1MJ3A

Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
258
Chain Sequence
b'ANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-COA HYDRATASE, MITOCHONDRIAL
publication title Stereoselectivity of Enoyl-CoA Hydratase Results from Preferential Activation of One of Two Bound Substrate Conformers
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
total genus 87
structure length 258
sequence length 260
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2002-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1mj3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1mj3A01
3V5EA 4ELSA 1FC9A 1WZ8A 3BEZA 3H81A 1YG8A 4IZBA 3H0SA 4FN7A 3FDUA 3OT6A 1HNUA 2VSUC 1FC7A 1UYRA 5FUSA 3TZ3A 3IBBA 3BF0A 3P85A 2FW2A 1SZOA 4U1AA 3T88A 4JVTA 4IZCA 1PJHA 3ST9A 4ASIA 2CBYA 5DKPA 5JBXA 2NP9A 4RYFH 3TRRA 2Q2XA 3HP0A 2W3PA 4JSBA 3OC7A 2BZRA 1UYVA 1EF8A 2VSSA 5DL1A 1YG6A 3GMAA 3P5MA 4HNKA 2EJ5A 3R9QA 3OMEA 3G64A 5E0SA 4EMPA 2PBPA 4FNDA 1FC6A 3MFMA 2IEXA 3ZW9A 4K2NA 3U9TB 2VSUA 3M6NA 4ZDEA 2DEOA 5KJPA 4JCQA 2WTBA 5DZKA 1OD2A 1XO6A 3TT7A 5C90A 2ZL0A 3QWDA 5DU6A 2QQ3A 1SG4A 3DORA 1XX4A 3M6MA 3TT6A 3R9TA 3T3WA 4HC8A 4QIIA 2FBMA 4JYLA 5KDRA 3PZKA 3U9RB 3R0OA 2CE3A 4EMLA 1MJ3A 1NZYA 3N6RB 3K50A 4RCNA 5CTBA 3SLLA 3U9SB 2VSUF 4QIJA 3KTIA 3ISAA 3MT6A 3PGQA 4FB8A 1UYSA 4OLQA 2A7KA 1W2XA 1WDMA 2VREA 3TV5A 5G1QA 3QXZA 4NEKA 5E0NX 4JJTA 3PE8A 2ZL2A 1ON3A 4B3IA 3Q7HA 1EY3A 4I52A 3V5IA 2PPYA 1RJMA 3KTGA 3I47A 3IB9A 2PG8A 4ELXA 2F6IA 3HRXA 2J5IA 4ZDCA 3RSTA 1WDLA 2J5GA 1OD4A 3R6HA 3PEAA 3HE2A 3STAA 1UYTA 3TVWA 3H0UA 2VX2A 3H0QA 4U0GA 3NJBA 2A81A 1WDKA 1J7XA 5DTPA 3Q0GA 3VIVA 2F6QA 4KD6A 3P2LA 1UIYA 2ZQQA 1X0UA 3JU1A 3QK8A 2ZQRA 4MXIA 2X58A 2HW5A 2J5SA 3BPPA 4ZDFA 4FN8A 1RJNA 5E0SH 5DUCA 4ELWA 4DI1A 3ZWCA 4WYOB 1TYFA 1FCFA 5KDRB 4JYJA 2C8TA 2VSSF 1NZYB 3ZW8A 4KNPA 1VRGA 5INGA 3H02A 5DZKH 3L3SA 3LKEA 2F9YA 3KQFA 5DUFA 4GHNA 3TLFA 4U19A 1XNYA 3GLMA 3H0JA 1N6EA 4FNBA 2F9IA 5INIA 4F47A 4OMRA 1K39A 4B3JA 2ZL4A 4L8KA 1XNWA 1N6FA 3MOYA 5MGBA 3KTJA 3GKBA 2J5IB 3FF6A 1TG6A 3GF7A 4GM2A 1HZDA 4MOUA 3LAOA 3QKAA 3HLN1 1ON9A 1HNOA 3HINA 4K29A 4WCZA 3RSIA 1Q51A 4KWBA 4B3HA 4ZDBA 3QYRA 4ZU2A 3QMJA 4RYFA 3ZWAA 3TDCA 4Z0MA 4WZ8B 3R9SA 1EF9A 5G1SA 3MYBA 3T89A 2X24A 1N6DA 2A7SA 3SWXA 4U0GH 4Q0GA 5INFA 5IKLB 1Q52A 4JWVA 5DU8A 2UZFA 4JCSA 2Q35A 4U0HA 4K3WA 5C9GA 1JXZA 5JBWA 3QREA 3GF3A 3Q0JA 2D3TA 5FIFA 3K8XA 4I42A 2VSSE 2Q34A 2F9YB 4JFCA 2J5GD 4FZWC 4KPKA 3NJDA 4JCRA 2FZSA 3KTKA 2ZL3A 3WG5A 4EMMA 2F9IB 3QXIA 5DTWA 4YLHA 3TVUA 4OG1A 3DJAA 4G2RA 2VSUE 4I4ZA 5CTCA 4L6WA 4JOTA 4Q1IA 3KTHA 3T8BA 3IAVA 3T8AA 3ZWBA 3RRVA 1K32A 4NNQA 4U18A 4ZDDA 3Q1TA 4MI2A 1O8UA 4JCTA 2GTRA 1XNVA 1DUBA 4FJWD 1DCIA 4LK5A 1PIXA 5G1RA 4QFEA 5DU4A 4IZDA 2DUBA 4FZWA 2J5II 1Y7OA
chains in the Genus database with same CATH superfamily
3V5EA 4ELSA 1FC9A 1WZ8A 3BEZA 3H81A 1YG8A 4IZBA 3H0SA 4FN7A 3FDUA 3OT6A 1HNUA 2VSUC 1FC7A 1UYRA 5FUSA 3TZ3A 3IBBA 3BF0A 3P85A 2FW2A 3ADDA 1SZOA 1UX5A 4U1AA 3T88A 4JVTA 4IZCA 1PJHA 3ST9A 4ASIA 2CBYA 5DKPA 5JBXA 2NP9A 4RYFH 3TRRA 2Q2XA 3HP0A 2W3PA 3L8JA 3ADBA 4JSBA 3OC7A 2BZRA 3O4XE 1UYVA 1EF8A 2VSSA 5DL1A 1YG6A 3GMAA 3P5MA 3RQFA 4HNKA 2EJ5A 3R9QA 3OMEA 3G64A 5E0SA 3ADCA 4EMPA 2PBPA 4FNDA 1FC6A 3MFMA 2IEXA 3ZW9A 4K2NA 3U9TB 2VSUA 3M6NA 4ZDEA 2DEOA 3A4LA 5KJPA 4JCQA 2WTBA 5DZKA 1OD2A 1XO6A 3TT7A 5C90A 2ZL0A 3QWDA 5DU6A 2QQ3A 1SG4A 3DORA 1XX4A 3M6MA 3TT6A 3R9TA 3T3WA 4HC8A 4QIIA 2FBMA 4JYLA 5KDRA 4NARA 3L8IA 3PZKA 3U9RB 3A4MA 3R0OA 2CE3A 4EMLA 1MJ3A 1NZYA 3N6RB 3K50A 4RCNA 5CTBA 3SLLA 3U9SB 2VSUF 4QIJA 3KTIA 3ISAA 3MT6A 3PGQA 4FB8A 1UYSA 4OLQA 2A7KA 2P63A 1W2XA 1WDMA 2VREA 3TV5A 5G1QA 3QXZA 4NEKA 5E0NX 4JJTA 3PE8A 2ZL2A 1ON3A 4B3IA 3Q7HA 1EY3A 4I52A 3V5IA 2PPYA 1RJMA 3KTGA 3I47A 3W8HB 3IB9A 2PG8A 4ELXA 2F6IA 3IRBA 3HRXA 2J5IA 4ZDCA 3RSTA 2YJGA 1WDLA 2J5GA 1OD4A 3R6HA 3PEAA 3HE2A 3STAA 1UYTA 3TVWA 3H0UA 2VX2A 3H0QA 4U0GA 3NJBA 2A81A 1WDKA 1J7XA 4J2UA 5DTPA 3Q0GA 3VIVA 2F6QA 4KD6A 3P2LA 1UIYA 2ZQQA 1X0UA 3JU1A 3QK8A 4GEHB 2ZQRA 4MXIA 2X58A 2HW5A 2J5SA 3BPPA 4ZDFA 4FN8A 3BPTA 1RJNA 5E0SH 5DUCA 4ELWA 4DI1A 3ZWCA 4WYOB 1TYFA 1FCFA 5KDRB 4JYJA 2C8TA 3A4NA 3RQGA 2VSSF 1NZYB 3ZW8A 4KNPA 1VRGA 5INGA 3H02A 5DZKH 3L3SA 3LKEA 2F9YA 3KQFA 5DUFA 4GHNA 3TLFA 4U19A 1XNYA 3GLMA 3H0JA 1N6EA 4FNBA 2F9IA 5INIA 4F47A 4OMRA 1K39A 4B3JA 2ZL4A 4L8KA 1XNWA 1N6FA 3MOYA 5MGBA 3KTJA 3GKBA 3W8IB 2J5IB 3FF6A 1TG6A 3GF7A 4GM2A 1HZDA 4MOUA 3AM1A 3LAOA 3QKAA 3HLN1 1ON9A 1HNOA 3HINA 4K29A 4WCZA 3RSIA 1Q51A 4KWBA 4B3HA 4ZDBA 3QYRA 4ZU2A 3QMJA 4RYFA 3ZWAA 3TDCA 4Z0MA 4WZ8B 3R9SA 1EF9A 5G1SA 3MYBA 3T89A 2X24A 1N6DA 2A7SA 3SWXA 4U0GH 4Q0GA 5INFA 5IKLB 1Q52A 4JWVA 5DU8A 1UX4A 2UZFA 4JCSA 2Q35A 4U0HA 4K3WA 5C9GA 1JXZA 3QREA 5JBWA 3GF3A 3Q0JA 2D3TA 5FIFA 3K8XA 4I42A 2VSSE 2Q34A 2F9YB 4JFCA 2J5GD 4FZWC 4KPKA 3NJDA 4JCRA 2FZSA 3KTKA 2ZL3A 3WG5A 4EMMA 2F9IB 3QXIA 5DTWA 5HUQA 4YLHA 3TVUA 4OG1A 3DJAA 4G2RA 2VSUE 4I4ZA 5CTCA 4L6WA 4JOTA 4Q1IA 3KTHA 3T8BA 3RQEA 3IAVA 3T8AA 3ZWBA 3RRVA 3AJMA 1K32A 4NNQA 4U18A 4ZDDA 3Q1TA 4MI2A 1O8UA 4JCTA 2GTRA 1XNVA 1DUBA 4FJWD 1DCIA 4LK5A 1PIXA 5G1RA 4QFEA 4HDTA 1Y64B 5DU4A 4IZDA 2DUBA 4FZWA 2J5II 1Y7OA
chains in the Genus database with same CATH topology
3V5EA 4ELSA 1FC9A 1WZ8A 3BEZA 3H81A 1YG8A 4IZBA 3H0SA 4FN7A 3FDUA 3OT6A 1HNUA 2VSUC 1FC7A 1UYRA 5FUSA 3TZ3A 3IBBA 3BF0A 3P85A 2FW2A 1SZOA 4U1AA 3T88A 4JVTA 4IZCA 1PJHA 3ST9A 4ASIA 2CBYA 5DKPA 5JBXA 2NP9A 4RYFH 3TRRA 2Q2XA 3HP0A 2W3PA 4JSBA 3OC7A 2BZRA 1UYVA 1EF8A 2VSSA 5DL1A 1YG6A 3GMAA 3P5MA 4HNKA 2EJ5A 3R9QA 3OMEA 3G64A 5E0SA 4EMPA 2PBPA 4FNDA 1FC6A 3MFMA 2IEXA 3ZW9A 4K2NA 3U9TB 2VSUA 3M6NA 4ZDEA 2DEOA 5KJPA 4JCQA 2WTBA 5DZKA 1OD2A 1XO6A 3TT7A 5C90A 2ZL0A 3QWDA 5DU6A 2QQ3A 1SG4A 3DORA 1XX4A 3M6MA 3TT6A 3R9TA 3T3WA 4HC8A 4QIIA 2FBMA 4JYLA 5KDRA 4NARA 3PZKA 3U9RB 3R0OA 2CE3A 4EMLA 1MJ3A 1NZYA 3N6RB 3K50A 4RCNA 5CTBA 3SLLA 3U9SB 2VSUF 4QIJA 3KTIA 3ISAA 3MT6A 3PGQA 4FB8A 1UYSA 4OLQA 2A7KA 1W2XA 1WDMA 2VREA 3TV5A 5G1QA 3QXZA 4NEKA 5E0NX 4JJTA 3PE8A 2ZL2A 1ON3A 4B3IA 3Q7HA 1EY3A 4I52A 3V5IA 2PPYA 1RJMA 3KTGA 3I47A 3IB9A 2PG8A 4ELXA 2F6IA 3HRXA 2J5IA 4ZDCA 3RSTA 2YJGA 1WDLA 2J5GA 1OD4A 3R6HA 3PEAA 3HE2A 3STAA 1UYTA 3TVWA 3H0UA 2VX2A 3H0QA 4U0GA 3NJBA 2A81A 1WDKA 1J7XA 4J2UA 5DTPA 3Q0GA 3VIVA 2F6QA 4KD6A 3P2LA 1UIYA 2ZQQA 1X0UA 3JU1A 3QK8A 2ZQRA 4MXIA 2X58A 2HW5A 2J5SA 3BPPA 4ZDFA 4FN8A 3BPTA 1RJNA 5E0SH 5DUCA 4ELWA 4DI1A 3ZWCA 4WYOB 1TYFA 1FCFA 5KDRB 4JYJA 2C8TA 2VSSF 1NZYB 3ZW8A 4KNPA 1VRGA 5INGA 3H02A 5DZKH 3L3SA 3LKEA 2F9YA 3KQFA 5DUFA 4GHNA 3TLFA 4U19A 1XNYA 3GLMA 3H0JA 1N6EA 4FNBA 2F9IA 5INIA 4F47A 4OMRA 1K39A 4B3JA 2ZL4A 4L8KA 1XNWA 1N6FA 3MOYA 5MGBA 3KTJA 3GKBA 2J5IB 3FF6A 1TG6A 3GF7A 4GM2A 1HZDA 4MOUA 3LAOA 3QKAA 3HLN1 1ON9A 1HNOA 3HINA 4K29A 4WCZA 3RSIA 1Q51A 4KWBA 4B3HA 4ZDBA 3QYRA 4ZU2A 3QMJA 4RYFA 3ZWAA 3TDCA 4Z0MA 4WZ8B 3R9SA 1EF9A 5G1SA 3MYBA 3T89A 2X24A 1N6DA 2A7SA 3SWXA 4U0GH 4Q0GA 5INFA 5IKLB 1Q52A 4JWVA 5DU8A 2UZFA 4JCSA 2Q35A 4U0HA 4K3WA 5C9GA 1JXZA 5JBWA 3QREA 3GF3A 3Q0JA 2D3TA 5FIFA 3K8XA 4I42A 2VSSE 2Q34A 2F9YB 4JFCA 2J5GD 4FZWC 4KPKA 3NJDA 4JCRA 2FZSA 3KTKA 2ZL3A 3WG5A 4EMMA 2F9IB 3QXIA 5DTWA 5HUQA 4YLHA 3TVUA 4OG1A 3DJAA 4G2RA 2VSUE 4I4ZA 5CTCA 4L6WA 4JOTA 4Q1IA 3KTHA 3T8BA 3IAVA 3T8AA 3ZWBA 3RRVA 1K32A 4NNQA 4U18A 4ZDDA 3Q1TA 4MI2A 1O8UA 4JCTA 2GTRA 1XNVA 1DUBA 4FJWD 1DCIA 4LK5A 1PIXA 5G1RA 4QFEA 4HDTA 5DU4A 4IZDA 2DUBA 4FZWA 2J5II 1Y7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5E A;  4ELS A;  1FC9 A;  1WZ8 A;  3BEZ A;  3H81 A;  1YG8 A;  4IZB A;  3H0S A;  4FN7 A;  3FDU A;  3OT6 A;  1HNU A;  2VSU C;  1FC7 A;  1UYR A;  5FUS A;  3TZ3 A;  3IBB A;  3BF0 A;  3P85 A;  2FW2 A;  1SZO A;  4U1A A;  3T88 A;  4JVT A;  4IZC A;  1PJH A;  3ST9 A;  4ASI A;  2CBY A;  5DKP A;  5JBX A;  2NP9 A;  4RYF H;  3TRR A;  2Q2X A;  3HP0 A;  2W3P A;  4JSB A;  3OC7 A;  2BZR A;  1UYV A;  1EF8 A;  2VSS A;  5DL1 A;  1YG6 A;  3GMA A;  3P5M A;  4HNK A;  2EJ5 A;  3R9Q A;  3OME A;  3G64 A;  5E0S A;  4EMP A;  2PBP A;  4FND A;  1FC6 A;  3MFM A;  2IEX A;  3ZW9 A;  4K2N A;  3U9T B;  2VSU A;  3M6N A;  4ZDE A;  2DEO A;  5KJP A;  4JCQ A;  2WTB A;  5DZK A;  1OD2 A;  1XO6 A;  3TT7 A;  5C90 A;  2ZL0 A;  3QWD A;  5DU6 A;  2QQ3 A;  1SG4 A;  3DOR A;  1XX4 A;  3M6M A;  3TT6 A;  3R9T A;  3T3W A;  4HC8 A;  4QII A;  2FBM A;  4JYL A;  5KDR A;  3PZK A;  3U9R B;  3R0O A;  2CE3 A;  4EML A;  1MJ3 A;  1NZY A;  3N6R B;  3K50 A;  4RCN A;  5CTB A;  3SLL A;  3U9S B;  2VSU F;  4QIJ A;  3KTI A;  3ISA A;  3MT6 A;  3PGQ A;  4FB8 A;  1UYS A;  4OLQ A;  2A7K A;  1W2X A;  1WDM A;  2VRE A;  3TV5 A;  5G1Q A;  3QXZ A;  4NEK A;  5E0N X;  4JJT A;  3PE8 A;  2ZL2 A;  1ON3 A;  4B3I A;  3Q7H A;  1EY3 A;  4I52 A;  3V5I A;  2PPY A;  1RJM A;  3KTG A;  3I47 A;  3IB9 A;  2PG8 A;  4ELX A;  2F6I A;  3HRX A;  2J5I A;  4ZDC A;  3RST A;  1WDL A;  2J5G A;  1OD4 A;  3R6H A;  3PEA A;  3HE2 A;  3STA A;  1UYT A;  3TVW A;  3H0U A;  2VX2 A;  3H0Q A;  4U0G A;  3NJB A;  2A81 A;  1WDK A;  1J7X A;  5DTP A;  3Q0G A;  3VIV A;  2F6Q A;  4KD6 A;  3P2L A;  1UIY A;  2ZQQ A;  1X0U A;  3JU1 A;  3QK8 A;  2ZQR A;  4MXI A;  2X58 A;  2HW5 A;  2J5S A;  3BPP A;  4ZDF A;  4FN8 A;  1RJN A;  5E0S H;  5DUC A;  4ELW A;  4DI1 A;  3ZWC A;  4WYO B;  1TYF A;  1FCF A;  5KDR B;  4JYJ A;  2C8T A;  2VSS F;  1NZY B;  3ZW8 A;  4KNP A;  1VRG A;  5ING A;  3H02 A;  5DZK H;  3L3S A;  3LKE A;  2F9Y A;  3KQF A;  5DUF A;  4GHN A;  3TLF A;  4U19 A;  1XNY A;  3GLM A;  3H0J A;  1N6E A;  4FNB A;  2F9I A;  5INI A;  4F47 A;  4OMR A;  1K39 A;  4B3J A;  2ZL4 A;  4L8K A;  1XNW A;  1N6F A;  3MOY A;  5MGB A;  3KTJ A;  3GKB A;  2J5I B;  3FF6 A;  1TG6 A;  3GF7 A;  4GM2 A;  1HZD A;  4MOU A;  3LAO A;  3QKA A;  3HLN 1;  1ON9 A;  1HNO A;  3HIN A;  4K29 A;  4WCZ A;  3RSI A;  1Q51 A;  4KWB A;  4B3H A;  4ZDB A;  3QYR A;  4ZU2 A;  3QMJ A;  4RYF A;  3ZWA A;  3TDC A;  4Z0M A;  4WZ8 B;  3R9S A;  1EF9 A;  5G1S A;  3MYB A;  3T89 A;  2X24 A;  1N6D A;  2A7S A;  3SWX A;  4U0G H;  4Q0G A;  5INF A;  5IKL B;  1Q52 A;  4JWV A;  5DU8 A;  2UZF A;  4JCS A;  2Q35 A;  4U0H A;  4K3W A;  5C9G A;  1JXZ A;  5JBW A;  3QRE A;  3GF3 A;  3Q0J A;  2D3T A;  5FIF A;  3K8X A;  4I42 A;  2VSS E;  2Q34 A;  2F9Y B;  4JFC A;  2J5G D;  4FZW C;  4KPK A;  3NJD A;  4JCR A;  2FZS A;  3KTK A;  2ZL3 A;  3WG5 A;  4EMM A;  2F9I B;  3QXI A;  5DTW A;  4YLH A;  3TVU A;  4OG1 A;  3DJA A;  4G2R A;  2VSU E;  4I4Z A;  5CTC A;  4L6W A;  4JOT A;  4Q1I A;  3KTH A;  3T8B A;  3IAV A;  3T8A A;  3ZWB A;  3RRV A;  1K32 A;  4NNQ A;  4U18 A;  4ZDD A;  3Q1T A;  4MI2 A;  1O8U A;  4JCT A;  2GTR A;  1XNV A;  1DUB A;  4FJW D;  1DCI A;  4LK5 A;  1PIX A;  5G1R A;  4QFE A;  5DU4 A;  4IZD A;  2DUB A;  4FZW A;  2J5I I;  1Y7O A; 
#chains in the Genus database with same CATH topology
 3V5E A;  4ELS A;  1FC9 A;  1WZ8 A;  3BEZ A;  3H81 A;  1YG8 A;  4IZB A;  3H0S A;  4FN7 A;  3FDU A;  3OT6 A;  1HNU A;  2VSU C;  1FC7 A;  1UYR A;  5FUS A;  3TZ3 A;  3IBB A;  3BF0 A;  3P85 A;  2FW2 A;  3ADD A;  1SZO A;  1UX5 A;  4U1A A;  3T88 A;  4JVT A;  4IZC A;  1PJH A;  3ST9 A;  4ASI A;  2CBY A;  5DKP A;  5JBX A;  2NP9 A;  4RYF H;  3TRR A;  2Q2X A;  3HP0 A;  2W3P A;  3L8J A;  3ADB A;  4JSB A;  3OC7 A;  2BZR A;  3O4X E;  1UYV A;  1EF8 A;  2VSS A;  5DL1 A;  1YG6 A;  3GMA A;  3P5M A;  3RQF A;  4HNK A;  2EJ5 A;  3R9Q A;  3OME A;  3G64 A;  5E0S A;  3ADC A;  4EMP A;  2PBP A;  4FND A;  1FC6 A;  3MFM A;  2IEX A;  3ZW9 A;  4K2N A;  3U9T B;  2VSU A;  3M6N A;  4ZDE A;  2DEO A;  3A4L A;  5KJP A;  4JCQ A;  2WTB A;  5DZK A;  1OD2 A;  1XO6 A;  3TT7 A;  5C90 A;  2ZL0 A;  3QWD A;  5DU6 A;  2QQ3 A;  1SG4 A;  3DOR A;  1XX4 A;  3M6M A;  3TT6 A;  3R9T A;  3T3W A;  4HC8 A;  4QII A;  2FBM A;  4JYL A;  5KDR A;  4NAR A;  3L8I A;  3PZK A;  3U9R B;  3A4M A;  3R0O A;  2CE3 A;  4EML A;  1MJ3 A;  1NZY A;  3N6R B;  3K50 A;  4RCN A;  5CTB A;  3SLL A;  3U9S B;  2VSU F;  4QIJ A;  3KTI A;  3ISA A;  3MT6 A;  3PGQ A;  4FB8 A;  1UYS A;  4OLQ A;  2A7K A;  2P63 A;  1W2X A;  1WDM A;  2VRE A;  3TV5 A;  5G1Q A;  3QXZ A;  4NEK A;  5E0N X;  4JJT A;  3PE8 A;  2ZL2 A;  1ON3 A;  4B3I A;  3Q7H A;  1EY3 A;  4I52 A;  3V5I A;  2PPY A;  1RJM A;  3KTG A;  3I47 A;  3W8H B;  3IB9 A;  2PG8 A;  4ELX A;  2F6I A;  3IRB A;  3HRX A;  2J5I A;  4ZDC A;  3RST A;  2YJG A;  1WDL A;  2J5G A;  1OD4 A;  3R6H A;  3PEA A;  3HE2 A;  3STA A;  1UYT A;  3TVW A;  3H0U A;  2VX2 A;  3H0Q A;  4U0G A;  3NJB A;  2A81 A;  1WDK A;  1J7X A;  4J2U A;  5DTP A;  3Q0G A;  3VIV A;  2F6Q A;  4KD6 A;  3P2L A;  1UIY A;  2ZQQ A;  1X0U A;  3JU1 A;  3QK8 A;  4GEH B;  2ZQR A;  4MXI A;  2X58 A;  2HW5 A;  2J5S A;  3BPP A;  4ZDF A;  4FN8 A;  3BPT A;  1RJN A;  5E0S H;  5DUC A;  4ELW A;  4DI1 A;  3ZWC A;  4WYO B;  1TYF A;  1FCF A;  5KDR B;  4JYJ A;  2C8T A;  3A4N A;  3RQG A;  2VSS F;  1NZY B;  3ZW8 A;  4KNP A;  1VRG A;  5ING A;  3H02 A;  5DZK H;  3L3S A;  3LKE A;  2F9Y A;  3KQF A;  5DUF A;  4GHN A;  3TLF A;  4U19 A;  1XNY A;  3GLM A;  3H0J A;  1N6E A;  4FNB A;  2F9I A;  5INI A;  4F47 A;  4OMR A;  1K39 A;  4B3J A;  2ZL4 A;  4L8K A;  1XNW A;  1N6F A;  3MOY A;  5MGB A;  3KTJ A;  3GKB A;  3W8I B;  2J5I B;  3FF6 A;  1TG6 A;  3GF7 A;  4GM2 A;  1HZD A;  4MOU A;  3AM1 A;  3LAO A;  3QKA A;  3HLN 1;  1ON9 A;  1HNO A;  3HIN A;  4K29 A;  4WCZ A;  3RSI A;  1Q51 A;  4KWB A;  4B3H A;  4ZDB A;  3QYR A;  4ZU2 A;  3QMJ A;  4RYF A;  3ZWA A;  3TDC A;  4Z0M A;  4WZ8 B;  3R9S A;  1EF9 A;  5G1S A;  3MYB A;  3T89 A;  2X24 A;  1N6D A;  2A7S A;  3SWX A;  4U0G H;  4Q0G A;  5INF A;  5IKL B;  1Q52 A;  4JWV A;  5DU8 A;  1UX4 A;  2UZF A;  4JCS A;  2Q35 A;  4U0H A;  4K3W A;  5C9G A;  1JXZ A;  3QRE A;  5JBW A;  3GF3 A;  3Q0J A;  2D3T A;  5FIF A;  3K8X A;  4I42 A;  2VSS E;  2Q34 A;  2F9Y B;  4JFC A;  2J5G D;  4FZW C;  4KPK A;  3NJD A;  4JCR A;  2FZS A;  3KTK A;  2ZL3 A;  3WG5 A;  4EMM A;  2F9I B;  3QXI A;  5DTW A;  5HUQ A;  4YLH A;  3TVU A;  4OG1 A;  3DJA A;  4G2R A;  2VSU E;  4I4Z A;  5CTC A;  4L6W A;  4JOT A;  4Q1I A;  3KTH A;  3T8B A;  3RQE A;  3IAV A;  3T8A A;  3ZWB A;  3RRV A;  3AJM A;  1K32 A;  4NNQ A;  4U18 A;  4ZDD A;  3Q1T A;  4MI2 A;  1O8U A;  4JCT A;  2GTR A;  1XNV A;  1DUB A;  4FJW D;  1DCI A;  4LK5 A;  1PIX A;  5G1R A;  4QFE A;  4HDT A;  1Y64 B;  5DU4 A;  4IZD A;  2DUB A;  4FZW A;  2J5I I;  1Y7O A; 
#chains in the Genus database with same CATH homology
 3V5E A;  4ELS A;  1FC9 A;  1WZ8 A;  3BEZ A;  3H81 A;  1YG8 A;  4IZB A;  3H0S A;  4FN7 A;  3FDU A;  3OT6 A;  1HNU A;  2VSU C;  1FC7 A;  1UYR A;  5FUS A;  3TZ3 A;  3IBB A;  3BF0 A;  3P85 A;  2FW2 A;  1SZO A;  4U1A A;  3T88 A;  4JVT A;  4IZC A;  1PJH A;  3ST9 A;  4ASI A;  2CBY A;  5DKP A;  5JBX A;  2NP9 A;  4RYF H;  3TRR A;  2Q2X A;  3HP0 A;  2W3P A;  4JSB A;  3OC7 A;  2BZR A;  1UYV A;  1EF8 A;  2VSS A;  5DL1 A;  1YG6 A;  3GMA A;  3P5M A;  4HNK A;  2EJ5 A;  3R9Q A;  3OME A;  3G64 A;  5E0S A;  4EMP A;  2PBP A;  4FND A;  1FC6 A;  3MFM A;  2IEX A;  3ZW9 A;  4K2N A;  3U9T B;  2VSU A;  3M6N A;  4ZDE A;  2DEO A;  5KJP A;  4JCQ A;  2WTB A;  5DZK A;  1OD2 A;  1XO6 A;  3TT7 A;  5C90 A;  2ZL0 A;  3QWD A;  5DU6 A;  2QQ3 A;  1SG4 A;  3DOR A;  1XX4 A;  3M6M A;  3TT6 A;  3R9T A;  3T3W A;  4HC8 A;  4QII A;  2FBM A;  4JYL A;  5KDR A;  4NAR A;  3PZK A;  3U9R B;  3R0O A;  2CE3 A;  4EML A;  1MJ3 A;  1NZY A;  3N6R B;  3K50 A;  4RCN A;  5CTB A;  3SLL A;  3U9S B;  2VSU F;  4QIJ A;  3KTI A;  3ISA A;  3MT6 A;  3PGQ A;  4FB8 A;  1UYS A;  4OLQ A;  2A7K A;  1W2X A;  1WDM A;  2VRE A;  3TV5 A;  5G1Q A;  3QXZ A;  4NEK A;  5E0N X;  4JJT A;  3PE8 A;  2ZL2 A;  1ON3 A;  4B3I A;  3Q7H A;  1EY3 A;  4I52 A;  3V5I A;  2PPY A;  1RJM A;  3KTG A;  3I47 A;  3IB9 A;  2PG8 A;  4ELX A;  2F6I A;  3HRX A;  2J5I A;  4ZDC A;  3RST A;  2YJG A;  1WDL A;  2J5G A;  1OD4 A;  3R6H A;  3PEA A;  3HE2 A;  3STA A;  1UYT A;  3TVW A;  3H0U A;  2VX2 A;  3H0Q A;  4U0G A;  3NJB A;  2A81 A;  1WDK A;  1J7X A;  4J2U A;  5DTP A;  3Q0G A;  3VIV A;  2F6Q A;  4KD6 A;  3P2L A;  1UIY A;  2ZQQ A;  1X0U A;  3JU1 A;  3QK8 A;  2ZQR A;  4MXI A;  2X58 A;  2HW5 A;  2J5S A;  3BPP A;  4ZDF A;  4FN8 A;  3BPT A;  1RJN A;  5E0S H;  5DUC A;  4ELW A;  4DI1 A;  3ZWC A;  4WYO B;  1TYF A;  1FCF A;  5KDR B;  4JYJ A;  2C8T A;  2VSS F;  1NZY B;  3ZW8 A;  4KNP A;  1VRG A;  5ING A;  3H02 A;  5DZK H;  3L3S A;  3LKE A;  2F9Y A;  3KQF A;  5DUF A;  4GHN A;  3TLF A;  4U19 A;  1XNY A;  3GLM A;  3H0J A;  1N6E A;  4FNB A;  2F9I A;  5INI A;  4F47 A;  4OMR A;  1K39 A;  4B3J A;  2ZL4 A;  4L8K A;  1XNW A;  1N6F A;  3MOY A;  5MGB A;  3KTJ A;  3GKB A;  2J5I B;  3FF6 A;  1TG6 A;  3GF7 A;  4GM2 A;  1HZD A;  4MOU A;  3LAO A;  3QKA A;  3HLN 1;  1ON9 A;  1HNO A;  3HIN A;  4K29 A;  4WCZ A;  3RSI A;  1Q51 A;  4KWB A;  4B3H A;  4ZDB A;  3QYR A;  4ZU2 A;  3QMJ A;  4RYF A;  3ZWA A;  3TDC A;  4Z0M A;  4WZ8 B;  3R9S A;  1EF9 A;  5G1S A;  3MYB A;  3T89 A;  2X24 A;  1N6D A;  2A7S A;  3SWX A;  4U0G H;  4Q0G A;  5INF A;  5IKL B;  1Q52 A;  4JWV A;  5DU8 A;  2UZF A;  4JCS A;  2Q35 A;  4U0H A;  4K3W A;  5C9G A;  1JXZ A;  5JBW A;  3QRE A;  3GF3 A;  3Q0J A;  2D3T A;  5FIF A;  3K8X A;  4I42 A;  2VSS E;  2Q34 A;  2F9Y B;  4JFC A;  2J5G D;  4FZW C;  4KPK A;  3NJD A;  4JCR A;  2FZS A;  3KTK A;  2ZL3 A;  3WG5 A;  4EMM A;  2F9I B;  3QXI A;  5DTW A;  5HUQ A;  4YLH A;  3TVU A;  4OG1 A;  3DJA A;  4G2R A;  2VSU E;  4I4Z A;  5CTC A;  4L6W A;  4JOT A;  4Q1I A;  3KTH A;  3T8B A;  3IAV A;  3T8A A;  3ZWB A;  3RRV A;  1K32 A;  4NNQ A;  4U18 A;  4ZDD A;  3Q1T A;  4MI2 A;  1O8U A;  4JCT A;  2GTR A;  1XNV A;  1DUB A;  4FJW D;  1DCI A;  4LK5 A;  1PIX A;  5G1R A;  4QFE A;  4HDT A;  5DU4 A;  4IZD A;  2DUB A;  4FZW A;  2J5I I;  1Y7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...