1MJ3A

Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
258
Chain Sequence
ANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereoselectivity of Enoyl-CoA Hydratase Results from Preferential Activation of One of Two Bound Substrate Conformers
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
molecule keywords ENOYL-COA HYDRATASE, MITOCHONDRIAL
total genus 87
structure length 258
sequence length 260
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2002-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1mj3A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1mj3A01
3TDCA 2EJ5A 2WTBA 2CE3A 4FN8A 4IZDA 2A7KA 4EMLA 2ZL2A 3QMJA 2PBPA 4LK5A 1NZYB 4QIJA 3V5EA 4ZDCA 1N6DA 1ON9A 3GMAA 2C8TA 2F6QA 2F9IB 1NZYA 1WDKA 1TG6A 2ZL0A 3U9SB 5E0SA 3MFMA 1XO6A 4U0GH 4WCZA 3OC7A 4B3IA 4KPKA 3RSIA 4QFEA 4ZU2A 3BF0A 1FC7A 2FBMA 5FIFA 4ZDFA 3GF7A 2X24A 2F9YA 3QXIA 2J5GA 3IB9A 5CTBA 2X58A 4OMRA 1VRGA 3H0SA 4EMMA 4GM2A 5DUCA 2BZRA 5CTCA 4KWBA 1N6EA 3H0JA 4OG1A 2A7SA 5DU6A 1EF9A 1FCFA 3JU1A 4WZ8B 3KQFA 5FUSA 3L3SA 3HE2A 4U1AA 1UYRA 5INGA 5E0SH 1ON3A 1XNVA 3ZW9A 2NP9A 4ELWA 5G1SA 1Y7OA 3NJBA 3QWDA 4ZDBA 2J5GD 3T8AA 2F9IA 4ZDEA 3KTIA 2F6IA 2VX2A 4ZDDA 4IZBA 3U9TB 3PGQA 3BEZA 3TV5A 3ZW8A 3P5MA 2GTRA 3MYBA 5DTPA 3MT6A 4U18A 3GKBA 3ZWCA 3DORA 3QXZA 1WZ8A 4MI2A 3H0QA 3Q0JA 4G2RA 3VIVA 2PPYA 3PE8A 5DZKH 3H81A 4U0GA 2VSUA 2UZFA 4I52A 3WG5A 4U19A 3TT7A 1XNYA 4FZWA 4ELSA 3R0OA 5C9GA 4NEKA 1UYSA 3LAOA 5KDRA 4RYFH 4Q0GA 3T88A 4YLHA 3GLMA 3GF3A 4I42A 4FNBA 1W2XA 3BPPA 3TLFA 1K32A 3K50A 2F9YB 1N6FA 4K2NA 4JSBA 4I4ZA 2D3TA 3HRXA 1OD4A 4JCTA 2ZL4A 3TVUA 4KNPA 3R9QA 3IBBA 2DUBA 2VREA 3QKAA 5G1RA 4DI1A 4ELXA 2VSUC 3R6HA 3KTJA 4EMPA 2VSSF 1UIYA 3U9RB 3H0UA 1RJNA 3K8XA 4FN7A 1FC6A 3QYRA 4F47A 4RCNA 4FZWC 1FC9A 4ASIA 4JOTA 2Q2XA 5E0NX 4FNDA 3P85A 4JCRA 3PEAA 3SWXA 2VSUF 2ZL3A 1RJMA 4JYJA 3DJAA 1YG8A 4GHNA 1EY3A 2Q35A 4B3JA 4L8KA 1SZOA 5JBXA 3R9TA 3FDUA 3G64A 1JXZA 5KJPA 4NNQA 1X0UA 3T3WA 3NJDA 5INIA 4QIIA 1SG4A 3KTGA 3SLLA 3QK8A 3RSTA 2VSSA 5IKLB 3I47A 4U0HA 4JYLA 4JFCA 4HC8A 1HNOA 3OMEA 2Q34A 3HLN1 5DU4A 2W3PA 3P2LA 2J5SA 2ZQQA 3OT6A 2IEXA 1OD2A 4L6WA 1WDLA 1O8UA 2ZQRA 1PIXA 3Q7HA 4WYOB 3TRRA 3HINA 1TYFA 5DTWA 5KDRB 3QREA 5MGBA 1J7XA 3MOYA 3TVWA 3IAVA 4K3WA 4FJWD 4Q1IA 1XNWA 4JWVA 3M6NA 1K39A 1HNUA 4B3HA 4FB8A 1XX4A 5DU8A 3RRVA 3ZWBA 5DZKA 4Z0MA 4MOUA 1DUBA 3R9SA 2FZSA 2CBYA 4JCSA 1Q51A 3HP0A 3H02A 5DL1A 5DKPA 3ISAA 3TZ3A 4MXIA 4JJTA 3LKEA 1UYTA 5G1QA 3T89A 2J5II 4JVTA 3Q0GA 1MJ3A 1YG6A 2VSUE 3ZWAA 2J5IB 4RYFA 1Q52A 5INFA 3TT6A 3T8BA 4IZCA 2DEOA 5C90A 4K29A 1HZDA 2VSSE 4JCQA 2QQ3A 3M6MA 5DUFA 5JBWA 2J5IA 3N6RB 2A81A 3STAA 4KD6A 3Q1TA 1UYVA 3V5IA 2HW5A 2FW2A 3KTHA 1EF8A 4OLQA 1WDMA 1DCIA 1PJHA 3ST9A 3KTKA 2PG8A 3PZKA 3FF6A 4HNKA
chains in the Genus database with same CATH superfamily
3TDCA 2EJ5A 2WTBA 2CE3A 4FN8A 4IZDA 2A7KA 4EMLA 2ZL2A 2YJGA 3QMJA 2PBPA 4LK5A 1NZYB 4QIJA 3V5EA 4ZDCA 1N6DA 1ON9A 3GMAA 2C8TA 2F6QA 2F9IB 1NZYA 2ZL0A 1WDKA 3W8HB 1TG6A 3U9SB 5E0SA 3MFMA 1XO6A 4U0GH 4WCZA 3OC7A 4B3IA 4KPKA 3RSIA 3ADDA 4QFEA 4ZU2A 3BF0A 1FC7A 4J2UA 2FBMA 5FIFA 4ZDFA 3GF7A 2X24A 2F9YA 3QXIA 2J5GA 3IB9A 5CTBA 4NARA 2X58A 4OMRA 1VRGA 3H0SA 4EMMA 4GM2A 5DUCA 2BZRA 5CTCA 4KWBA 1N6EA 3H0JA 4OG1A 2A7SA 5DU6A 1EF9A 1FCFA 3JU1A 4WZ8B 3KQFA 3L8JA 5FUSA 3L3SA 3HE2A 4U1AA 1UYRA 5INGA 5E0SH 3L8IA 1ON3A 1XNVA 3ZW9A 2NP9A 4ELWA 5G1SA 1Y7OA 3NJBA 3QWDA 4ZDBA 2J5GD 3T8AA 2F9IA 4ZDEA 3KTIA 2F6IA 2VX2A 4ZDDA 4IZBA 3U9TB 3PGQA 3BEZA 3TV5A 3ZW8A 3P5MA 2GTRA 3MYBA 5DTPA 3MT6A 4U18A 3GKBA 3ZWCA 3DORA 3QXZA 1WZ8A 4MI2A 3H0QA 3Q0JA 4G2RA 3VIVA 2PPYA 3PE8A 5HUQA 5DZKH 3H81A 4U0GA 2VSUA 2UZFA 4I52A 3WG5A 4U19A 3TT7A 1XNYA 4FZWA 4ELSA 3R0OA 5C9GA 4NEKA 1UYSA 3LAOA 5KDRA 4RYFH 4Q0GA 3T88A 4YLHA 3GLMA 3GF3A 4I42A 4FNBA 1W2XA 3BPPA 3TLFA 1K32A 3K50A 2F9YB 1N6FA 4K2NA 4JSBA 4I4ZA 2D3TA 3HRXA 1OD4A 4JCTA 2ZL4A 3ADCA 3TVUA 4KNPA 3R9QA 3IBBA 2DUBA 2VREA 3QKAA 5G1RA 4DI1A 4ELXA 2VSUC 3R6HA 3KTJA 4EMPA 2VSSF 1UIYA 1Y64B 3U9RB 3H0UA 1RJNA 3K8XA 4FN7A 1FC6A 3QYRA 4F47A 4RCNA 4FZWC 1FC9A 4ASIA 4JOTA 2Q2XA 5E0NX 4FNDA 3P85A 4JCRA 3PEAA 3SWXA 2VSUF 2ZL3A 1RJMA 4JYJA 3DJAA 1YG8A 4GHNA 3O4XE 1EY3A 2Q35A 3RQFA 4B3JA 4L8KA 1SZOA 5JBXA 3R9TA 3FDUA 3G64A 1JXZA 5KJPA 4NNQA 1X0UA 3T3WA 3NJDA 5INIA 4QIIA 1SG4A 3KTGA 3SLLA 3QK8A 3RSTA 2VSSA 5IKLB 3I47A 4U0HA 4JYLA 4JFCA 4HC8A 1HNOA 3OMEA 3A4MA 2Q34A 3HLN1 5DU4A 2W3PA 3P2LA 2J5SA 2ZQQA 3OT6A 2IEXA 2P63A 1OD2A 4L6WA 1WDLA 1O8UA 2ZQRA 1PIXA 3Q7HA 4WYOB 3TRRA 3HINA 1TYFA 5DTWA 5KDRB 3BPTA 3QREA 5MGBA 1J7XA 3MOYA 3TVWA 3IAVA 4K3WA 4FJWD 4Q1IA 1XNWA 3AJMA 4JWVA 3RQEA 3M6NA 1K39A 1HNUA 4B3HA 4FB8A 1XX4A 5DU8A 3RRVA 3ZWBA 5DZKA 4Z0MA 4MOUA 1DUBA 3R9SA 2FZSA 2CBYA 3A4LA 4GEHB 4JCSA 1Q51A 3W8IB 3HP0A 3H02A 5DL1A 5DKPA 3ISAA 3TZ3A 4MXIA 4JJTA 3ADBA 3LKEA 1UYTA 4HDTA 5G1QA 3T89A 2J5II 4JVTA 3Q0GA 1MJ3A 1YG6A 3IRBA 2VSUE 3ZWAA 2J5IB 4RYFA 1Q52A 5INFA 3TT6A 3T8BA 4IZCA 2DEOA 3AM1A 5C90A 4K29A 1HZDA 1UX5A 2VSSE 4JCQA 2QQ3A 3M6MA 5DUFA 5JBWA 1UX4A 2J5IA 3N6RB 2A81A 3STAA 4KD6A 3Q1TA 1UYVA 3V5IA 2HW5A 2FW2A 3KTHA 1EF8A 4OLQA 1WDMA 1DCIA 1PJHA 3A4NA 3ST9A 3KTKA 2PG8A 3PZKA 3RQGA 3FF6A 4HNKA
chains in the Genus database with same CATH topology
3TDCA 2EJ5A 2WTBA 2CE3A 4FN8A 4IZDA 2A7KA 4EMLA 2ZL2A 2YJGA 3QMJA 2PBPA 4LK5A 1NZYB 4QIJA 3V5EA 4ZDCA 1N6DA 1ON9A 3GMAA 2C8TA 2F6QA 2F9IB 1NZYA 1WDKA 1TG6A 2ZL0A 3U9SB 5E0SA 3MFMA 1XO6A 4U0GH 4WCZA 3OC7A 4B3IA 4KPKA 3RSIA 4QFEA 4ZU2A 3BF0A 1FC7A 4J2UA 2FBMA 5FIFA 4ZDFA 3GF7A 2X24A 2F9YA 3QXIA 2J5GA 3IB9A 5CTBA 4NARA 2X58A 4OMRA 1VRGA 3H0SA 4EMMA 4GM2A 5DUCA 2BZRA 5CTCA 4KWBA 1N6EA 3H0JA 4OG1A 2A7SA 5DU6A 1EF9A 1FCFA 3JU1A 4WZ8B 3KQFA 5FUSA 3L3SA 3HE2A 4U1AA 1UYRA 5INGA 5E0SH 1ON3A 1XNVA 3ZW9A 2NP9A 4ELWA 5G1SA 1Y7OA 3NJBA 3QWDA 4ZDBA 2J5GD 3T8AA 2F9IA 4ZDEA 3KTIA 2F6IA 2VX2A 4ZDDA 4IZBA 3U9TB 3PGQA 3BEZA 3TV5A 3ZW8A 3P5MA 2GTRA 3MYBA 5DTPA 3MT6A 4U18A 3GKBA 3ZWCA 3DORA 3QXZA 1WZ8A 4MI2A 3H0QA 3Q0JA 4G2RA 3VIVA 2PPYA 5HUQA 3PE8A 5DZKH 3H81A 4U0GA 2VSUA 2UZFA 4I52A 3WG5A 4U19A 3TT7A 1XNYA 4FZWA 4ELSA 3R0OA 5C9GA 4NEKA 1UYSA 3LAOA 5KDRA 4RYFH 4Q0GA 3T88A 4YLHA 3GLMA 3GF3A 4I42A 4FNBA 1W2XA 3BPPA 3TLFA 1K32A 3K50A 2F9YB 1N6FA 4K2NA 4JSBA 4I4ZA 2D3TA 3HRXA 1OD4A 4JCTA 2ZL4A 3TVUA 4KNPA 3R9QA 3IBBA 2DUBA 2VREA 3QKAA 5G1RA 4DI1A 4ELXA 2VSUC 3R6HA 3KTJA 4EMPA 2VSSF 1UIYA 3U9RB 3H0UA 1RJNA 3K8XA 4FN7A 1FC6A 3QYRA 4F47A 4RCNA 4FZWC 1FC9A 4ASIA 4JOTA 2Q2XA 5E0NX 4FNDA 3P85A 4JCRA 3PEAA 3SWXA 2VSUF 2ZL3A 1RJMA 4JYJA 3DJAA 1YG8A 4GHNA 1EY3A 2Q35A 4B3JA 4L8KA 1SZOA 5JBXA 3R9TA 3FDUA 3G64A 1JXZA 5KJPA 4NNQA 1X0UA 3T3WA 3NJDA 5INIA 4QIIA 1SG4A 3KTGA 3SLLA 3QK8A 3RSTA 2VSSA 5IKLB 3I47A 4U0HA 4JYLA 4JFCA 4HC8A 1HNOA 3OMEA 2Q34A 3HLN1 5DU4A 2W3PA 3P2LA 2J5SA 2ZQQA 3OT6A 2IEXA 1OD2A 4L6WA 1WDLA 1O8UA 2ZQRA 1PIXA 3Q7HA 4WYOB 3TRRA 3HINA 1TYFA 5DTWA 5KDRB 3BPTA 3QREA 5MGBA 1J7XA 3MOYA 3TVWA 3IAVA 4K3WA 4FJWD 4Q1IA 1XNWA 4JWVA 3M6NA 1K39A 1HNUA 4B3HA 4FB8A 1XX4A 5DU8A 3RRVA 3ZWBA 5DZKA 4Z0MA 4MOUA 1DUBA 3R9SA 2FZSA 2CBYA 4JCSA 1Q51A 3HP0A 3H02A 5DL1A 5DKPA 3ISAA 3TZ3A 4MXIA 4JJTA 3LKEA 1UYTA 4HDTA 5G1QA 3T89A 2J5II 4JVTA 3Q0GA 1MJ3A 1YG6A 2VSUE 3ZWAA 2J5IB 4RYFA 1Q52A 5INFA 3TT6A 3T8BA 4IZCA 2DEOA 5C90A 4K29A 1HZDA 2VSSE 4JCQA 2QQ3A 3M6MA 5DUFA 5JBWA 2J5IA 3N6RB 2A81A 3STAA 4KD6A 3Q1TA 1UYVA 3V5IA 2HW5A 2FW2A 3KTHA 1EF8A 4OLQA 1WDMA 1DCIA 1PJHA 3ST9A 3KTKA 2PG8A 3PZKA 3FF6A 4HNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDC A;  2EJ5 A;  2WTB A;  2CE3 A;  4FN8 A;  4IZD A;  2A7K A;  4EML A;  2ZL2 A;  3QMJ A;  2PBP A;  4LK5 A;  1NZY B;  4QIJ A;  3V5E A;  4ZDC A;  1N6D A;  1ON9 A;  3GMA A;  2C8T A;  2F6Q A;  2F9I B;  1NZY A;  1WDK A;  1TG6 A;  2ZL0 A;  3U9S B;  5E0S A;  3MFM A;  1XO6 A;  4U0G H;  4WCZ A;  3OC7 A;  4B3I A;  4KPK A;  3RSI A;  4QFE A;  4ZU2 A;  3BF0 A;  1FC7 A;  2FBM A;  5FIF A;  4ZDF A;  3GF7 A;  2X24 A;  2F9Y A;  3QXI A;  2J5G A;  3IB9 A;  5CTB A;  2X58 A;  4OMR A;  1VRG A;  3H0S A;  4EMM A;  4GM2 A;  5DUC A;  2BZR A;  5CTC A;  4KWB A;  1N6E A;  3H0J A;  4OG1 A;  2A7S A;  5DU6 A;  1EF9 A;  1FCF A;  3JU1 A;  4WZ8 B;  3KQF A;  5FUS A;  3L3S A;  3HE2 A;  4U1A A;  1UYR A;  5ING A;  5E0S H;  1ON3 A;  1XNV A;  3ZW9 A;  2NP9 A;  4ELW A;  5G1S A;  1Y7O A;  3NJB A;  3QWD A;  4ZDB A;  2J5G D;  3T8A A;  2F9I A;  4ZDE A;  3KTI A;  2F6I A;  2VX2 A;  4ZDD A;  4IZB A;  3U9T B;  3PGQ A;  3BEZ A;  3TV5 A;  3ZW8 A;  3P5M A;  2GTR A;  3MYB A;  5DTP A;  3MT6 A;  4U18 A;  3GKB A;  3ZWC A;  3DOR A;  3QXZ A;  1WZ8 A;  4MI2 A;  3H0Q A;  3Q0J A;  4G2R A;  3VIV A;  2PPY A;  3PE8 A;  5DZK H;  3H81 A;  4U0G A;  2VSU A;  2UZF A;  4I52 A;  3WG5 A;  4U19 A;  3TT7 A;  1XNY A;  4FZW A;  4ELS A;  3R0O A;  5C9G A;  4NEK A;  1UYS A;  3LAO A;  5KDR A;  4RYF H;  4Q0G A;  3T88 A;  4YLH A;  3GLM A;  3GF3 A;  4I42 A;  4FNB A;  1W2X A;  3BPP A;  3TLF A;  1K32 A;  3K50 A;  2F9Y B;  1N6F A;  4K2N A;  4JSB A;  4I4Z A;  2D3T A;  3HRX A;  1OD4 A;  4JCT A;  2ZL4 A;  3TVU A;  4KNP A;  3R9Q A;  3IBB A;  2DUB A;  2VRE A;  3QKA A;  5G1R A;  4DI1 A;  4ELX A;  2VSU C;  3R6H A;  3KTJ A;  4EMP A;  2VSS F;  1UIY A;  3U9R B;  3H0U A;  1RJN A;  3K8X A;  4FN7 A;  1FC6 A;  3QYR A;  4F47 A;  4RCN A;  4FZW C;  1FC9 A;  4ASI A;  4JOT A;  2Q2X A;  5E0N X;  4FND A;  3P85 A;  4JCR A;  3PEA A;  3SWX A;  2VSU F;  2ZL3 A;  1RJM A;  4JYJ A;  3DJA A;  1YG8 A;  4GHN A;  1EY3 A;  2Q35 A;  4B3J A;  4L8K A;  1SZO A;  5JBX A;  3R9T A;  3FDU A;  3G64 A;  1JXZ A;  5KJP A;  4NNQ A;  1X0U A;  3T3W A;  3NJD A;  5INI A;  4QII A;  1SG4 A;  3KTG A;  3SLL A;  3QK8 A;  3RST A;  2VSS A;  5IKL B;  3I47 A;  4U0H A;  4JYL A;  4JFC A;  4HC8 A;  1HNO A;  3OME A;  2Q34 A;  3HLN 1;  5DU4 A;  2W3P A;  3P2L A;  2J5S A;  2ZQQ A;  3OT6 A;  2IEX A;  1OD2 A;  4L6W A;  1WDL A;  1O8U A;  2ZQR A;  1PIX A;  3Q7H A;  4WYO B;  3TRR A;  3HIN A;  1TYF A;  5DTW A;  5KDR B;  3QRE A;  5MGB A;  1J7X A;  3MOY A;  3TVW A;  3IAV A;  4K3W A;  4FJW D;  4Q1I A;  1XNW A;  4JWV A;  3M6N A;  1K39 A;  1HNU A;  4B3H A;  4FB8 A;  1XX4 A;  5DU8 A;  3RRV A;  3ZWB A;  5DZK A;  4Z0M A;  4MOU A;  1DUB A;  3R9S A;  2FZS A;  2CBY A;  4JCS A;  1Q51 A;  3HP0 A;  3H02 A;  5DL1 A;  5DKP A;  3ISA A;  3TZ3 A;  4MXI A;  4JJT A;  3LKE A;  1UYT A;  5G1Q A;  3T89 A;  2J5I I;  4JVT A;  3Q0G A;  1MJ3 A;  1YG6 A;  2VSU E;  3ZWA A;  2J5I B;  4RYF A;  1Q52 A;  5INF A;  3TT6 A;  3T8B A;  4IZC A;  2DEO A;  5C90 A;  4K29 A;  1HZD A;  2VSS E;  4JCQ A;  2QQ3 A;  3M6M A;  5DUF A;  5JBW A;  2J5I A;  3N6R B;  2A81 A;  3STA A;  4KD6 A;  3Q1T A;  1UYV A;  3V5I A;  2HW5 A;  2FW2 A;  3KTH A;  1EF8 A;  4OLQ A;  1WDM A;  1DCI A;  1PJH A;  3ST9 A;  3KTK A;  2PG8 A;  3PZK A;  3FF6 A;  4HNK A; 
#chains in the Genus database with same CATH topology
 3TDC A;  2EJ5 A;  2WTB A;  2CE3 A;  4FN8 A;  4IZD A;  2A7K A;  4EML A;  2ZL2 A;  2YJG A;  3QMJ A;  2PBP A;  4LK5 A;  1NZY B;  4QIJ A;  3V5E A;  4ZDC A;  1N6D A;  1ON9 A;  3GMA A;  2C8T A;  2F6Q A;  2F9I B;  1NZY A;  2ZL0 A;  1WDK A;  3W8H B;  1TG6 A;  3U9S B;  5E0S A;  3MFM A;  1XO6 A;  4U0G H;  4WCZ A;  3OC7 A;  4B3I A;  4KPK A;  3RSI A;  3ADD A;  4QFE A;  4ZU2 A;  3BF0 A;  1FC7 A;  4J2U A;  2FBM A;  5FIF A;  4ZDF A;  3GF7 A;  2X24 A;  2F9Y A;  3QXI A;  2J5G A;  3IB9 A;  5CTB A;  4NAR A;  2X58 A;  4OMR A;  1VRG A;  3H0S A;  4EMM A;  4GM2 A;  5DUC A;  2BZR A;  5CTC A;  4KWB A;  1N6E A;  3H0J A;  4OG1 A;  2A7S A;  5DU6 A;  1EF9 A;  1FCF A;  3JU1 A;  4WZ8 B;  3KQF A;  3L8J A;  5FUS A;  3L3S A;  3HE2 A;  4U1A A;  1UYR A;  5ING A;  5E0S H;  3L8I A;  1ON3 A;  1XNV A;  3ZW9 A;  2NP9 A;  4ELW A;  5G1S A;  1Y7O A;  3NJB A;  3QWD A;  4ZDB A;  2J5G D;  3T8A A;  2F9I A;  4ZDE A;  3KTI A;  2F6I A;  2VX2 A;  4ZDD A;  4IZB A;  3U9T B;  3PGQ A;  3BEZ A;  3TV5 A;  3ZW8 A;  3P5M A;  2GTR A;  3MYB A;  5DTP A;  3MT6 A;  4U18 A;  3GKB A;  3ZWC A;  3DOR A;  3QXZ A;  1WZ8 A;  4MI2 A;  3H0Q A;  3Q0J A;  4G2R A;  3VIV A;  2PPY A;  3PE8 A;  5HUQ A;  5DZK H;  3H81 A;  4U0G A;  2VSU A;  2UZF A;  4I52 A;  3WG5 A;  4U19 A;  3TT7 A;  1XNY A;  4FZW A;  4ELS A;  3R0O A;  5C9G A;  4NEK A;  1UYS A;  3LAO A;  5KDR A;  4RYF H;  4Q0G A;  3T88 A;  4YLH A;  3GLM A;  3GF3 A;  4I42 A;  4FNB A;  1W2X A;  3BPP A;  3TLF A;  1K32 A;  3K50 A;  2F9Y B;  1N6F A;  4K2N A;  4JSB A;  4I4Z A;  2D3T A;  3HRX A;  1OD4 A;  4JCT A;  2ZL4 A;  3ADC A;  3TVU A;  4KNP A;  3R9Q A;  3IBB A;  2DUB A;  2VRE A;  3QKA A;  5G1R A;  4DI1 A;  4ELX A;  2VSU C;  3R6H A;  3KTJ A;  4EMP A;  2VSS F;  1UIY A;  1Y64 B;  3U9R B;  3H0U A;  1RJN A;  3K8X A;  4FN7 A;  1FC6 A;  3QYR A;  4F47 A;  4RCN A;  4FZW C;  1FC9 A;  4ASI A;  4JOT A;  2Q2X A;  5E0N X;  4FND A;  3P85 A;  4JCR A;  3PEA A;  3SWX A;  2VSU F;  2ZL3 A;  1RJM A;  4JYJ A;  3DJA A;  1YG8 A;  4GHN A;  3O4X E;  1EY3 A;  2Q35 A;  3RQF A;  4B3J A;  4L8K A;  1SZO A;  5JBX A;  3R9T A;  3FDU A;  3G64 A;  1JXZ A;  5KJP A;  4NNQ A;  1X0U A;  3T3W A;  3NJD A;  5INI A;  4QII A;  1SG4 A;  3KTG A;  3SLL A;  3QK8 A;  3RST A;  2VSS A;  5IKL B;  3I47 A;  4U0H A;  4JYL A;  4JFC A;  4HC8 A;  1HNO A;  3OME A;  3A4M A;  2Q34 A;  3HLN 1;  5DU4 A;  2W3P A;  3P2L A;  2J5S A;  2ZQQ A;  3OT6 A;  2IEX A;  2P63 A;  1OD2 A;  4L6W A;  1WDL A;  1O8U A;  2ZQR A;  1PIX A;  3Q7H A;  4WYO B;  3TRR A;  3HIN A;  1TYF A;  5DTW A;  5KDR B;  3BPT A;  3QRE A;  5MGB A;  1J7X A;  3MOY A;  3TVW A;  3IAV A;  4K3W A;  4FJW D;  4Q1I A;  1XNW A;  3AJM A;  4JWV A;  3RQE A;  3M6N A;  1K39 A;  1HNU A;  4B3H A;  4FB8 A;  1XX4 A;  5DU8 A;  3RRV A;  3ZWB A;  5DZK A;  4Z0M A;  4MOU A;  1DUB A;  3R9S A;  2FZS A;  2CBY A;  3A4L A;  4GEH B;  4JCS A;  1Q51 A;  3W8I B;  3HP0 A;  3H02 A;  5DL1 A;  5DKP A;  3ISA A;  3TZ3 A;  4MXI A;  4JJT A;  3ADB A;  3LKE A;  1UYT A;  4HDT A;  5G1Q A;  3T89 A;  2J5I I;  4JVT A;  3Q0G A;  1MJ3 A;  1YG6 A;  3IRB A;  2VSU E;  3ZWA A;  2J5I B;  4RYF A;  1Q52 A;  5INF A;  3TT6 A;  3T8B A;  4IZC A;  2DEO A;  3AM1 A;  5C90 A;  4K29 A;  1HZD A;  1UX5 A;  2VSS E;  4JCQ A;  2QQ3 A;  3M6M A;  5DUF A;  5JBW A;  1UX4 A;  2J5I A;  3N6R B;  2A81 A;  3STA A;  4KD6 A;  3Q1T A;  1UYV A;  3V5I A;  2HW5 A;  2FW2 A;  3KTH A;  1EF8 A;  4OLQ A;  1WDM A;  1DCI A;  1PJH A;  3A4N A;  3ST9 A;  3KTK A;  2PG8 A;  3PZK A;  3RQG A;  3FF6 A;  4HNK A; 
#chains in the Genus database with same CATH homology
 3TDC A;  2EJ5 A;  2WTB A;  2CE3 A;  4FN8 A;  4IZD A;  2A7K A;  4EML A;  2ZL2 A;  2YJG A;  3QMJ A;  2PBP A;  4LK5 A;  1NZY B;  4QIJ A;  3V5E A;  4ZDC A;  1N6D A;  1ON9 A;  3GMA A;  2C8T A;  2F6Q A;  2F9I B;  1NZY A;  1WDK A;  1TG6 A;  2ZL0 A;  3U9S B;  5E0S A;  3MFM A;  1XO6 A;  4U0G H;  4WCZ A;  3OC7 A;  4B3I A;  4KPK A;  3RSI A;  4QFE A;  4ZU2 A;  3BF0 A;  1FC7 A;  4J2U A;  2FBM A;  5FIF A;  4ZDF A;  3GF7 A;  2X24 A;  2F9Y A;  3QXI A;  2J5G A;  3IB9 A;  5CTB A;  4NAR A;  2X58 A;  4OMR A;  1VRG A;  3H0S A;  4EMM A;  4GM2 A;  5DUC A;  2BZR A;  5CTC A;  4KWB A;  1N6E A;  3H0J A;  4OG1 A;  2A7S A;  5DU6 A;  1EF9 A;  1FCF A;  3JU1 A;  4WZ8 B;  3KQF A;  5FUS A;  3L3S A;  3HE2 A;  4U1A A;  1UYR A;  5ING A;  5E0S H;  1ON3 A;  1XNV A;  3ZW9 A;  2NP9 A;  4ELW A;  5G1S A;  1Y7O A;  3NJB A;  3QWD A;  4ZDB A;  2J5G D;  3T8A A;  2F9I A;  4ZDE A;  3KTI A;  2F6I A;  2VX2 A;  4ZDD A;  4IZB A;  3U9T B;  3PGQ A;  3BEZ A;  3TV5 A;  3ZW8 A;  3P5M A;  2GTR A;  3MYB A;  5DTP A;  3MT6 A;  4U18 A;  3GKB A;  3ZWC A;  3DOR A;  3QXZ A;  1WZ8 A;  4MI2 A;  3H0Q A;  3Q0J A;  4G2R A;  3VIV A;  2PPY A;  5HUQ A;  3PE8 A;  5DZK H;  3H81 A;  4U0G A;  2VSU A;  2UZF A;  4I52 A;  3WG5 A;  4U19 A;  3TT7 A;  1XNY A;  4FZW A;  4ELS A;  3R0O A;  5C9G A;  4NEK A;  1UYS A;  3LAO A;  5KDR A;  4RYF H;  4Q0G A;  3T88 A;  4YLH A;  3GLM A;  3GF3 A;  4I42 A;  4FNB A;  1W2X A;  3BPP A;  3TLF A;  1K32 A;  3K50 A;  2F9Y B;  1N6F A;  4K2N A;  4JSB A;  4I4Z A;  2D3T A;  3HRX A;  1OD4 A;  4JCT A;  2ZL4 A;  3TVU A;  4KNP A;  3R9Q A;  3IBB A;  2DUB A;  2VRE A;  3QKA A;  5G1R A;  4DI1 A;  4ELX A;  2VSU C;  3R6H A;  3KTJ A;  4EMP A;  2VSS F;  1UIY A;  3U9R B;  3H0U A;  1RJN A;  3K8X A;  4FN7 A;  1FC6 A;  3QYR A;  4F47 A;  4RCN A;  4FZW C;  1FC9 A;  4ASI A;  4JOT A;  2Q2X A;  5E0N X;  4FND A;  3P85 A;  4JCR A;  3PEA A;  3SWX A;  2VSU F;  2ZL3 A;  1RJM A;  4JYJ A;  3DJA A;  1YG8 A;  4GHN A;  1EY3 A;  2Q35 A;  4B3J A;  4L8K A;  1SZO A;  5JBX A;  3R9T A;  3FDU A;  3G64 A;  1JXZ A;  5KJP A;  4NNQ A;  1X0U A;  3T3W A;  3NJD A;  5INI A;  4QII A;  1SG4 A;  3KTG A;  3SLL A;  3QK8 A;  3RST A;  2VSS A;  5IKL B;  3I47 A;  4U0H A;  4JYL A;  4JFC A;  4HC8 A;  1HNO A;  3OME A;  2Q34 A;  3HLN 1;  5DU4 A;  2W3P A;  3P2L A;  2J5S A;  2ZQQ A;  3OT6 A;  2IEX A;  1OD2 A;  4L6W A;  1WDL A;  1O8U A;  2ZQR A;  1PIX A;  3Q7H A;  4WYO B;  3TRR A;  3HIN A;  1TYF A;  5DTW A;  5KDR B;  3BPT A;  3QRE A;  5MGB A;  1J7X A;  3MOY A;  3TVW A;  3IAV A;  4K3W A;  4FJW D;  4Q1I A;  1XNW A;  4JWV A;  3M6N A;  1K39 A;  1HNU A;  4B3H A;  4FB8 A;  1XX4 A;  5DU8 A;  3RRV A;  3ZWB A;  5DZK A;  4Z0M A;  4MOU A;  1DUB A;  3R9S A;  2FZS A;  2CBY A;  4JCS A;  1Q51 A;  3HP0 A;  3H02 A;  5DL1 A;  5DKP A;  3ISA A;  3TZ3 A;  4MXI A;  4JJT A;  3LKE A;  1UYT A;  4HDT A;  5G1Q A;  3T89 A;  2J5I I;  4JVT A;  3Q0G A;  1MJ3 A;  1YG6 A;  2VSU E;  3ZWA A;  2J5I B;  4RYF A;  1Q52 A;  5INF A;  3TT6 A;  3T8B A;  4IZC A;  2DEO A;  5C90 A;  4K29 A;  1HZD A;  2VSS E;  4JCQ A;  2QQ3 A;  3M6M A;  5DUF A;  5JBW A;  2J5I A;  3N6R B;  2A81 A;  3STA A;  4KD6 A;  3Q1T A;  1UYV A;  3V5I A;  2HW5 A;  2FW2 A;  3KTH A;  1EF8 A;  4OLQ A;  1WDM A;  1DCI A;  1PJH A;  3ST9 A;  3KTK A;  2PG8 A;  3PZK A;  3FF6 A;  4HNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...