3R9S A;  5AQF B;  2K24 A;  3L8R A;  2M6B A;  3AVS A;  2M67 A;  4UV8 B;  5LHG B;  3UU3 A;  1VRB A;  1FJG T;  4MI2 A;  2LRK A;  3Q5E A;  4WW0 A;  5LNK A;  5JRC A;  4U2Z A;  2C5I T;  3AE4 A;  5LJM A;  4YHH T;  2VX2 A;  1LRZ A;  3FZK B;  3KBT A;  3ZC0 A;  2V7K A;  3BK9 A;  3QB5 K;  1MJ3 A;  5EK3 A;  1Q52 A;  3AEE A;  1UK5 A;  1W0A A;  3MOY A;  3CPZ A;  2I59 A;  2IIU A;  4LMJ A;  2V26 A;  2BVM A;  4EXT A;  5LGN B;  2HN2 A;  3FDU A;  2EHO C;  4X65 T;  1NAF A;  4YSY A;  2XAS B;  3CQG B;  4ELX A;  5LBM A;  4OK0 A;  4U72 A;  4U1A A;  2W0G A;  2JMK A;  1BR1 A;  2CLY B;  1IJ5 A;  4C90 A;  3FXD B;  1KFY A;  3A4N A;  3RQW A;  1DUB A;  4HWH A;  1WFD A;  3K8P C;  1MMD A;  2HH7 A;  3PV0 F;  3K3Q C;  3ADB A;  3VHL A;  3AXJ A;  4K0K T;  3UUM A;  5HXC A;  4BJM A;  1NEN A;  5JVD E;  4GEH B;  4TNW A;  3FB2 A;  1E2A A;  3KBU A;  1OED B;  1UCU A;  2XQ3 A;  3JC6 C;  4QII A;  1T98 A;  1M62 A;  3SOL A;  2VKD A;  2XTL A;  5AQL B;  2NW9 A;  5CJ5 A;  3ZMZ B;  3MZK B;  1XMO T;  3W8I B;  2W00 A;  3UT5 E;  3ETV A;  4IST A;  1WRD A;  2BDE A;  3I9Y A;  4NUU A;  4DV5 T;  4PJL A;  5LOV E;  3RSI A;  2XQ6 A;  4U31 A;  3AJM A;  4F6R C;  5F5W A;  3FXE B;  3KFW X;  3TKL B;  4EIW A;  2L3L A;  3T1H T;  3PUV F;  5AQU B;  1KF6 A;  4EV6 A;  5JDG A;  2GK9 A;  3PUY F;  5FY1 A;  1R8I A;  5JDM A;  2IDO B;  3A8Y C;  4HWD A;  3KIN B;  4O8S A;  2CM0 A;  1Z0P A;  1WYB A;  3H02 A;  3E22 E;  3R6N A;  5C9G A;  4A56 A;  2AXD S;  1W09 A;  4HGA A;  1KEY A;  3TLT A;  2LM2 A;  3FZM B;  5LGT B;  5KJP A;  5EK2 A;  2LE8 A;  4BA9 A;  2QVA A;  1OED C;  3FBZ A;  4GOU A;  3MJX A;  3UU8 A;  3Q0J A;  2BKN A;  3UUL A;  4J2C A;  3TRR A;  3ZC1 A;  1IBL T;  3AE5 A;  1FMV A;  2DCF A;  2KSR A;  4TZ4 C;  4JBW F;  3NKZ A;  1XDP A;  2D0U A;  5JBX A;  2IW5 B;  2Q9Q D;  4QXB B;  4AQY T;  1Q51 A;  5JQG E;  2WMO A;  4M1P A;  4H9Q C;  4DMW A;  3ZYL A;  3UFG A;  4ELW A;  3AB3 B;  4PK6 A;  3CX6 B;  3CQC B;  4GK0 E;  3ZPO A;  2MOZ A;  4QXC B;  3KQF A;  5IYZ E;  3AEG A;  4CXY A;  2H89 A;  2FUP A;  3FBL A;  4UVB B;  2DLR A;  2OA5 A;  1EY3 A;  3ZJ2 A;  3IA3 A;  2BG9 B;  3C4Z A;  3H81 A;  2IC6 A;  2A9U A;  2H88 A;  3CML A;  1QSD A;  1S35 A;  5JRE A;  2WB5 A;  3QC9 A;  3Q5D A;  5IWA T;  2PG8 A;  3LK4 2;  1SHZ C;  3NVO A;  3ZCJ A;  3L8I A;  1XDO A;  5A1L A;  4TWF A;  4LF7 T;  4FZW A;  1W0B A;  2V7L A;  5JR9 C;  1N33 T;  1OED E;  4PFO A;  5L47 A;  4JI2 T;  5CFB A;  4DR4 T;  5HXR A;  5BR8 T;  3ZSS A;  4IDQ A;  2H3R A;  3N9O A;  2P63 A;  4CI2 B;  4NNQ A;  2CEA A;  2XM2 A;  3WAK A;  3VRA A;  2J4G A;  1Z8U A;  3KV4 A;  4QX8 B;  4PJJ A;  4KNP A;  3OKQ A;  2M6I A;  2RA1 A;  2H7V C;  4WYV A;  1M7K A;  4DV1 T;  4XZC A;  2V8S V;  3LSV A;  4AKG A;  4H9S E;  2D0T A;  2K3W A;  2IML A;  4DID B;  3RIU C;  4P0B A;  3TLF A;  3JAD A;  4QH4 A;  3L8J A;  5J2U E;  2CXF A;  3JAE A;  3IRB A;  1IBM T;  4UEL A;  4ILU A;  2E5L T;  3ZST A;  2UZF A;  4U18 A;  2KWI B;  2YU2 A;  1G8X A;  3N2K E;  5C8Y E;  3F2E A;  4COF A;  1L0V A;  1X79 A;  2NOX A;  2XHE B;  2BS3 A;  3RLF F;  3AE6 A;  1E1H B;  3P4Q A;  4DR2 T;  4PJM A;  3R0O A;  4E7S A;  1SA0 E;  4IRE A;  4L9I A;  4Z90 A;  4IT4 A;  2CHO A;  4UVC B;  4ADZ A;  2YDR A;  4HFB A;  4DR6 T;  3C4W A;  4YTM A;  3GA8 A;  3PUG A;  2LSJ A;  4JI7 T;  5HXS A;  4JI4 T;  4YLH A;  4WBN E;  3C50 A;  2YOE A;  3PZK A;  1ZEE A;  5IUX A;  4L0R A;  4HWC A;  3N9P A;  4X20 E;  3Q2M A;  4NPP A;  5LGU B;  4LF6 T;  4P1N A;  3NWI A;  2A2F X;  3AXJ B;  4V1A v;  1XNQ T;  2XQY A;  1YW0 A;  3GMI A;  1EZ3 A;  5JR9 B;  3P4P A;  3QB5 A;  4CXX A;  3EDU A;  2CXL A;  3ABV A;  1FIO A;  1UX5 A;  1MMA A;  2UXC T;  2CBJ A;  1DU2 A;  4ILC A;  3CKD A;  2X0L B;  1HTJ F;  2XAH B;  2DI4 A;  2QGS A;  2PBI A;  5AQQ B;  3LFM A;  1ZHC A;  2X0H A;  2BG9 C;  4PJN A;  2KND A;  3RRC A;  3SFE A;  4CN4 A;  4IL9 A;  5HEG A;  2WU2 A;  1O3X A;  4AKH A;  4EZ4 A;  1JNZ A;  4YTP A;  3CIR A;  2LKG A;  3CX7 B;  4F47 A;  3ZT7 A;  3HKC E;  3NBX X;  3LK2 B;  3E08 A;  2PTF A;  1I94 T;  1YD8 G;  4PK4 A;  2XPK A;  3AE8 A;  2LHR A;  1D1C A;  5HWX A;  5AQO B;  5LYJ E;  4ELS A;  4B3R T;  2BBH A;  5HXH A;  2FBM A;  2KT9 A;  1GQE A;  4BAY B;  2JRK A;  5AQG B;  3B13 A;  4IE5 A;  4X66 T;  1UIY A;  3KV5 A;  5JR9 A;  2UU9 T;  1NZY A;  1ZOY A;  4LFA T;  3OYZ A;  1WZ8 A;  2VVN A;  4HFD A;  2YN6 A;  2JMH A;  5FXX A;  2KWH A;  3MXZ A;  4IE7 A;  3LG7 A;  2XZE A;  3N9L A;  3MYB A;  4HFH A;  5AQP B;  2IHR 1;  1HNX T;  3VR8 A;  3RC3 A;  3RGL A;  4QIJ A;  4CZZ B;  2UXN B;  4EAH A;  3RIF A;  5HXE A;  3UTK A;  2ZM2 A;  2HHH T;  4U7Y A;  1ZP0 A;  2JQK A;  1ZKE A;  2VL0 A;  2QRX A;  2LKH A;  2DHR A;  2P9B A;  1WCR A;  3AE1 A;  3SWH A;  2X0Y A;  4ZI2 C;  2BG9 E;  3EHZ A;  1D1B A;  4FJO A;  1LVF A;  1NZY B;  2C0S A;  5FXZ A;  2MPK A;  2AE9 A;  2MBG A;  4MHC A;  5C3J A;  4EZH A;  2B76 A;  3ETU A;  3TLS A;  4O2A E;  4X1K E;  3T8A A;  1HCI A;  4FI5 A;  4OYJ A;  4KI0 F;  5FNV E;  2WQY A;  3FZF B;  4TNV A;  1HF8 A;  2L9Q A;  3WAJ A;  2WM9 A;  1H7C A;  3E0Z A;  3IHR A;  1HG2 A;  3HKB E;  1UUR A;  2ZMA A;  1T72 A;  3ZCI A;  5LB7 B;  3QXI A;  4EGW A;  3B57 A;  1FEW A;  3GN5 A;  2X9Y A;  3L3P A;  5HAX A;  1U4Q A;  5CGM A;  1BR0 A;  2UUB T;  2F4V T;  1KNP A;  3RX6 A;  2VQF T;  3P5M A;  5LBQ B;  2IC9 A;  3T1Y T;  5L4H A;  4DV6 T;  4UIG A;  4NUV A;  5L2L A;  4DBQ A;  3QK8 A;  3T8O A;  3Q9D A;  4X5T A;  4JWV A;  4IIJ E;  4B3T T;  3PU8 A;  2XQ7 A;  3AE2 A;  2MAW A;  3HI2 A;  2ODU A;  2A72 A;  2XJ7 A;  5JDQ A;  3PU3 A;  4P09 A;  4LF4 T;  1OXZ A;  3TLU A;  1JNR A;  5DAB A;  4IZB A;  4O4J E;  5JH7 E;  1YQ3 A;  3F57 A;  4JOT A;  3EUH A;  4KBM B;  2E9X C;  3NZP A;  4DV4 T;  4PFP A;  5LHI B;  2DUB A;  2ZQQ A;  2CA5 A;  4U2Y A;  4YSX A;  3PDY A;  2VAS A;  2LEH A;  4QXH B;  2UUA T;  4DV3 T;  5LJN A;  4IZC A;  4GYS A;  2H7O A;  2I0M A;  4YTN A;  2ZQR A;  4PNI A;  2D2S A;  4AKR B;  1IJ6 A;  3A7M A;  3VU7 H;  4JFC A;  4KP3 C;  4IGU A;  3PUW F;  3V5U A;  3LBX A;  4I55 E;  2KMF A;  1XWM A;  2F6Q A;  2XAJ B;  2JQQ A;  1XMQ T;  3W8H B;  4AIS A;  1YXR A;  1FMW A;  2V7J A;  3C4X A;  3QOF A;  4LF8 T;  4DV2 T;  4JCS A;  2Q9Q C;  1HZD A;  3ZMT B;  1UX4 A;  5AQI B;  2YDS A;  2CXD A;  4KHZ F;  3PUX F;  2EHO B;  4LMK A;  4U74 A;  5AQM B;  3ZLI A;  2FW2 A;  3QNU A;  4IE0 A;  5FMN A;  3VKG A;  4A97 A;  1WYC A;  3B5M A;  2GTR A;  3SRZ A;  4JYA T;  3VR9 A;  2CWO A;  2E2A A;  2VKJ A;  3K1S A;  3RKG A;  4DV7 T;  2CE7 A;  2N2N A;  5JRC B;  3G06 A;  3KV6 A;  3L09 A;  3Q5W A;  5AFU L;  3DP7 A;  4P0A A;  2KXP B;  2YIN A;  3OYX A;  3RQF A;  2V7M A;  3N5L A;  5AQV B;  2J62 A;  4H63 H;  1BR4 A;  3ZMU B;  4ZI2 D;  4FJW D;  5LG3 A;  2WP9 A;  4E7Z A;  3R9T A;  3SS1 A;  5M4Y A;  5FY0 A;  4UVA B;  2X66 A;  3KVA A;  3W15 B;  4I52 A;  4GIW A;  4H9N C;  5HCJ A;  1HX1 B;  4IHJ E;  2KLQ A;  2EHO A;  3UU5 A;  2YK0 A;  5JDF A;  2NTX A;  4KUM B;  3RKO A;  1HS7 A;  4KX6 A;  3CWZ B;  3G64 A;  3HRX A;  2E9X D;  1HNZ T;  2RPA A;  4DVD A;  4AI6 A;  3EAB A;  5LP6 E;  1CUN A;  2ZM0 A;  2DL1 A;  2OV9 A;  3VKH A;  4HN9 A;  5L3B B;  4PAG A;  2QQ3 A;  2FJB A;  4NXM T;  4HFC A;  4X1I E;  3O1J A;  2UXB T;  4OLQ A;  4I0U A;  3S4U A;  2WZI A;  2K48 A;  2HN1 A;  3UFE A;  3O1H A;  3AED A;  2DWK A;  4EED A;  2KZ7 B;  3JCF A;  3RIA A;  4NIQ A;  5LCY A;  2NWB A;  4EEB A;  2SPC A;  4K0U A;  3M65 A;  4UV9 B;  5JDL A;  2E9X B;  2XQA A;  1VCS A;  1S94 A;  5L4E A;  5KX5 E;  2K5B B;  4CQI A;  2LSG A;  4H63 V;  3I47 A;  3AM1 A;  2E5V A;  1W9R A;  4ZZB A;  1XZY A;  3K3O A;  2CCQ A;  2G0U A;  4H9P C;  2XQ8 A;  3O4X E;  2PJQ A;  3HKD E;  4ERR A;  4O4I E;  4YJ2 E;  3RH3 A;  4HKA A;  4QH5 A;  3RI5 A;  4FZW C;  2LT3 A;  1D0X A;  4U33 A;  3OJA A;  5DJQ C;  5ABH A;  3IEE A;  2WDV A;  3ZYM A;  2DWG A;  3ONL C;  1JXZ A;  1HX8 A;  2HPL A;  4JUY A;  2IUB A;  2CPT A;  4JLE A;  4LML A;  1WR6 A;  2NP9 A;  5HEJ A;  4MLK A;  1ZV4 X;  2V5C A;  2V6Y A;  4QKN A;  2EJ5 A;  3GN5 B;  1MMN A;  2X9H A;  2WBL A;  2CMR A;  3AA1 B;  4IL4 A;  2E9X A;  3ESL A;  4JYL A;  3CX8 B;  4DR7 T;  5CB4 E;  3OTO T;  3HA4 A;  4AQF A;  2RP4 A;  2XY8 B;  5FL1 A;  5EK4 A;  3U3I A;  2FJA A;  3AA6 B;  2WY2 A;  3PJA J;  3AE9 A;  4GK5 E;  3HIN A;  4H9R C;  3AEC A;  1SUM B;  3BQL A;  4KHP T;  1B7T A;  3ZKR A;  5AQK B;  1EF9 A;  3L39 A;  2X51 A;  1N32 T;  1VOM A;  3LBX B;  1D0Z A;  5L3E B;  4X64 T;  2W4X A;  4IZD A;  3NRX A;  4JI8 T;  4NEK A;  2LSY A;  4YFS A;  2LM9 A;  1N36 T;  3ZN0 B;  4LF5 T;  3P50 A;  2WAU A;  2X68 A;  3PUR A;  4MFR A;  2WDQ A;  4JEH B;  2XM1 A;  2E8I A;  5J2T E;  3UUN A;  3ONJ A;  3I9W A;  2BBJ A;  2WZH A;  2VWA A;  4ZXL A;  3C64 A;  3ZEF B; 
#chains in the Genus database with same CATH homology
 5L2L A;  3RRW A;  4CXY A;  5ETW A;  4DBQ A;  3FBL A;  4UVB B;  2DLR A;  2XAF B;  2UXX B;  1IZN B;  2X67 A;  3MK7 C;  2OA5 A;  1D0Y A;  4O4H E;  3T8O A;  3Q9D A;  1BR2 A;  3ZJ2 A;  3AAE B;  2JJ9 A;  5FY7 A;  5LHH B;  4TV9 E;  4IIJ E;  3IBP A;  2XAQ B;  3KV9 A;  4ZI3 D;  3C4Z A;  4DMV A;  3RYI E;  3RYH E;  3PU8 A;  2IC6 A;  3HI2 A;  2ODU A;  5KDM C;  3CML A;  4ZS2 A;  5TAO A;  1QSD A;  2A72 A;  4ASK A;  1S35 A;  5JRE A;  1YKH B;  3QC9 A;  4AKL A;  5JDQ A;  2NW7 A;  3PU3 A;  2PG8 A;  3LK4 2;  4X1Y E;  4P09 A;  2N9D A;  1SHZ C;  1U5P A;  1OXZ A;  4QWN B;  5DQW A;  2LJL A;  1MIW A;  3ZCJ A;  3RC8 A;  5DAB A;  5JH7 E;  4O4J E;  3L8I A;  5A1L A;  3AAI A;  4PK5 A;  2X9X A;  3F57 A;  4EB6 E;  4PW8 A;  3EUH A;  3Q5X A;  4ANJ A;  3EDV A;  3NRY A;  4UF0 A;  4WNK A;  3RQE A;  4KBM B;  2E9X C;  2Y6X A;  2V7L A;  2X9W A;  3CQX C;  2LSI A;  3NZP A;  4PFP A;  5JR9 C;  4QHO A;  5LHI B;  3P8C D;  3N2G E;  1Y64 B;  3J7Y q;  4PFO A;  3RYC E;  2B1E A;  4CI3 B;  5HXR A;  1YKE B;  3UUX B;  4DBR A;  2CA5 A;  2W61 A;  2H3R A;  1WLX A;  3LK3 B;  4Z8X A;  3N9O A;  4BJN A;  2P63 A;  2N1G A;  4KMC A;  3PUS A;  4CI2 B;  4EYY R;  4NNQ A;  3PDY A;  5HWY A;  3MKD A;  2CEA A;  2VAS A;  2Z6E A;  5L3F B;  4QX7 B;  2LEH A;  4OHF A;  1D1A A;  4QXH B;  5JDN A;  3WAK A;  5LJN A;  4O4L E;  4GYS A;  2LSK A;  2H7O A;  4AQF C;  3KV4 A;  4QX8 B;  3H37 A;  1V9D A;  4PJJ A;  4HEA A;  2VK9 A;  2BVL A;  3OKQ A;  3OBV E;  3O9X A;  2RA1 A;  2H7V C;  5HYA A;  4XZC A;  4PNI A;  4H9S E;  4AKG A;  3ZJ1 A;  2VB6 A;  2D2S A;  3ADC A;  2D0T A;  3I0O A;  4AKR B;  1MND A;  3WI3 A;  3ZMS B;  1MMG A;  3F31 A;  4HFV A;  1IJ6 A;  4IE6 A;  3VU7 H;  3EVY A;  2NTY A;  4KP3 C;  4IGU A;  4UEM A;  3RPU A;  4P0B A;  1HG5 A;  4TV8 E;  3V5U A;  5KMG P;  2C5J A;  3IF8 B;  3BQI A;  3LBX A;  4I55 E;  2KMF A;  4GYR A;  5H6R B;  3GWH A;  3L8J A;  3PTR B;  5J2U E;  2XAJ B;  2Q9Q A;  2XUE A;  5CA0 E;  5LXT E;  2JQQ A;  2Q9Q B;  3W8H B;  4AKI A;  2CXF A;  1FMW A;  5H6Q B;  2V7J A;  3C4X A;  1KK7 A;  3FHN A;  2QA7 A;  3IRB A;  3I0Q A;  4G63 A;  4UEL A;  2Q9Q C;  4XAX B;  4ILU A;  3ZMT B;  4CI1 B;  1UX4 A;  2Y8D A;  4TUY E;  4EYU A;  3AA0 B;  2KWI B;  2YU2 A;  1G8X A;  3AA7 B;  2CXD A;  4JEU B;  1KNZ A;  4MBQ A;  3N2K E;  2CLY C;  3H3A A;  5C8Y E;  3F2E A;  4H9O C;  2LOP A;  1IAP A;  5J1G A;  3HR0 A;  1X79 A;  2WWU A;  2NOX A;  3I1A A;  3CVR A;  2V1D B;  2XHE B;  2EHO B;  3AVR A;  2A3D A;  4OFZ A;  4U74 A;  3PUQ A;  3D0T A;  2VKO A;  2C5K T;  1E1H B;  2YU1 A;  1MNE A;  4I4T E;  3ZLI A;  3HL6 A;  3LJC A;  4PJM A;  4E7S A;  1SA0 E;  1MIV A;  4L9I A;  4IE0 A;  5FMN A;  3VKG A;  1WYC A;  2K24 A;  2WMN A;  3QK6 A;  4UVC B;  3SRZ A;  5JDH A;  1RJM A;  2MYS A;  3AVS A;  2ZLY A;  5BMV E;  4ADZ A;  2M67 A;  4UV8 B;  4IDZ A;  2CWO A;  5LHG B;  2LOS A;  3QUJ A;  1VRB A;  4HE8 A;  2VKJ A;  3C4W A;  3GA8 A;  3PUG A;  2ACX A;  3N9Q A;  2LSJ A;  2CE7 A;  2N2N A;  5JRC B;  5HXS A;  3KV6 A;  3L09 A;  3Q5W A;  4WW0 A;  5AFU L;  5LNK A;  4YLH A;  2EHO D;  5JRC A;  2C5I T;  3DP7 A;  4WBN E;  4P0A A;  2KXP B;  3C50 A;  5FP3 A;  2YIN A;  3OYX A;  3RQF A;  5LJM A;  2V7M A;  1LRZ A;  3N5L A;  4YJ3 E;  3KBT A;  4H63 H;  1BR4 A;  3ZMU B;  4ZI2 D;  3ZC0 A;  1ZEE A;  2V7K A;  4L0R A;  4E7Z A;  3SS1 A;  3KVB A;  5M4Y A;  3N9P A;  4ZS3 A;  5L3D B;  4X20 E;  4G2A A;  4I43 B;  3BK9 A;  3Q2M A;  5FY0 A;  4UVA B;  2X66 A;  3KVA A;  3W15 B;  5EK3 A;  5LGU B;  4GIW A;  4H9N C;  2A2F X;  4V1A v;  5IHY A;  3PUA A;  4IHJ E;  4TX5 A;  2XQY A;  1YW0 A;  2I59 A;  3CPZ A;  3GMI A;  1EZ3 A;  2ZM8 A;  3ANW B;  5JR9 B;  3RQG A;  2KLQ A;  2J1D G;  2EHO A;  3DTO A;  2V26 A;  3EDU A;  2BVM A;  4CXX A;  2CXL A;  4EXT A;  5LGN B;  1FIO A;  1UX5 A;  3BQK A;  1MMA A;  3A5X A;  2EHO C;  5FXW A;  2XAG B;  2LHN A;  2YK0 A;  2WSS V;  5JDF A;  1NAF A;  2NTX A;  4KUM B;  3RKO A;  1LVK A;  1HFA A;  1HS7 A;  2XAS B;  3CWZ B;  3CKD A;  2X0L B;  4MAL A;  3MAC A;  2E9X D;  3CQG B;  3K3N A;  1HTJ F;  4WBO A;  2HPJ A;  3MA9 A;  2XAH B;  4DVD A;  5LBM A;  2W62 A;  4OK0 A;  4U72 A;  4AI6 A;  2W0G A;  5LP6 E;  2JMK A;  5FXV A;  2DI4 A;  1BR1 A;  2QGS A;  1CUN A;  4YHJ A;  2ZM0 A;  3VKH A;  2PBI A;  2CLY B;  4ZI7 E;  1IJ5 A;  4HN9 A;  2W63 A;  4TN7 B;  5L3B B;  4PAG A;  4IE4 A;  4C90 A;  3FXD B;  3ADD A;  3N9N A;  4X1I E;  5F3J A;  3LFM A;  1ZHC A;  3A4N A;  3O1J A;  4PJN A;  4OYK A;  2KND A;  3RRC A;  2ES0 A;  3K8P C;  3S4U A;  1MMD A;  1O3X A;  2HH7 A;  2K48 A;  4AKH A;  3K3Q C;  4EZ4 A;  3ADB A;  3VHL A;  3CX7 B;  3KDS E;  5LG4 A;  3UFE A;  3O1H A;  3UUM A;  5HXC A;  4BJM A;  5L3G B;  2DWK A;  5JVD E;  3P7I A;  4GEH B;  5L3C B;  4AXP A;  3HKC E;  3NBX X;  2KZ7 B;  3LK2 B;  3E08 A;  1AJ3 A;  3FB2 A;  1YD8 G;  3KBU A;  1UCU A;  4PK4 A;  5LCY A;  2LHR A;  1D1C A;  3JC6 C;  2NWB A;  5HWX A;  2VKH A;  2SPC A;  5LYJ E;  1T98 A;  4K0U A;  5HXH A;  4HTE A;  3M65 A;  3SOL A;  2KT9 A;  2VKD A;  4UV9 B;  2XTL A;  5JDL A;  2E9X B;  5FYM A;  2NW9 A;  3R84 B;  3U78 A;  3HKE E;  4BAY B;  2K9A A;  1S94 A;  3ZMZ B;  5DQV A;  2JRK A;  4XBF B;  5KX5 E;  3N9M A;  3MZK B;  2K5B B;  4CQI A;  2LSG A;  4H63 V;  3W8I B;  3AM1 A;  2W00 A;  3B13 A;  4IE5 A;  2V7I A;  2PFV A;  3K3O A;  3UT5 E;  3ETV A;  2CCQ A;  2G0U A;  4H9P C;  4IST A;  3O4X E;  3KV5 A;  1WRD A;  3ANW A;  2L8K A;  5JR9 A;  3NZQ A;  2BDE A;  3I9Y A;  2PJQ A;  3HKD E;  4ERR A;  4NUU A;  3V5S A;  4O4I E;  3RYF E;  4YJ2 E;  3RH3 A;  1G73 A;  4HKA A;  3OYZ A;  4PJL A;  5LOV E;  3A4L A;  2LT3 A;  3AJM A;  1US7 B;  1D0X A;  4DO0 A;  4UXN B;  4F6R C;  3JC6 D;  4DND A;  2D5U A;  2JMH A;  5FXX A;  2NW8 A;  3OJA A;  3FXE B;  5DJQ C;  2KWH A;  2ODV A;  3KFW X;  3MXZ A;  4IE7 A;  5F8P A;  5GON E;  3IEE A;  3LG7 A;  3TKL B;  4EIW A;  2L3L A;  3ZYM A;  2DWG A;  3AAA B;  3N9L A;  1HX8 A;  2HPL A;  4JUY A;  2MTQ A;  3J9X 1;  3ZYK A;  4JLE A;  5JDG A;  2GK9 A;  1WR6 A;  2NP9 A;  3RC3 A;  5FY1 A;  2YEV C;  1ZV4 X;  4MLK A;  4O2B E;  2UXN B;  4CZZ B;  4EAH A;  5JDM A;  5HXE A;  3UTK A;  2ZM2 A;  4ISS A;  4AQG A;  4QKN A;  3GN5 B;  1MMN A;  1ZKE A;  2X9H A;  2DHR A;  2P9B A;  3KIN B;  2WBL A;  4ZOL E;  2CMR A;  4O8S A;  3AA1 B;  2DNX A;  2E9X A;  1LKX A;  3ESL A;  2CM0 A;  3SWH A;  1Z0P A;  1WYB A;  4ZI2 C;  3CX8 B;  3O1I A;  3PE0 A;  2VL8 A;  3E22 E;  3DJB A;  3R6N A;  5CB4 E;  1D1B A;  4A56 A;  4HGA A;  2IAK A;  3HA4 A;  4FJO A;  4AQF A;  2RP4 A;  5E0O A;  2KIN B;  1LVF A;  5EK4 A;  2C0S A;  4ZI3 C;  3U3I A;  5FXZ A;  4C91 A;  3AA6 B;  5LGT B;  3C98 B;  5EK2 A;  1NWM X;  2BZB A;  2CWY A;  4GK5 E;  4EOZ B;  2LE8 A;  2MBG A;  4MHC A;  4BA9 A;  4H9R C;  2JPF A;  3BQL A;  5EZY E;  1B7T A;  1QUU A;  3FBZ A;  4GOU A;  4ZHQ E;  4EZH A;  3ETU A;  4O2A E;  4X1K E;  3MJX A;  2X51 A;  1HCI A;  4FI5 A;  3ZN1 B;  4L5G A;  4OYJ A;  5LA6 E;  5FNV E;  3ZMV B;  3UUL A;  4J2C A;  1HF8 A;  2L9Q A;  3ZC1 A;  3WAJ A;  2WM9 A;  1H7C A;  1VOM A;  1MIY A;  1FMV A;  2DCF A;  3E0Z A;  4TZ4 C;  3LBX B;  3IHR A;  1D0Z A;  5L3E B;  1HG2 A;  3HKB E;  2ZMA A;  3NRX A;  4N78 D;  2D0U A;  3ONX A;  2LSY A;  2IW5 B;  2Q9Q D;  3B57 A;  1FEW A;  4QXB B;  3ZCI A;  4YFS A;  2WMO A;  3GN5 A;  4UF0 B;  2X9Y A;  3L3P A;  5JQG E;  4M1P A;  5HAX A;  4H9Q C;  5CA1 E;  1U4Q A;  1BR0 A;  2LM9 A;  4B6X A;  4DMW A;  5ADX L;  3ZN0 B;  4CXW A;  3ZYL A;  2Y48 B;  3RX6 A;  3AB3 B;  2WAU A;  3N2O A;  2X68 A;  3PUR A;  4PK6 A;  1OWA A;  3CX6 B;  4MFR A;  5LBQ B;  3CQC B;  2IC9 A;  4GK0 E;  3ZPO A;  4JEH B;  3A4M A;  4I50 E;  2MOZ A;  2E8I A;  5J2T E;  4QXC B;  3UUN A;  3C51 A;  3I9W A;  5IYZ E;  4UIG A;  2VWA A;  4NUV A;  3C64 A;  3ZEF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...