3RQFA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 74
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqfA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqfA02
3C8GB 4XEVA 1ZZPA 3GM1A 3RQFA 4GEHB 2HSBA 3RQEA 3GM2A 3AJMA 4XEFA 2KK1A 2Q00A 3L8IA 1WOLA 1OW8A 3O10A 1PV3A 4XEKA 1OW6A 1QVXA 3U3FA 1K40A 1KTMA 3L8JA 3W8IB 2JPUA 3C18A 4NQFA 4EBJA 3S9OA 3TULA 3JYYA 5F28E 2PBEA 1WTYA 3RQGA 3MFNA 1K05A 4EBKA 3K7DA 1O3UA 3W8HB 2L6FA 3C8GD 4R32A 1OW7A 1KNYA 1WWPA 3C8GA 2L6HA 2LK4A 1K04A 1V4AA 3BRJA 2YWAA 3U0CA 1UFBA 1JOGA 2JX0A 3B71A 3JZ0A 3GM3A 2L6GA
chains in the Genus database with same CATH superfamily
2WVOA 3K1HA 4Z9IA 3DAGA 1XWJA 5A6JA 3GEEA 5L0FA 1T6IA 1RKCA 1HE9A 2QUPA 3QVYA 3S27A 1DCIA 3ZWIA 1HMOA 2LIGA 1OXBA 3EGDB 3GODA 2YL7A 5E3CA 4DVYP 2P61A 3C18A 2LFFA 3G50A 4K1OA 3CQZA 3ZSUA 4DBQA 5A6AA 3AM1A 2XM4A 1JAFA 3ASOC 2IBFA 3LS0A 4G78A 1O3UA 5A6KA 5K0IA 3ABLC 3MYIA 2X0CA 3FDUA 4GQHA 1M57C 2C04A 5KYWB 3FVYA 3SZRA 3US6A 3PDMP 3EZHA 2CW0F 4F4BA 1VYIA 3DM5A 2OOCA 1QKRA 1MNDA 2CNWD 2EIKC 3L0IA 2LCHA 4OINF 1O87A 3TOLA 4CS8C 4JC7A 2AP3A 3IPMO 1LIHA 3RYLA 1TWHA 3N2ZB 3TOMA 4E17A 4P9FA 3RVZA 2WZLA 3ZG1A 5HV9A 3HNKA 1S7ZA 2NUTA 4BEJA 1CGME 2UUHA 3U9JA 2Q00A 3NG1A 4HFFB 4FZWC 4JEBA 2FGYA 5L0JA 4YL1A 2PPYA 3FOOA 2GFHA 3B0VC 3S84A 5T3WA 3S9OA 4DRHB 1JXZA 1ZHZA 5F28E 2HKVA 2NPUA 3MYBA 3R9SA 4PACA 1VK5A 3T6JA 4C7OB 4AL1A 1KU2A 2UZFA 1YYXA 4LACB 1OCCC 3J06A 3N0TA 2EIJC 4L6RA 3SNHA 4G0HA 3SEOA 4CIPA 2VB6A 4NEKA 3WAQA 1G4US 3HRXA 4IZBA 4RDAA 3SXZA 2PNOA 4JW1A 4BEMJ 2TMVP 2R7XA 1RJ9A 4LERA 1ZU4A 1HW1A 5EHHA 4LDQA 4AL0A 4MVQA 5BQIA 1DOWA 3CAXA 4YJWA 4H54A 3C8GB 3EHMA 3UMIA 4WABA 3Q0JA 3POVA 1Q0GA 4MVMA 1UIYA 1Z23A 1FMVA 2MWQA 2NUPA 2XSEA 4Q7CA 5CI9A 3TQOA 2YL0A 4E0IA 5KJPA 5IY5C 2QNLA 2D5RB 5JRAA 3SWXA 2J46A 2KSFA 3HNIA 4XQ1A 3ADCA 2WB7A 2GDCA 3U8VA 2VCBA 2KGOA 4JZAA 2A68F 3E9VA 2R7SA 1WTYA 4JYLA 3K7DA 2HV7A 4LLEA 5E2QA 5E3AA 4FJWD 3DE8A 3W4YA 1NSGB 3Q7GA 2R03A 3KYIA 3K1IC 3ZC4A 4AX2A 3JRMO 1LS1A 2HW5A 1CPRA 3QXIA 4EIYA 3K6BA 2OG2A 1L3PA 1HMDA 2HJMA 3B9QA 3DXJF 3U3BA 3H02A 1IW7F 5BQHA 1Z5ZA 3MOYA 4I1OB 1ZYRF 5BUOA 3JT1A 2QLAA 5DQTA 1EKYA 2BE5F 4RBNA 4CS8A 1FFTC 2ZXPA 4Q5SF 1MMNA 4XTKA 3AQCA 3GM2A 2EILC 3N24A 1NZYB 5DS6A 2HFIA 5F5HA 1FTSA 4ONSA 3BEHA 1FNTc 2YLIA 1MMGA 3T89A 4YL0A 5KYNA 4FZWA 3DMDA 1WATA 1TWAA 2WVNA 1EF8A 1RKEA 1LVKA 3DJNB 4NQFA 4ULVA 5COFA 3WG7C 3LLIA 3TLFA 1GS9A 1T5OA 2PFDA 3EZIA 3L34A 3NYMA 2ZD9A 1NZYA 4JE9A 4MVUA 4JEAA 2A6EF 4O6MA 4U5HA 4NTFA 4U9EA 4OIRF 1G8XA 2LFDA 1KNYA 1EA8A 3H81A 1J8MF 3P5MA 2PP4A 2XLVA 4YT8A 3FDQA 2XLHA 3AG4C 1VMAA 3LEVA 3BRJA 4DRJB 2YWAA 5AC5A 4BJTA 2Q3TA 3LAYA 3V5ZA 2Y69C 4NTAA 4IARA 4LDRA 3WHNA 4YT2A 2GWWA 2L9JA 1WZ8A 4ZLCA 3W8IA 1E83A 1KTMA 3GM1A 2PX3A 1WASA 2OCCC 4N6HA 1Z63A 2ZQRA 3HNLA 4ZLDA 2KK1A 3ZQVA 3PHF2 1OCRC 2AVKA 2HZ8A 3RVYA 5KYYA 1YJGA 3OEOA 2BL2A 2VASA 3Q6MA 5COGA 5COMA 1E85A 3I47A 1WGWA 3RIPA 1BDJB 2F22A 3QW0A 1Q52A 2QY9A 3ZTMA 4EBKA 2YVKA 1ZU5A 1C03A 1APCA 1OKKD 2A0BA 2CDQA 4O79A 3OWTA 1BZ4A 2YL3A 3FMSA 2CYDA 4DJ9A 4IJJA 5B1BC 1CGOA 3MFNA 3V5XA 4CS7A 3ZTZA 1V55C 1Q0FA 1EY3A 2IXOA 3IEEA 2Y3HA 2QE9A 3X2QC 1VB5A 2XL4A 4IAQA 3UMHA 3A4LA 1YZAA 4M63A 1WOLA 4CJGA 4NNQA 4ZU2A 1I4ZA 1YA7O 3NMJA 2ZQQA 4CBEA 4P6IC 2VCAA 4N4WA 1MQVA 1OQCA 2J0XA 1R5ID 2G3KA 3AG3C 3O4XE 1PD1A 1XZQA 2EINC 2XM0A 3AGUA 4J30B 2L6FA 2Q9BA 4R32A 4MTGA 1RCPA 2B0JA 3R2PA 1V54C 4K2NA 1G4WR 1OR2A 2Y3BA 5A69A 2J0WA 4U5GA 4Z9HA 1C17M 1D1CA 3O6XA 1ZW3A 3UNGC 5L0IA 4QIJA 5JBWA 1ZHYA 1QPUA 2EPKX 1T6QA 3K1IA 4W8PA 1TKNA 4WCZA 1TFOB 2EIMC 2YRFA 3A4NA 1NFNA 2AU5A 2L6GA 4MQ9F 1VOMA 3KYJA 3EH1A 1O5HA 1NZEA 3RQEA 1E2XA 3A4MA 3RSIA 3C8ZA 5D92A 3T4RA 1IZMA 2KNHA 1W2WA 2YLGA 2J9VA 4I1MA 2FW2A 3A9CA 3NYLA 4W8KA 1D1AA 4HE8D 3TD7A 1OW6A 4AK9A 4Q4ZF 4U1AA 1ZHTA 1TWCA 3F47A 3H2UA 4MVZA 3M4CA 3VRCA 1A41A 4U5DE 4EUKB 1DOVA 3ATPA 3U8PA 3IRBA 1SMYF 2M4EA 2ZXOA 5T1DB 1M2VB 3T6BA 2KYHA 4DRIB 1JPJA 2VCCA 4RD9A 3B0UX 3R9TA 2H7VC 2R7RA 3QVZA 1M2OA 1HW2A 1A7EA 2KJGA 1K04A 2ASRA 2WL8A 3DZAA 1Z6AA 4QI2A 1SR2A 3SLLA 2NSGA 2P7VA 4MOUA 4XLPF 4JIOA 2XXAA 2A6HF 2L7AA 2LD6A 3T6GB 4O6NA 3C63A 4PFOA 1OXKA 1RKEB 4XPYA 1U89A 1LM3B 4BJ5C 4KI2A 4JCHA 4XPXA 2PF4E 3LNRA 5KYUA 4E7ZA 1VTMP 5JLIA 3SXMA 3HINA 1U6HA 4XEFA 1ORJA 3NKEA 1OW8A 5A6BA 2R7VA 2I15A 1OR3A 1M56C 1TR2A 2KW3C 4J7TA 3W2VA 4J7YA 3GWNA 5AC4A 2R02A 4JWVA 3JSZA 4IB4A 2DI3A 3M79A 4E0HA 1HZDA 3Q7LA 1FR0A 2PBEA 1JRAA 1ZHWA 2P1AA 1QLEC 1H6GA 4QIIA 3ADBA 1E86A 4I4ZA 2EPNA 3S29A 1G5ZA 2PX0A 2ETSA 4WGYA 1JR8A 2AWYA 2LK4A 2XS1A 4DVZA 1YAUO 5B3SC 1Y64B 5KYUB 5L0HA 1R4TA 4CS9C 1N1CA 1V74B 3QTHA 2XXAB 1HY5A 1MNEA 2KQ9A 5L0GA 4JTDB 3HJCA 1GM5A 4JURI 2PBPA 1YA9A 2EPOA 3U2MA 2RSEB 4CX9A 2IXPA 1UG7A 3MLGA 4E18A 3L8JA 1SYQA 5TJ5E 2XLOA 4JJGA 4OIPF 1LE2A 2YL1A 4WJ0A 5A6BD 2IXMA 3SXKA 3SYNA 3KKBA 3RQGA 4ELXA 3EHNA 3EGXA 3F46A 3MYFA 2H7OA 4NTBA 5B3IA 1LI5A 2VREA 1J8YF 3DJUB 3FXHA 3R0OA 1OW7A 2L81A 1WWPA 2FFHA 1LI7A 3DM9B 1OCOC 3JSEO 2L6HA 5JBXA 4FESA 2IYLD 3M1CB 3SXYA 5E33A 4MTFA 4N06A 3V5YA 3T9OA 3HKKA 1I5NA 2CNWA 5CI8A 5KYXA 4IAOA 1OCZC 5FCLA 3AGTA 2ICWG 3M15A 4YK5A 4BJ6C 1L7CA 3FAPB 3LNMB 4FX5A 4MVSA 5DS5A 2R7UA 3NDBB 1XZPA 5L0CA 3RKOF 3PZKA 5C9GA 2P63A 1B68A 2YHSA 4JTAB 5FZTA 2CCYA 4BPMA 3UR3C 2R7TA 3DKAA 4JCSA 2IXNA 3C7JA 3I4UA 2P0NA 3MX3A 2J7PD 2JPUA 2OEXA 2XLWA 2Y3DA 4JRZA 4PR9A 1Y6DA 3CEXA 3GORA 3AG1C 5AGFA 3CZ6A 3UGPA 2YLDA 5EK0A 2OEVA 2GAQA 5KYXB 2OJED 2WZFA 4JKVA 3LEOA 4MW3A 2R7QA 1SZIA 1F1MA 3S90A 1HE1A 1H9TA 3NYJA 1T6UA 256BA 1UFBA 3B71A 1D0XA 3QW1A 2J7PA 2OKUA 5HSWA 3QZCA 3G64A 1FFHA 2NSFA 3GM3A 1YDIA 3A11A 2QQ3A 4PFPA 4C3BA 4CDVA 1A7DA 4WGZA 3KQFA 4MTOA 3ADDA 2HSBA 3R7CA 2MHRA 3TJ6A 4KBLA 4NY3A 4O7GA 4YN0B 2MYSA 3K33A 1ZVZA 5JP7A 1CPQA 2R7OA 1QVXA 3U3FA 3O39A 3QK8A 1TWGA 1JMWA 2YQYA 5DQZA 4DXWA 3ABKC 4D4NA 3JYHA 1E84A 4BJ1A 4CIHA 1M6TA 1TQGA 4G7HF 4J32B 4X0RA 3RH3A 4G7ZF 1Y4CA 3EGXB 3UGOA 3JCUQ 2IOQA 4UDVA 3OA1A 1V4AA 4IZCA 2YEVA 1EI7A 2HUJA 3I5PA 5JT4A 1NLXA 4IWBA 3C62A 4YT5A 2FAPB 2HV6A 4U18A 3DD7A 4ULWA 2JX0A 3TK0A 2O9XA 3ZQYA 1QQ3A 2M64A 2ZXWC 1LKXA 4U5FE 1I4YA 5CIVA 2XLMA 2J9BA 3PMRA 4PJLA 2VX2A 3K66A 4I3MA 4BG0A 3AG2C 4G7OF 4GEHB 4JFCA 4OG1A 3OC7A 1Z3IX 2DYSC 2OQMA 3B0PA 3EFOA 4PJJA 3WODF 5JVEA 3U5SA 1AEPA 4H4KC 5DVWA 4CS9A 1YVIA 1K40A 4PJMA 3O55A 1Q51A 3Q6NA 1U0BB 2Y3GA 4AE4A 4YL3A 3T88A 5JUAA 2XRHA 4JOTA 2BC5A 3EFOB 4ELSA 1A7VA 1RXQA 1YARO 2KC3A 4JJFA 5D91A 1AUEA 2W9YA 3S28A 4PJNA 2VC9A 4FWVA 4IZDA 2YKZA 4NC3A 1MJ3A 1BR4A 1UX5A 4MVOA 1BBHA 3AOUA 2GA0A 2F6QA 5T3TA 2NG1A 2J9UA 3DE9A 2FBMA 1M2VA 1QZXA 3Q0GA 1VYKA 3EJNA 1Q0MA 3DAFA 4QI0A 3V7OA 2QTVA 3IHUA 4XPWA 2Q9AA 4ANJA 2DUBA 3QMKA 1Z7Qc 4F47A 2XLDA 1EQ1A 3RFYA 3RQFA 2XLEA 3HNJA 3ZVRA 3Q1TA 4QDLA 4K3WA 4JCZA 1RJMA 3L8IA 4I42A 1YZCA 3GWLA 3EPVA 1PV3A 3HTKC 1GGQA 3O10A 4BJ6A 2HMZA 3G4XA 2OJQA 4KC9A 4O6YA 3T8AA 4MW8A 3W8IB 1FAPB 1SF8A 2XS8A 3FHDA 3JRTA 4XWJA 3RF3A 4GEHA 4U5EE 3RW0A 4A2NB 4EBJA 3JYYA 4EHPA 5EGYA 3TULA 3ECSA 3LLKA 2D4UA 1DUBA 1K05A 3AQBA 3PCVA 1BR2A 2G62A 4EBBA 3E70C 4MVRA 1ORSC 2AWCA 2J9WA 3IQTA 3NRHA 4HEAJ 4U19A 1LE4A 4IRUA 1FMWA 1S05A 1VLSA 2RD9A 3GEHA 1LPEA 3FAJA 2DB4A 4P9TA 5B1AC 1NG1A 3W8HA 2NUTB 2DGJA 1JPNA 1NFOA 3M4BA 4I44A 3MBGA 1ORYA 2V26A 2EPMX 4BJ5A 3KH2A 3NKDA 1MMAA 3KPHA 4XEVA 5JSLA 5BQGA 4YWQA 3IQCA 2LSEA 4IGGA 4N6CA 4C7OA 2XL6A 1YLMA 2IEXA 3GANA 3VM6A 4B6IA 1YYJA 4CSAC 3X1OA 3UMKA 4C3EA 2Z15A 1RJNA 4OIQF 2OU6A 3H65A 2WVQA 3LESA 3NMIA 2E87A 2P6VA 2CGEA 3L1MA 4U5BE 1H7IA 1T01A 2I8BA 4D4XA 2EPLX 3KL4A 4PK4A 1ZW2A 2A0UA 3ZIBA 5DLJA 2IM8A 2V3CC 2LP4A 3FOPA 3JTLO 2HMQA 5L0DA 3DWWA 3S0XA 3SP1A 3ZDLA 2NUPB 2J8WA 4YT4A 1JOGA 1A0BA 5GPGB 1PD0A 3JZ0A 1Q0KA 2A69F 3IQ6A 4NCQA 3U9MA 2Y39A 4KNWA 4DBRA 2ZXRA 5DS4A 4I52A 1ZZPA 3G4ZA 3LUTB 4K7BA 4FAPB 5KYYB 4KNPA 1TFKB 2LQGA 5L3VA 4CDYA 3GEIA 3QXZA 3VAYA 2A1DD 2HJ3A 3TJ5A 4JTCB 2HS5A 3ASNC 1GQAA 1H9GA 2Q4FA 4OD4A 3HLZA 3EGDA 4Z9JA 2G3VA 4EWCA 4OIOF 4OD5A 4ER9A 3VF0A 2WZGA 4E7SA 1D1BA 5L3QA 1EF9A 1RJ9B 2C03A 2ZPAA 2W4MA 2XL8A 3EQLF 3C8GD 2R25A 1NBBA 3C8GA 2GTRA 1WN0A 4KNVA 4CDAA 2Q7RA 4DOZA 3IQ5A 2R7WA 2R9RB 2X51A 1VLTA 5KYWA 4A4AA 4CJOA 3KMIA 4OLQA 4MI2A 2HSQA 1NU7D 3LJBA 3U2LA 3CSKA 3EG9B 4MNDA 2J45A 3B29A 3ABMC 3H2VA 2W4BA 4ELWA 1UX4A 3AJMA 1BR1A 4XLNF 1D0ZA 4K0DA 2B0HA 5JS5A 4XEKA 2YZSA 3ITFA 1D0YA 3TRRA 1C02A 2JD3A 1AVOB 4HFKB 1RMVA 4U9DA 4C3DA 1LS4A 4JVSA 2Q9CA 3DI5A 1CGNA 3W8HB 2DYRC 4U5CE 3W2WA 4CSAA 1OKKA 3EG9A 2UUIA 2EJ5A 1NU9C 2H7BA 1ZHXA 1PCXA 3EH2A 4AE4B 2H8AA 4EKWA 3NMKA 3VYWA 1MMDA 1T9KA 4GYTA 4LLCA 2R05A 4MS2A 2VH3A 3U0CA 1Q0DA 3LS1A 2W45A 1QSPA 5F5FA 3I5QA 4LDKA 4EMLA 1ST6A
chains in the Genus database with same CATH topology
3C8GB 4XEVA 1ZZPA 3GM1A 3RQFA 4GEHB 3ADDA 3RQEA 2HSBA 1UX4A 3A4MA 3AJMA 3GM2A 3A4LA 2KK1A 3GM3A 1RJMA 3L8IA 2P63A 1WOLA 1OW8A 4NNQA 1PV3A 2Q00A 3O10A 4XEKA 1OW6A 1QVXA 3U3FA 1K40A 1KTMA 3L8JA 3ADCA 3W8IB 2JPUA 3C18A 4NQFA 4EBJA 3S9OA 3TULA 3JYYA 4XEFA 3IRBA 2PBEA 5F28E 3AM1A 3O4XE 3RQGA 1WTYA 1K05A 3MFNA 3K7DA 3ADBA 3W8HB 1O3UA 4EBKA 2L6FA 3C8GD 4R32A 1OW7A 1KNYA 1WWPA 3C8GA 2L6HA 2LK4A 1UX5A 1K04A 1V4AA 1Y64B 3BRJA 2YWAA 3U0CA 1UFBA 1JOGA 2JX0A 3B71A 3JZ0A 3A4NA 2L6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G B;  4XEV A;  1ZZP A;  3GM1 A;  3RQF A;  4GEH B;  2HSB A;  3RQE A;  3GM2 A;  3AJM A;  4XEF A;  2KK1 A;  2Q00 A;  3L8I A;  1WOL A;  1OW8 A;  3O10 A;  1PV3 A;  4XEK A;  1OW6 A;  1QVX A;  3U3F A;  1K40 A;  1KTM A;  3L8J A;  3W8I B;  2JPU A;  3C18 A;  4NQF A;  4EBJ A;  3S9O A;  3TUL A;  3JYY A;  5F28 E;  2PBE A;  1WTY A;  3RQG A;  3MFN A;  1K05 A;  4EBK A;  3K7D A;  1O3U A;  3W8H B;  2L6F A;  3C8G D;  4R32 A;  1OW7 A;  1KNY A;  1WWP A;  3C8G A;  2L6H A;  2LK4 A;  1K04 A;  1V4A A;  3BRJ A;  2YWA A;  3U0C A;  1UFB A;  1JOG A;  2JX0 A;  3B71 A;  3JZ0 A;  3GM3 A;  2L6G A; 
#chains in the Genus database with same CATH topology
 2WVO A;  3K1H A;  4Z9I A;  3DAG A;  1XWJ A;  5A6J A;  3GEE A;  5L0F A;  1T6I A;  1RKC A;  1HE9 A;  2QUP A;  3QVY A;  3S27 A;  1DCI A;  3ZWI A;  1HMO A;  2LIG A;  1OXB A;  3EGD B;  3GOD A;  2YL7 A;  5E3C A;  4DVY P;  2P61 A;  3C18 A;  2LFF A;  3G50 A;  4K1O A;  3CQZ A;  3ZSU A;  4DBQ A;  5A6A A;  3AM1 A;  2XM4 A;  1JAF A;  3ASO C;  2IBF A;  3LS0 A;  4G78 A;  1O3U A;  5A6K A;  5K0I A;  3ABL C;  3MYI A;  2X0C A;  3FDU A;  4GQH A;  1M57 C;  2C04 A;  5KYW B;  3FVY A;  3SZR A;  3US6 A;  3PDM P;  3EZH A;  2CW0 F;  4F4B A;  1VYI A;  3DM5 A;  2OOC A;  1QKR A;  1MND A;  2CNW D;  2EIK C;  3L0I A;  2LCH A;  4OIN F;  1O87 A;  3TOL A;  4CS8 C;  4JC7 A;  2AP3 A;  3IPM O;  1LIH A;  3RYL A;  1TWH A;  3N2Z B;  3TOM A;  4E17 A;  4P9F A;  3RVZ A;  2WZL A;  3ZG1 A;  5HV9 A;  3HNK A;  1S7Z A;  2NUT A;  4BEJ A;  1CGM E;  2UUH A;  3U9J A;  2Q00 A;  3NG1 A;  4HFF B;  4FZW C;  4JEB A;  2FGY A;  5L0J A;  4YL1 A;  2PPY A;  3FOO A;  2GFH A;  3B0V C;  3S84 A;  5T3W A;  3S9O A;  4DRH B;  1JXZ A;  1ZHZ A;  5F28 E;  2HKV A;  2NPU A;  3MYB A;  3R9S A;  4PAC A;  1VK5 A;  3T6J A;  4C7O B;  4AL1 A;  1KU2 A;  2UZF A;  1YYX A;  4LAC B;  1OCC C;  3J06 A;  3N0T A;  2EIJ C;  4L6R A;  3SNH A;  4G0H A;  3SEO A;  4CIP A;  2VB6 A;  4NEK A;  3WAQ A;  1G4U S;  3HRX A;  4IZB A;  4RDA A;  3SXZ A;  2PNO A;  4JW1 A;  4BEM J;  2TMV P;  2R7X A;  1RJ9 A;  4LER A;  1ZU4 A;  1HW1 A;  5EHH A;  4LDQ A;  4AL0 A;  4MVQ A;  5BQI A;  1DOW A;  3CAX A;  4YJW A;  4H54 A;  3C8G B;  3EHM A;  3UMI A;  4WAB A;  3Q0J A;  3POV A;  1Q0G A;  4MVM A;  1UIY A;  1Z23 A;  1FMV A;  2MWQ A;  2NUP A;  2XSE A;  4Q7C A;  5CI9 A;  3TQO A;  2YL0 A;  4E0I A;  5KJP A;  5IY5 C;  2QNL A;  2D5R B;  5JRA A;  3SWX A;  2J46 A;  2KSF A;  3HNI A;  4XQ1 A;  3ADC A;  2WB7 A;  2GDC A;  3U8V A;  2VCB A;  2KGO A;  4JZA A;  2A68 F;  3E9V A;  2R7S A;  1WTY A;  4JYL A;  3K7D A;  2HV7 A;  4LLE A;  5E2Q A;  5E3A A;  4FJW D;  3DE8 A;  3W4Y A;  1NSG B;  3Q7G A;  2R03 A;  3KYI A;  3K1I C;  3ZC4 A;  4AX2 A;  3JRM O;  1LS1 A;  2HW5 A;  1CPR A;  3QXI A;  4EIY A;  3K6B A;  2OG2 A;  1L3P A;  1HMD A;  2HJM A;  3B9Q A;  3DXJ F;  3U3B A;  3H02 A;  1IW7 F;  5BQH A;  1Z5Z A;  3MOY A;  4I1O B;  1ZYR F;  5BUO A;  3JT1 A;  2QLA A;  5DQT A;  1EKY A;  2BE5 F;  4RBN A;  4CS8 A;  1FFT C;  2ZXP A;  4Q5S F;  1MMN A;  4XTK A;  3AQC A;  3GM2 A;  2EIL C;  3N24 A;  1NZY B;  5DS6 A;  2HFI A;  5F5H A;  1FTS A;  4ONS A;  3BEH A;  1FNT c;  2YLI A;  1MMG A;  3T89 A;  4YL0 A;  5KYN A;  4FZW A;  3DMD A;  1WAT A;  1TWA A;  2WVN A;  1EF8 A;  1RKE A;  1LVK A;  3DJN B;  4NQF A;  4ULV A;  5COF A;  3WG7 C;  3LLI A;  3TLF A;  1GS9 A;  1T5O A;  2PFD A;  3EZI A;  3L34 A;  3NYM A;  2ZD9 A;  1NZY A;  4JE9 A;  4MVU A;  4JEA A;  2A6E F;  4O6M A;  4U5H A;  4NTF A;  4U9E A;  4OIR F;  1G8X A;  2LFD A;  1KNY A;  1EA8 A;  3H81 A;  1J8M F;  3P5M A;  2PP4 A;  2XLV A;  4YT8 A;  3FDQ A;  2XLH A;  3AG4 C;  1VMA A;  3LEV A;  3BRJ A;  4DRJ B;  2YWA A;  5AC5 A;  4BJT A;  2Q3T A;  3LAY A;  3V5Z A;  2Y69 C;  4NTA A;  4IAR A;  4LDR A;  3WHN A;  4YT2 A;  2GWW A;  2L9J A;  1WZ8 A;  4ZLC A;  3W8I A;  1E83 A;  1KTM A;  3GM1 A;  2PX3 A;  1WAS A;  2OCC C;  4N6H A;  1Z63 A;  2ZQR A;  3HNL A;  4ZLD A;  2KK1 A;  3ZQV A;  3PHF 2;  1OCR C;  2AVK A;  2HZ8 A;  3RVY A;  5KYY A;  1YJG A;  3OEO A;  2BL2 A;  2VAS A;  3Q6M A;  5COG A;  5COM A;  1E85 A;  3I47 A;  1WGW A;  3RIP A;  1BDJ B;  2F22 A;  3QW0 A;  1Q52 A;  2QY9 A;  3ZTM A;  4EBK A;  2YVK A;  1ZU5 A;  1C03 A;  1APC A;  1OKK D;  2A0B A;  2CDQ A;  4O79 A;  3OWT A;  1BZ4 A;  2YL3 A;  3FMS A;  2CYD A;  4DJ9 A;  4IJJ A;  5B1B C;  1CGO A;  3MFN A;  3V5X A;  4CS7 A;  3ZTZ A;  1V55 C;  1Q0F A;  1EY3 A;  2IXO A;  3IEE A;  2Y3H A;  2QE9 A;  3X2Q C;  1VB5 A;  2XL4 A;  4IAQ A;  3UMH A;  3A4L A;  1YZA A;  4M63 A;  1WOL A;  4CJG A;  4NNQ A;  4ZU2 A;  1I4Z A;  1YA7 O;  3NMJ A;  2ZQQ A;  4CBE A;  4P6I C;  2VCA A;  4N4W A;  1MQV A;  1OQC A;  2J0X A;  1R5I D;  2G3K A;  3AG3 C;  3O4X E;  1PD1 A;  1XZQ A;  2EIN C;  2XM0 A;  3AGU A;  4J30 B;  2L6F A;  2Q9B A;  4R32 A;  4MTG A;  1RCP A;  2B0J A;  3R2P A;  1V54 C;  4K2N A;  1G4W R;  1OR2 A;  2Y3B A;  5A69 A;  2J0W A;  4U5G A;  4Z9H A;  1C17 M;  1D1C A;  3O6X A;  1ZW3 A;  3UNG C;  5L0I A;  4QIJ A;  5JBW A;  1ZHY A;  1QPU A;  2EPK X;  1T6Q A;  3K1I A;  4W8P A;  1TKN A;  4WCZ A;  1TFO B;  2EIM C;  2YRF A;  3A4N A;  1NFN A;  2AU5 A;  2L6G A;  4MQ9 F;  1VOM A;  3KYJ A;  3EH1 A;  1O5H A;  1NZE A;  3RQE A;  1E2X A;  3A4M A;  3RSI A;  3C8Z A;  5D92 A;  3T4R A;  1IZM A;  2KNH A;  1W2W A;  2YLG A;  2J9V A;  4I1M A;  2FW2 A;  3A9C A;  3NYL A;  4W8K A;  1D1A A;  4HE8 D;  3TD7 A;  1OW6 A;  4AK9 A;  4Q4Z F;  4U1A A;  1ZHT A;  1TWC A;  3F47 A;  3H2U A;  4MVZ A;  3M4C A;  3VRC A;  1A41 A;  4U5D E;  4EUK B;  1DOV A;  3ATP A;  3U8P A;  3IRB A;  1SMY F;  2M4E A;  2ZXO A;  5T1D B;  1M2V B;  3T6B A;  2KYH A;  4DRI B;  1JPJ A;  2VCC A;  4RD9 A;  3B0U X;  3R9T A;  2H7V C;  2R7R A;  3QVZ A;  1M2O A;  1HW2 A;  1A7E A;  2KJG A;  1K04 A;  2ASR A;  2WL8 A;  3DZA A;  1Z6A A;  4QI2 A;  1SR2 A;  3SLL A;  2NSG A;  2P7V A;  4MOU A;  4XLP F;  4JIO A;  2XXA A;  2A6H F;  2L7A A;  2LD6 A;  3T6G B;  4O6N A;  3C63 A;  4PFO A;  1OXK A;  1RKE B;  4XPY A;  1U89 A;  1LM3 B;  4BJ5 C;  4KI2 A;  4JCH A;  4XPX A;  2PF4 E;  3LNR A;  5KYU A;  4E7Z A;  1VTM P;  5JLI A;  3SXM A;  3HIN A;  1U6H A;  4XEF A;  1ORJ A;  3NKE A;  1OW8 A;  5A6B A;  2R7V A;  2I15 A;  1OR3 A;  1M56 C;  1TR2 A;  2KW3 C;  4J7T A;  3W2V A;  4J7Y A;  3GWN A;  5AC4 A;  2R02 A;  4JWV A;  3JSZ A;  4IB4 A;  2DI3 A;  3M79 A;  4E0H A;  1HZD A;  3Q7L A;  1FR0 A;  2PBE A;  1JRA A;  1ZHW A;  2P1A A;  1QLE C;  1H6G A;  4QII A;  3ADB A;  1E86 A;  4I4Z A;  2EPN A;  3S29 A;  1G5Z A;  2PX0 A;  2ETS A;  4WGY A;  1JR8 A;  2AWY A;  2LK4 A;  2XS1 A;  4DVZ A;  1YAU O;  5B3S C;  1Y64 B;  5KYU B;  5L0H A;  1R4T A;  4CS9 C;  1N1C A;  1V74 B;  3QTH A;  2XXA B;  1HY5 A;  1MNE A;  2KQ9 A;  5L0G A;  4JTD B;  3HJC A;  1GM5 A;  4JUR I;  2PBP A;  1YA9 A;  2EPO A;  3U2M A;  2RSE B;  4CX9 A;  2IXP A;  1UG7 A;  3MLG A;  4E18 A;  3L8J A;  1SYQ A;  5TJ5 E;  2XLO A;  4JJG A;  4OIP F;  1LE2 A;  2YL1 A;  4WJ0 A;  5A6B D;  2IXM A;  3SXK A;  3SYN A;  3KKB A;  3RQG A;  4ELX A;  3EHN A;  3EGX A;  3F46 A;  3MYF A;  2H7O A;  4NTB A;  5B3I A;  1LI5 A;  2VRE A;  1J8Y F;  3DJU B;  3FXH A;  3R0O A;  1OW7 A;  2L81 A;  1WWP A;  2FFH A;  1LI7 A;  3DM9 B;  1OCO C;  3JSE O;  2L6H A;  5JBX A;  4FES A;  2IYL D;  3M1C B;  3SXY A;  5E33 A;  4MTF A;  4N06 A;  3V5Y A;  3T9O A;  3HKK A;  1I5N A;  2CNW A;  5CI8 A;  5KYX A;  4IAO A;  1OCZ C;  5FCL A;  3AGT A;  2ICW G;  3M15 A;  4YK5 A;  4BJ6 C;  1L7C A;  3FAP B;  3LNM B;  4FX5 A;  4MVS A;  5DS5 A;  2R7U A;  3NDB B;  1XZP A;  5L0C A;  3RKO F;  3PZK A;  5C9G A;  2P63 A;  1B68 A;  2YHS A;  4JTA B;  5FZT A;  2CCY A;  4BPM A;  3UR3 C;  2R7T A;  3DKA A;  4JCS A;  2IXN A;  3C7J A;  3I4U A;  2P0N A;  3MX3 A;  2J7P D;  2JPU A;  2OEX A;  2XLW A;  2Y3D A;  4JRZ A;  4PR9 A;  1Y6D A;  3CEX A;  3GOR A;  3AG1 C;  5AGF A;  3CZ6 A;  3UGP A;  2YLD A;  5EK0 A;  2OEV A;  2GAQ A;  5KYX B;  2OJE D;  2WZF A;  4JKV A;  3LEO A;  4MW3 A;  2R7Q A;  1SZI A;  1F1M A;  3S90 A;  1HE1 A;  1H9T A;  3NYJ A;  1T6U A;  256B A;  1UFB A;  3B71 A;  1D0X A;  3QW1 A;  2J7P A;  2OKU A;  5HSW A;  3QZC A;  3G64 A;  1FFH A;  2NSF A;  3GM3 A;  1YDI A;  3A11 A;  2QQ3 A;  4PFP A;  4C3B A;  4CDV A;  1A7D A;  4WGZ A;  3KQF A;  4MTO A;  3ADD A;  2HSB A;  3R7C A;  2MHR A;  3TJ6 A;  4KBL A;  4NY3 A;  4O7G A;  4YN0 B;  2MYS A;  3K33 A;  1ZVZ A;  5JP7 A;  1CPQ A;  2R7O A;  1QVX A;  3U3F A;  3O39 A;  3QK8 A;  1TWG A;  1JMW A;  2YQY A;  5DQZ A;  4DXW A;  3ABK C;  4D4N A;  3JYH A;  1E84 A;  4BJ1 A;  4CIH A;  1M6T A;  1TQG A;  4G7H F;  4J32 B;  4X0R A;  3RH3 A;  4G7Z F;  1Y4C A;  3EGX B;  3UGO A;  3JCU Q;  2IOQ A;  4UDV A;  3OA1 A;  1V4A A;  4IZC A;  2YEV A;  1EI7 A;  2HUJ A;  3I5P A;  5JT4 A;  1NLX A;  4IWB A;  3C62 A;  4YT5 A;  2FAP B;  2HV6 A;  4U18 A;  3DD7 A;  4ULW A;  2JX0 A;  3TK0 A;  2O9X A;  3ZQY A;  1QQ3 A;  2M64 A;  2ZXW C;  1LKX A;  4U5F E;  1I4Y A;  5CIV A;  2XLM A;  2J9B A;  3PMR A;  4PJL A;  2VX2 A;  3K66 A;  4I3M A;  4BG0 A;  3AG2 C;  4G7O F;  4GEH B;  4JFC A;  4OG1 A;  3OC7 A;  1Z3I X;  2DYS C;  2OQM A;  3B0P A;  3EFO A;  4PJJ A;  3WOD F;  5JVE A;  3U5S A;  1AEP A;  4H4K C;  5DVW A;  4CS9 A;  1YVI A;  1K40 A;  4PJM A;  3O55 A;  1Q51 A;  3Q6N A;  1U0B B;  2Y3G A;  4AE4 A;  4YL3 A;  3T88 A;  5JUA A;  2XRH A;  4JOT A;  2BC5 A;  3EFO B;  4ELS A;  1A7V A;  1RXQ A;  1YAR O;  2KC3 A;  4JJF A;  5D91 A;  1AUE A;  2W9Y A;  3S28 A;  4PJN A;  2VC9 A;  4FWV A;  4IZD A;  2YKZ A;  4NC3 A;  1MJ3 A;  1BR4 A;  1UX5 A;  4MVO A;  1BBH A;  3AOU A;  2GA0 A;  2F6Q A;  5T3T A;  2NG1 A;  2J9U A;  3DE9 A;  2FBM A;  1M2V A;  1QZX A;  3Q0G A;  1VYK A;  3EJN A;  1Q0M A;  3DAF A;  4QI0 A;  3V7O A;  2QTV A;  3IHU A;  4XPW A;  2Q9A A;  4ANJ A;  2DUB A;  3QMK A;  1Z7Q c;  4F47 A;  2XLD A;  1EQ1 A;  3RFY A;  3RQF A;  2XLE A;  3HNJ A;  3ZVR A;  3Q1T A;  4QDL A;  4K3W A;  4JCZ A;  1RJM A;  3L8I A;  4I42 A;  1YZC A;  3GWL A;  3EPV A;  1PV3 A;  3HTK C;  1GGQ A;  3O10 A;  4BJ6 A;  2HMZ A;  3G4X A;  2OJQ A;  4KC9 A;  4O6Y A;  3T8A A;  4MW8 A;  3W8I B;  1FAP B;  1SF8 A;  2XS8 A;  3FHD A;  3JRT A;  4XWJ A;  3RF3 A;  4GEH A;  4U5E E;  3RW0 A;  4A2N B;  4EBJ A;  3JYY A;  4EHP A;  5EGY A;  3TUL A;  3ECS A;  3LLK A;  2D4U A;  1DUB A;  1K05 A;  3AQB A;  3PCV A;  1BR2 A;  2G62 A;  4EBB A;  3E70 C;  4MVR A;  1ORS C;  2AWC A;  2J9W A;  3IQT A;  3NRH A;  4HEA J;  4U19 A;  1LE4 A;  4IRU A;  1FMW A;  1S05 A;  1VLS A;  2RD9 A;  3GEH A;  1LPE A;  3FAJ A;  2DB4 A;  4P9T A;  5B1A C;  1NG1 A;  3W8H A;  2NUT B;  2DGJ A;  1JPN A;  1NFO A;  3M4B A;  4I44 A;  3MBG A;  1ORY A;  2V26 A;  2EPM X;  4BJ5 A;  3KH2 A;  3NKD A;  1MMA A;  3KPH A;  4XEV A;  5JSL A;  5BQG A;  4YWQ A;  3IQC A;  2LSE A;  4IGG A;  4N6C A;  4C7O A;  2XL6 A;  1YLM A;  2IEX A;  3GAN A;  3VM6 A;  4B6I A;  1YYJ A;  4CSA C;  3X1O A;  3UMK A;  4C3E A;  2Z15 A;  1RJN A;  4OIQ F;  2OU6 A;  3H65 A;  2WVQ A;  3LES A;  3NMI A;  2E87 A;  2P6V A;  2CGE A;  3L1M A;  4U5B E;  1H7I A;  1T01 A;  2I8B A;  4D4X A;  2EPL X;  3KL4 A;  4PK4 A;  1ZW2 A;  2A0U A;  3ZIB A;  5DLJ A;  2IM8 A;  2V3C C;  2LP4 A;  3FOP A;  3JTL O;  2HMQ A;  5L0D A;  3DWW A;  3S0X A;  3SP1 A;  3ZDL A;  2NUP B;  2J8W A;  4YT4 A;  1JOG A;  1A0B A;  5GPG B;  1PD0 A;  3JZ0 A;  1Q0K A;  2A69 F;  3IQ6 A;  4NCQ A;  3U9M A;  2Y39 A;  4KNW A;  4DBR A;  2ZXR A;  5DS4 A;  4I52 A;  1ZZP A;  3G4Z A;  3LUT B;  4K7B A;  4FAP B;  5KYY B;  4KNP A;  1TFK B;  2LQG A;  5L3V A;  4CDY A;  3GEI A;  3QXZ A;  3VAY A;  2A1D D;  2HJ3 A;  3TJ5 A;  4JTC B;  2HS5 A;  3ASN C;  1GQA A;  1H9G A;  2Q4F A;  4OD4 A;  3HLZ A;  3EGD A;  4Z9J A;  2G3V A;  4EWC A;  4OIO F;  4OD5 A;  4ER9 A;  3VF0 A;  2WZG A;  4E7S A;  1D1B A;  5L3Q A;  1EF9 A;  1RJ9 B;  2C03 A;  2ZPA A;  2W4M A;  2XL8 A;  3EQL F;  3C8G D;  2R25 A;  1NBB A;  3C8G A;  2GTR A;  1WN0 A;  4KNV A;  4CDA A;  2Q7R A;  4DOZ A;  3IQ5 A;  2R7W A;  2R9R B;  2X51 A;  1VLT A;  5KYW A;  4A4A A;  4CJO A;  3KMI A;  4OLQ A;  4MI2 A;  2HSQ A;  1NU7 D;  3LJB A;  3U2L A;  3CSK A;  3EG9 B;  4MND A;  2J45 A;  3B29 A;  3ABM C;  3H2V A;  2W4B A;  4ELW A;  1UX4 A;  3AJM A;  1BR1 A;  4XLN F;  1D0Z A;  4K0D A;  2B0H A;  5JS5 A;  4XEK A;  2YZS A;  3ITF A;  1D0Y A;  3TRR A;  1C02 A;  2JD3 A;  1AVO B;  4HFK B;  1RMV A;  4U9D A;  4C3D A;  1LS4 A;  4JVS A;  2Q9C A;  3DI5 A;  1CGN A;  3W8H B;  2DYR C;  4U5C E;  3W2W A;  4CSA A;  1OKK A;  3EG9 A;  2UUI A;  2EJ5 A;  1NU9 C;  2H7B A;  1ZHX A;  1PCX A;  3EH2 A;  4AE4 B;  2H8A A;  4EKW A;  3NMK A;  3VYW A;  1MMD A;  1T9K A;  4GYT A;  4LLC A;  2R05 A;  4MS2 A;  2VH3 A;  3U0C A;  1Q0D A;  3LS1 A;  2W45 A;  1QSP A;  5F5F A;  3I5Q A;  4LDK A;  4EML A;  1ST6 A; 
#chains in the Genus database with same CATH homology
 3C8G B;  4XEV A;  1ZZP A;  3GM1 A;  3RQF A;  4GEH B;  3ADD A;  3RQE A;  2HSB A;  1UX4 A;  3A4M A;  3AJM A;  3GM2 A;  3A4L A;  2KK1 A;  3GM3 A;  1RJM A;  3L8I A;  2P63 A;  1WOL A;  1OW8 A;  4NNQ A;  1PV3 A;  2Q00 A;  3O10 A;  4XEK A;  1OW6 A;  1QVX A;  3U3F A;  1K40 A;  1KTM A;  3L8J A;  3ADC A;  3W8I B;  2JPU A;  3C18 A;  4NQF A;  4EBJ A;  3S9O A;  3TUL A;  3JYY A;  4XEF A;  3IRB A;  2PBE A;  5F28 E;  3AM1 A;  3O4X E;  3RQG A;  1WTY A;  1K05 A;  3MFN A;  3K7D A;  3ADB A;  3W8H B;  1O3U A;  4EBK A;  2L6F A;  3C8G D;  4R32 A;  1OW7 A;  1KNY A;  1WWP A;  3C8G A;  2L6H A;  2LK4 A;  1UX5 A;  1K04 A;  1V4A A;  1Y64 B;  3BRJ A;  2YWA A;  3U0C A;  1UFB A;  1JOG A;  2JX0 A;  3B71 A;  3JZ0 A;  3A4N A;  2L6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...