3RQFA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqfA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqfA02
4NQFA 3U3FA 1K40A 2LK4A 3C8GD 1K04A 3GM3A 3RQEA 4XEKA 2PBEA 3U0CA 3K7DA 1O3UA 2L6HA 3W8IB 1PV3A 3TULA 3MFNA 4EBJA 1ZZPA 2JX0A 2JPUA 2Q00A 4XEFA 4GEHB 2HSBA 5F28E 3RQFA 4XEVA 3C8GA 3L8IA 1OW6A 3GM2A 3L8JA 1OW7A 3B71A 3C18A 3GM1A 3O10A 2L6FA 1KTMA 2KK1A 3BRJA 2YWAA 3JZ0A 1QVXA 3RQGA 1JOGA 1WTYA 1WWPA 3C8GB 1V4AA 2L6GA 4EBKA 3S9OA 1UFBA 1K05A 1OW8A 3W8HB 1WOLA 3JYYA 4R32A 1KNYA 3AJMA
chains in the Genus database with same CATH superfamily
1OCOC 3MFNA 3VF0A 4MVMA 4OIPF 2Q9AA 2HFIA 5E3AA 2XSEA 3T9OA 1Z63A 3Q0JA 1YZCA 2H7BA 1GS9A 3KYJA 2L6HA 5FZTA 4QI0A 4Z9JA 3RQFA 3FHDA 2MHRA 4I3MA 3DM9B 1BZ4A 1QPUA 4RD9A 3RQGA 3T6BA 3AOUA 4DVZA 1APCA 1DOVA 5JUAA 1HW2A 3UGPA 4N6CA 5KYWA 2P61A 2W4MA 3KYIA 3PHF2 2B0HA 5DS4A 4DRHB 1TQGA 4WJ0A 1DCIA 4UDVA 3V7OA 2PFDA 3W8IA 3K1HA 3HNIA 4HFFB 4PFPA 4N06A 1Y4CA 1I4ZA 3S27A 2J9BA 1A7EA 4PACA 1OW6A 3JSEO 3ZIBA 3GEEA 3I5PA 2KW3C 5T3WA 1LE2A 4N4WA 4NEKA 1K05A 3QZCA 3ZDLA 2DI3A 3N24A 4E17A 1A7DA 1AUEA 1MMDA 4OIQF 1PD1A 2J7PA 5E3CA 4WGZA 4MW3A 4HFKB 1VYIA 3FDQA 4YJWA 3IEEA 3ECSA 1UFBA 3E9VA 3ZVRA 4MVSA 1DUBA 2R7TA 2QNLA 1MQVA 3RKOF 1QQ3A 1HW1A 3CQZA 5L0GA 4JZAA 1C02A 4U9DA 3IRBA 1AVOB 4I52A 3DKAA 4JIOA 1WWPA 2WZGA 1QLEC 3A9CA 3I5QA 3G50A 2NUPB 4AX2A 1SMYF 3T6GB 4DJ9A 1M2VB 3PMRA 3TOLA 1V74B 5COGA 2EPOA 3JT1A 2XM4A 3DD7A 4K2NA 3S29A 2OOCA 2YLDA 3S28A 1J8YF 2J46A 3IPMO 4N6HA 2VCCA 4FJWD 5BQIA 1HZDA 2YKZA 2F6QA 1UG7A 2YL0A 4IAOA 4RDAA 3H81A 2AU5A 4QIJA 1YAUO 4G7ZF 3I47A 3E70C 1T6IA 3Q1TA 1ZHTA 3DMDA 1MMGA 5F28E 3UMKA 1JPNA 3KL4A 3L1MA 3U9JA 5COFA 5KYUB 2LD6A 3DAFA 2M64A 2BE5F 3ATPA 1J8MF 4GEHB 3IQ5A 4BJ6A 4MTOA 3NKEA 3FVYA 1LE4A 1LI7A 3GWLA 3KMIA 4DOZA 2OKUA 2BL2A 3MLGA 2J9UA 1OCCC 4PJMA 3TJ6A 3H2VA 1EQ1A 3V5YA 5DS6A 2YEVA 3HNLA 5K0IA 4J7YA 3L8IA 2J9VA 4U5HA 3FMSA 3R0OA 3C63A 5JT4A 4JCSA 2PBEA 4B6IA 1U0BB 2PBPA 2HUJA 3J06A 3K6BA 2J45A 2R03A 3EG9A 1JAFA 4XQ1A 2WZLA 2QY9A 3TLFA 4YK5A 1OKKD 4JOTA 1JOGA 1MNDA 1YA7O 4U19A 4ONSA 4ZLDA 3JSZA 1G8XA 1Q0FA 4MQ9F 4OD5A 2KC3A 4WABA 3RIPA 1WASA 1SF8A 4I1MA 2GTRA 2R9RB 2G3VA 2C04A 1T6UA 5EGYA 5COMA 5C9GA 3DE9A 3CEXA 3EHMA 3RW0A 3NMIA 3FXHA 3L0IA 3HNJA 2X0CA 4I44A 1ZYRF 4IZCA 1EY3A 3ZWIA 4WGYA 5L0HA 4IARA 3T8AA 2OEVA 4AE4B 5AC5A 2XS1A 5IY5C 1L7CA 3RYLA 4CJGA 2AWYA 3OEOA 4CSAC 4I42A 3UMHA 1C03A 2KJGA 2LFDA 4G78A 4FX5A 3ABMC 2QE9A 3U2LA 1HE9A 1H6GA 3JRTA 2Q9CA 4G0HA 1FMWA 1AEPA 4MTGA 1NLXA 2J0WA 3PCVA 3RVYA 2XL4A 2R7WA 3OWTA 1H9GA 2NG1A 4IB4A 4JYLA 2YLIA 1SYQA 1Q0MA 2VH3A 1KNYA 3VYWA 2H7VC 5B1AC 3QW0A 3UNGC 5F5FA 2CCYA 5EK0A 3VRCA 3VM6A 4P6IC 3QK8A 4D4NA 4U5DE 4JFCA 1NU9C 4E7ZA 3ADBA 4CIHA 1YYXA 4OLQA 3RQEA 2OEXA 3ZTMA 1C17M 2YVKA 3CAXA 4YT4A 1A41A 2YQYA 1ZU4A 1RJMA 4U18A 1VB5A 2J7PD 1VTMP 4C7OB 5JSLA 2DGJA 2A0UA 4U9EA 3S0XA 1ZHXA 1QVXA 3JCUQ 4D4XA 2FGYA 2HSQA 4J7TA 2Y3GA 1GGQA 2IEXA 1OKKA 5JBWA 2XLEA 3H65A 2ZQQA 3DZAA 1E86A 1H7IA 1WATA 4IJJA 5A6BD 3H2UA 4AL1A 5KYYB 1RKEB 2D4UA 4F47A 2Q4FA 3G4ZA 2R7RA 4AL0A 4BG0A 2PNOA 4ZU2A 3Q6NA 2IXMA 3N2ZB 2O9XA 4MNDA 2R7XA 2R7QA 1FR0A 3ADCA 2ZXRA 4E7SA 4GEHA 4I4ZA 3MYBA 5B3SC 4MS2A 2GFHA 3R2PA 3UGOA 3LNMB 3R9TA 3BEHA 4NQFA 4E18A 3EGDB 2F22A 4CDYA 4DRJB 1Z23A 4BEMJ 3EFOB 3U3BA 3MX3A 1O5HA 2YL1A 1MMAA 2EJ5A 2NPUA 1M6TA 3EGXB 3KPHA 4QIIA 3LLKA 4BJTA 1B68A 3ABLC 4BJ5C 2NUTA 3C7JA 2EPNA 2AVKA 1G4WR 3F47A 4JRZA 2XS8A 2FFHA 4XEVA 2P0NA 3EPVA 2KK1A 4Q5SF 3OC7A 2ETSA 4KNPA 1ZVZA 2IXNA 4YL3A 4NCQA 5DQTA 4CBEA 1E84A 3M79A 3O4XE 1G4US 2JD3A 1WZ8A 1M57C 2PP4A 3TD7A 4EBKA 1EKYA 3PDMP 1OXKA 2QQ3A 3LUTB 3GM3A 2DUBA 1R4TA 4BJ6C 4AK9A 4AE4A 3O55A 3GWNA 3GORA 3NYLA 1SZIA 1VK5A 3SYNA 2YZSA 3MYFA 2XXAB 1LIHA 4J32B 2VCBA 1I4YA 4MVQA 1Y64B 4ULVA 1K40A 2H7OA 2A6HF 2DYSC 4HE8D 2A68F 4YT8A 4YWQA 1JXZA 1LM3B 3JYHA 3W4YA 2XM0A 1ZW3A 4JJFA 5A6BA 4YT5A 2AP3A 4CJOA 2DB4A 2I15A 4PR9A 5AGFA 4BJ5A 3FDUA 3FOPA 1WN0A 3X1OA 3AGTA 3NDBB 3NKDA 4NC3A 3TOMA 4OIOF 2R7VA 3ZG1A 3U5SA 4JWVA 2V26A 2OQMA 2HW5A 2P63A 4XPYA 4MVZA 3H02A 3GEHA 3DAGA 5A6AA 4CDAA 4BEJA 4A4AA 2EILC 5CI8A 2D5RB 2BC5A 1HE1A 4CS7A 3S84A 1T01A 1M2OA 4KC9A 3GANA 2L6GA 3ZQYA 4C7OA 3TJ5A 3UMIA 3Q7LA 3U0CA 1MMNA 1TWHA 1RMVA 3AG4C 3NRHA 4JC7A 1FNTc 3EHNA 1G5ZA 4Q7CA 5T3TA 2WZFA 5JLIA 2WL8A 3AJMA 1CGME 1GM5A 4RBNA 5KYXA 1TWCA 1RXQA 2KSFA 4WCZA 2VASA 2HSBA 1IZMA 5KYYA 1RKEA 4U5FE 2IBFA 1E85A 5L3VA 256BA 3SXYA 4JCZA 4C3EA 1EA8A 4NNQA 2Z15A 5L0JA 3HNKA 2ZQRA 3C18A 4DXWA 2ZXWC 1ZHZA 2XLVA 3S9OA 4C3BA 1U89A 2XRHA 3U3FA 2Y3BA 4YL0A 3C8ZA 3TK0A 1WGWA 4JEAA 2B0JA 2KYHA 2YL3A 2R25A 3TQOA 4U5BE 2ZXOA 3I4UA 2EIKC 1L3PA 4U5CE 4Z9HA 4Q4ZF 1NG1A 1Q51A 3EFOA 3ZSUA 1T6QA 2PX3A 2CYDA 4Z9IA 5BQHA 3EGXA 2VB6A 2XL6A 4L6RA 1N1CA 3A4NA 3QVZA 3IQTA 3RH3A 3C8GB 4JEBA 3JYYA 4OG1A 2A69F 5A6JA 2IM8A 2EINC 4EHPA 3DE8A 1YLMA 2Q9BA 4XPWA 3U8PA 2LSEA 4EKWA 1XZQA 4NTAA 2WVQA 4X0RA 2XL8A 4FESA 5HSWA 3RSIA 1SR2A 4NY3A 1Q0DA 3MYIA 3QW1A 3EJNA 1BR1A 3LNRA 2Y3HA 3M15A 4IWBA 1LS4A 4LDKA 5L0DA 2LK4A 2OG2A 4PJNA 1ZHWA 1PCXA 2IXPA 1I5NA 1H9TA 2XXAA 4XTKA 3B29A 1D0YA 3QTHA 1UX4A 3ZTZA 3QVYA 4LDRA 1OR3A 2NSGA 2EIJC 2RSEB 5DS5A 1Z3IX 3AGUA 4KNWA 1EI7A 2LIGA 3LJBA 3SZRA 1OCZC 2Y39A 5JS5A 1A7VA 2OJED 5BQGA 4JCHA 1TFOB 5L3QA 2G62A 3T89A 2HZ8A 2KQ9A 3O10A 4JURI 2PPYA 2GWWA 4F4BA 1XWJA 4NTBA 2CW0F 4YT2A 1A0BA 2IXOA 2NUPA 1CPRA 3C8GD 4PJJA 1M2VA 4BPMA 1FMVA 2ZPAA 1YVIA 3T88A 1U6HA 2PF4E 3A11A 1QZXA 2HJ3A 5HV9A 2XLDA 4IZBA 4P9FA 2W45A 4LDQA 1D0XA 4O6NA 3ASNC 1E2XA 2CDQA 1OXBA 5FCLA 4EUKB 3QMKA 4XWJA 4JW1A 3DWWA 1KU2A 1YYJA 1GQAA 1ORSC 4CDVA 2FW2A 3CSKA 4YL1A 4R32A 5JRAA 2WVOA 2MYSA 2Y3DA 1Q0GA 3B0PA 2LCHA 5KYNA 1Q52A 4G7HF 4JTDB 3CZ6A 1D1BA 4EBBA 3EZHA 4W8KA 5KYUA 3ADDA 2ZD9A 2M4EA 3LAYA 5KJPA 4LLEA 2Q3TA 1DOWA 1NZYB 1JMWA 1FFHA 2P1AA 4JTAB 5B1BC 4HEAJ 1FTSA 2FAPB 1RJNA 1HY5A 3SP1A 4G7OF 1UX5A 5D91A 3EG9B 1O87A 1HMDA 3LEVA 3RVZA 5JVEA 1YDIA 1OCRC 3W8HB 2XLOA 3DJUB 1VYKA 2WB7A 1T9KA 5A6KA 2EPLX 1FFTC 2X51A 4O6YA 5EHHA 1T5OA 4MVUA 3TRRA 2R02A 3W2VA 3EQLF 1BBHA 2FBMA 1ZHYA 1ZU5A 2QLAA 1Y6DA 4EBJA 3VAYA 3V5XA 4K7BA 3U2MA 1ZW2A 2ASRA 2HV7A 4EIYA 3K66A 3IQCA 1MNEA 2E87A 3FAJA 1ST6A 5AC4A 2Y69C 4MI2A 2HKVA 3OA1A 4A2NB 3T4RA 3FOOA 1RKCA 4XLPF 2HMZA 3X2QC 2XLWA 3LS1A 1RJ9B 3EZIA 4KBLA 1VLSA 3Q6MA 1BR4A 3KKBA 2GDCA 1NSGB 1EF8A 2HS5A 3IHUA 3WHNA 3C8GA 4JE9A 5L0IA 2LFFA 5L0FA 1YA9A 2VC9A 3MBGA 4PK4A 3SXMA 3U8VA 3G4XA 1LS1A 2R7OA 2ICWG 4NTFA 5GPGB 2IOQA 3UR3C 3C62A 3WG7C 4GQHA 1K04A 1TR2A 4MOUA 1VLTA 2L7AA 5E33A 1NZEA 1M56C 2AWCA 2MWQA 4OIRF 3B9QA 1NFOA 1VOMA 4ELWA 3BRJA 1D1CA 1WTYA 3LEOA 1OW8A 3WODF 4H4KC 3EH1A 3HJCA 1YJGA 4U1AA 5B3IA 3FAPB 3GODA 4W8PA 4CIPA 1O3UA 3NG1A 2YRFA 2QTVA 4K1OA 5T1DB 1V55C 2EPKX 2L9JA 1TKNA 3V5ZA 3N0TA 3WAQA 1IW7F 1XZPA 3T6JA 3G64A 1WOLA 3SXZA 1TWGA 4FAPB 1ORYA 3SLLA 1NBBA 3DM5A 5F5HA 3B0UX 3A4MA 4JVSA 5DVWA 5DQZA 3RFYA 4CS8C 3LS0A 1CGNA 4MVRA 4KI2A 2OU6A 3QXZA 3HRXA 3Q0GA 1R5ID 4KNVA 4M63A 1ORJA 4K0DA 2HV6A 3HLZA 4U5EE 2LQGA 3PZKA 5CI9A 3SWXA 3IQ6A 4FZWC 4XPXA 3K33A 4DRIB 2C03A 4LLCA 1FAPB 3SNHA 3DI5A 2R7SA 2PX0A 2UZFA 2OCCC 1V54C 3QXIA 1RCPA 1TFKB 2CNWD 1PD0A 1Q0KA 3S90A 3SEOA 4JJGA 1V4AA 2P7VA 5CIVA 2VCAA 2IYLD 2W9YA 2WVNA 3B0VC 4O79A 5E2QA 1QSPA 3LESA 1VMAA 2JPUA 1BR2A 3JRMO 1NZYA 4E0IA 3L34A 1QKRA 1F1MA 2UUIA 2L81A 2XLMA 4QDLA 2NUTB 4XEKA 1BDJB 2VX2A 4PJLA 3SXKA 2RD9A 1EF9A 2NSFA 2Q7RA 3ZC4A 3R7CA 4JTCB 2JX0A 4QI2A 3K1IC 1OR2A 5KYWB 3W8HA 1KTMA 4CX9A 4ZLCA 2EPMX 4MW8A 3EGDA 1LI5A 3NYMA 3B71A 4ELSA 2VREA 1JR8A 3DJNB 3W8IB 3W2WA 1LVKA 3NMKA 1NFNA 2CGEA 2P6VA 3AQCA 3GM2A 1D0ZA 3L8JA 4IAQA 1S7ZA 2J9WA 4JKVA 4CS8A 5D92A 2GA0A 2HMQA 5BUOA 5A69A 4IRUA 4EWCA 1OW7A 4CS9C 1Z6AA 1UIYA 1OQCA 3KH2A 3NMJA 4OD4A 3Q7GA 4P9TA 3JTLO 2KGOA 1D1AA 4FZWA 4PFOA 1LKXA 4IZDA 3TULA 4XLNF 4XEFA 1Z5ZA 3US6A 3AG3C 1W2WA 3AM1A 2ZXPA 5TJ5E 3ABKC 4LACB 3LLIA 1RJ9A 5JP7A 2A1DD 1CPQA 1JPJA 1YZAA 3HKKA 2YHSA 3R9SA 3HINA 5DLJA 4DBQA 2I8BA 5JBXA 3ASOC 4C3DA 4O6MA 3DXJF 4MTFA 2TMVP 3O6XA 2H8AA 3K1IA 4OINF 3JZ0A 4GYTA 2CNWA 1LPEA 2XLHA 3KQFA 1PV3A 3A4LA 4I1OB 3ITFA 1CGOA 4H54A 4LERA 4EMLA 2J8WA 2HJMA 2R7UA 3AG2C 2DYRC 2OJQA 3HTKC 3M4BA 3GEIA 3AQBA 2GAQA 5L0CA 4DVYP 3K7DA 2EIMC 2A6EF 1ZZPA 2W4BA 2Q00A 2QUPA 4DBRA 4ER9A 1TWAA 2YWAA 1MJ3A 3F46A 4J30B 4CS9A 3ZQVA 2UUHA 1YARO 2G3KA 4O7GA 4U5GA 4IGGA 4CSAA 1S05A 4E0HA 2YL7A 5KYXB 3POVA 3NYJA 3O39A 4BJ1A 4ULWA 2YLGA 1HMOA 2J0XA 2A0BA 4MVOA 3M1CB 2LP4A 3U9MA 4YN0B 2R05A 4ANJA 1JRAA 3AG1C 1Z7Qc 4K3WA 3EH2A 4FWVA 3MOYA 1NU7D 3M4CA 3GM1A 2L6FA 4ELXA 3P5MA 2V3CC 2KNHA 3RF3A 1E83A
chains in the Genus database with same CATH topology
1K04A 1PV3A 3MFNA 4NNQA 4EBJA 3A4LA 5F28E 3O4XE 1OW7A 3C18A 3BRJA 1WTYA 1V4AA 2P63A 4EBKA 3S9OA 1UFBA 1OW8A 4R32A 3ADCA 2LK4A 3ADBA 3U3FA 3GM3A 3RQEA 3K7DA 1O3UA 2L6HA 3TULA 1ZZPA 2Q00A 2JPUA 4XEFA 4GEHB 3RQFA 1UX4A 3IRBA 3ADDA 3AM1A 2YWAA 3RQGA 1WWPA 2L6GA 1RJMA 1WOLA 1Y64B 4NQFA 1K40A 4XEKA 3U0CA 1KNYA 2JX0A 3A4NA 1UX5A 3C8GA 3L8IA 3O10A 3A4MA 1KTMA 1QVXA 3C8GB 3JYYA 3W8HB 2PBEA 3B71A 3AJMA 3C8GD 3W8IB 2HSBA 4XEVA 1OW6A 3GM2A 3L8JA 3GM1A 2L6FA 2KK1A 1JOGA 1K05A 3JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQF A;  3U3F A;  1K40 A;  2LK4 A;  3C8G D;  1K04 A;  3GM3 A;  3RQE A;  4XEK A;  2PBE A;  3U0C A;  3K7D A;  1O3U A;  2L6H A;  3W8I B;  1PV3 A;  3TUL A;  3MFN A;  4EBJ A;  1ZZP A;  2JX0 A;  2JPU A;  2Q00 A;  4XEF A;  4GEH B;  2HSB A;  5F28 E;  3RQF A;  4XEV A;  3C8G A;  3L8I A;  1OW6 A;  3GM2 A;  3L8J A;  1OW7 A;  3B71 A;  3C18 A;  3GM1 A;  3O10 A;  2L6F A;  1KTM A;  2KK1 A;  3BRJ A;  2YWA A;  3JZ0 A;  1QVX A;  3RQG A;  1JOG A;  1WTY A;  1WWP A;  3C8G B;  1V4A A;  2L6G A;  4EBK A;  3S9O A;  1UFB A;  1K05 A;  1OW8 A;  3W8H B;  1WOL A;  3JYY A;  4R32 A;  1KNY A;  3AJM A; 
#chains in the Genus database with same CATH topology
 1OCO C;  3MFN A;  3VF0 A;  4MVM A;  4OIP F;  2Q9A A;  2HFI A;  5E3A A;  2XSE A;  3T9O A;  1Z63 A;  3Q0J A;  1YZC A;  2H7B A;  1GS9 A;  3KYJ A;  2L6H A;  5FZT A;  4QI0 A;  4Z9J A;  3RQF A;  3FHD A;  2MHR A;  4I3M A;  3DM9 B;  1BZ4 A;  1QPU A;  4RD9 A;  3RQG A;  3T6B A;  3AOU A;  4DVZ A;  1APC A;  1DOV A;  5JUA A;  1HW2 A;  3UGP A;  4N6C A;  5KYW A;  2P61 A;  2W4M A;  3KYI A;  3PHF 2;  2B0H A;  5DS4 A;  4DRH B;  1TQG A;  4WJ0 A;  1DCI A;  4UDV A;  3V7O A;  2PFD A;  3W8I A;  3K1H A;  3HNI A;  4HFF B;  4PFP A;  4N06 A;  1Y4C A;  1I4Z A;  3S27 A;  2J9B A;  1A7E A;  4PAC A;  1OW6 A;  3JSE O;  3ZIB A;  3GEE A;  3I5P A;  2KW3 C;  5T3W A;  1LE2 A;  4N4W A;  4NEK A;  1K05 A;  3QZC A;  3ZDL A;  2DI3 A;  3N24 A;  4E17 A;  1A7D A;  1AUE A;  1MMD A;  4OIQ F;  1PD1 A;  2J7P A;  5E3C A;  4WGZ A;  4MW3 A;  4HFK B;  1VYI A;  3FDQ A;  4YJW A;  3IEE A;  3ECS A;  1UFB A;  3E9V A;  3ZVR A;  4MVS A;  1DUB A;  2R7T A;  2QNL A;  1MQV A;  3RKO F;  1QQ3 A;  1HW1 A;  3CQZ A;  5L0G A;  4JZA A;  1C02 A;  4U9D A;  3IRB A;  1AVO B;  4I52 A;  3DKA A;  4JIO A;  1WWP A;  2WZG A;  1QLE C;  3A9C A;  3I5Q A;  3G50 A;  2NUP B;  4AX2 A;  1SMY F;  3T6G B;  4DJ9 A;  1M2V B;  3PMR A;  3TOL A;  1V74 B;  5COG A;  2EPO A;  3JT1 A;  2XM4 A;  3DD7 A;  4K2N A;  3S29 A;  2OOC A;  2YLD A;  3S28 A;  1J8Y F;  2J46 A;  3IPM O;  4N6H A;  2VCC A;  4FJW D;  5BQI A;  1HZD A;  2YKZ A;  2F6Q A;  1UG7 A;  2YL0 A;  4IAO A;  4RDA A;  3H81 A;  2AU5 A;  4QIJ A;  1YAU O;  4G7Z F;  3I47 A;  3E70 C;  1T6I A;  3Q1T A;  1ZHT A;  3DMD A;  1MMG A;  5F28 E;  3UMK A;  1JPN A;  3KL4 A;  3L1M A;  3U9J A;  5COF A;  5KYU B;  2LD6 A;  3DAF A;  2M64 A;  2BE5 F;  3ATP A;  1J8M F;  4GEH B;  3IQ5 A;  4BJ6 A;  4MTO A;  3NKE A;  3FVY A;  1LE4 A;  1LI7 A;  3GWL A;  3KMI A;  4DOZ A;  2OKU A;  2BL2 A;  3MLG A;  2J9U A;  1OCC C;  4PJM A;  3TJ6 A;  3H2V A;  1EQ1 A;  3V5Y A;  5DS6 A;  2YEV A;  3HNL A;  5K0I A;  4J7Y A;  3L8I A;  2J9V A;  4U5H A;  3FMS A;  3R0O A;  3C63 A;  5JT4 A;  4JCS A;  2PBE A;  4B6I A;  1U0B B;  2PBP A;  2HUJ A;  3J06 A;  3K6B A;  2J45 A;  2R03 A;  3EG9 A;  1JAF A;  4XQ1 A;  2WZL A;  2QY9 A;  3TLF A;  4YK5 A;  1OKK D;  4JOT A;  1JOG A;  1MND A;  1YA7 O;  4U19 A;  4ONS A;  4ZLD A;  3JSZ A;  1G8X A;  1Q0F A;  4MQ9 F;  4OD5 A;  2KC3 A;  4WAB A;  3RIP A;  1WAS A;  1SF8 A;  4I1M A;  2GTR A;  2R9R B;  2G3V A;  2C04 A;  1T6U A;  5EGY A;  5COM A;  5C9G A;  3DE9 A;  3CEX A;  3EHM A;  3RW0 A;  3NMI A;  3FXH A;  3L0I A;  3HNJ A;  2X0C A;  4I44 A;  1ZYR F;  4IZC A;  1EY3 A;  3ZWI A;  4WGY A;  5L0H A;  4IAR A;  3T8A A;  2OEV A;  4AE4 B;  5AC5 A;  2XS1 A;  5IY5 C;  1L7C A;  3RYL A;  4CJG A;  2AWY A;  3OEO A;  4CSA C;  4I42 A;  3UMH A;  1C03 A;  2KJG A;  2LFD A;  4G78 A;  4FX5 A;  3ABM C;  2QE9 A;  3U2L A;  1HE9 A;  1H6G A;  3JRT A;  2Q9C A;  4G0H A;  1FMW A;  1AEP A;  4MTG A;  1NLX A;  2J0W A;  3PCV A;  3RVY A;  2XL4 A;  2R7W A;  3OWT A;  1H9G A;  2NG1 A;  4IB4 A;  4JYL A;  2YLI A;  1SYQ A;  1Q0M A;  2VH3 A;  1KNY A;  3VYW A;  2H7V C;  5B1A C;  3QW0 A;  3UNG C;  5F5F A;  2CCY A;  5EK0 A;  3VRC A;  3VM6 A;  4P6I C;  3QK8 A;  4D4N A;  4U5D E;  4JFC A;  1NU9 C;  4E7Z A;  3ADB A;  4CIH A;  1YYX A;  4OLQ A;  3RQE A;  2OEX A;  3ZTM A;  1C17 M;  2YVK A;  3CAX A;  4YT4 A;  1A41 A;  2YQY A;  1ZU4 A;  1RJM A;  4U18 A;  1VB5 A;  2J7P D;  1VTM P;  4C7O B;  5JSL A;  2DGJ A;  2A0U A;  4U9E A;  3S0X A;  1ZHX A;  1QVX A;  3JCU Q;  4D4X A;  2FGY A;  2HSQ A;  4J7T A;  2Y3G A;  1GGQ A;  2IEX A;  1OKK A;  5JBW A;  2XLE A;  3H65 A;  2ZQQ A;  3DZA A;  1E86 A;  1H7I A;  1WAT A;  4IJJ A;  5A6B D;  3H2U A;  4AL1 A;  5KYY B;  1RKE B;  2D4U A;  4F47 A;  2Q4F A;  3G4Z A;  2R7R A;  4AL0 A;  4BG0 A;  2PNO A;  4ZU2 A;  3Q6N A;  2IXM A;  3N2Z B;  2O9X A;  4MND A;  2R7X A;  2R7Q A;  1FR0 A;  3ADC A;  2ZXR A;  4E7S A;  4GEH A;  4I4Z A;  3MYB A;  5B3S C;  4MS2 A;  2GFH A;  3R2P A;  3UGO A;  3LNM B;  3R9T A;  3BEH A;  4NQF A;  4E18 A;  3EGD B;  2F22 A;  4CDY A;  4DRJ B;  1Z23 A;  4BEM J;  3EFO B;  3U3B A;  3MX3 A;  1O5H A;  2YL1 A;  1MMA A;  2EJ5 A;  2NPU A;  1M6T A;  3EGX B;  3KPH A;  4QII A;  3LLK A;  4BJT A;  1B68 A;  3ABL C;  4BJ5 C;  2NUT A;  3C7J A;  2EPN A;  2AVK A;  1G4W R;  3F47 A;  4JRZ A;  2XS8 A;  2FFH A;  4XEV A;  2P0N A;  3EPV A;  2KK1 A;  4Q5S F;  3OC7 A;  2ETS A;  4KNP A;  1ZVZ A;  2IXN A;  4YL3 A;  4NCQ A;  5DQT A;  4CBE A;  1E84 A;  3M79 A;  3O4X E;  1G4U S;  2JD3 A;  1WZ8 A;  1M57 C;  2PP4 A;  3TD7 A;  4EBK A;  1EKY A;  3PDM P;  1OXK A;  2QQ3 A;  3LUT B;  3GM3 A;  2DUB A;  1R4T A;  4BJ6 C;  4AK9 A;  4AE4 A;  3O55 A;  3GWN A;  3GOR A;  3NYL A;  1SZI A;  1VK5 A;  3SYN A;  2YZS A;  3MYF A;  2XXA B;  1LIH A;  4J32 B;  2VCB A;  1I4Y A;  4MVQ A;  1Y64 B;  4ULV A;  1K40 A;  2H7O A;  2A6H F;  2DYS C;  4HE8 D;  2A68 F;  4YT8 A;  4YWQ A;  1JXZ A;  1LM3 B;  3JYH A;  3W4Y A;  2XM0 A;  1ZW3 A;  4JJF A;  5A6B A;  4YT5 A;  2AP3 A;  4CJO A;  2DB4 A;  2I15 A;  4PR9 A;  5AGF A;  4BJ5 A;  3FDU A;  3FOP A;  1WN0 A;  3X1O A;  3AGT A;  3NDB B;  3NKD A;  4NC3 A;  3TOM A;  4OIO F;  2R7V A;  3ZG1 A;  3U5S A;  4JWV A;  2V26 A;  2OQM A;  2HW5 A;  2P63 A;  4XPY A;  4MVZ A;  3H02 A;  3GEH A;  3DAG A;  5A6A A;  4CDA A;  4BEJ A;  4A4A A;  2EIL C;  5CI8 A;  2D5R B;  2BC5 A;  1HE1 A;  4CS7 A;  3S84 A;  1T01 A;  1M2O A;  4KC9 A;  3GAN A;  2L6G A;  3ZQY A;  4C7O A;  3TJ5 A;  3UMI A;  3Q7L A;  3U0C A;  1MMN A;  1TWH A;  1RMV A;  3AG4 C;  3NRH A;  4JC7 A;  1FNT c;  3EHN A;  1G5Z A;  4Q7C A;  5T3T A;  2WZF A;  5JLI A;  2WL8 A;  3AJM A;  1CGM E;  1GM5 A;  4RBN A;  5KYX A;  1TWC A;  1RXQ A;  2KSF A;  4WCZ A;  2VAS A;  2HSB A;  1IZM A;  5KYY A;  1RKE A;  4U5F E;  2IBF A;  1E85 A;  5L3V A;  256B A;  3SXY A;  4JCZ A;  4C3E A;  1EA8 A;  4NNQ A;  2Z15 A;  5L0J A;  3HNK A;  2ZQR A;  3C18 A;  4DXW A;  2ZXW C;  1ZHZ A;  2XLV A;  3S9O A;  4C3B A;  1U89 A;  2XRH A;  3U3F A;  2Y3B A;  4YL0 A;  3C8Z A;  3TK0 A;  1WGW A;  4JEA A;  2B0J A;  2KYH A;  2YL3 A;  2R25 A;  3TQO A;  4U5B E;  2ZXO A;  3I4U A;  2EIK C;  1L3P A;  4U5C E;  4Z9H A;  4Q4Z F;  1NG1 A;  1Q51 A;  3EFO A;  3ZSU A;  1T6Q A;  2PX3 A;  2CYD A;  4Z9I A;  5BQH A;  3EGX A;  2VB6 A;  2XL6 A;  4L6R A;  1N1C A;  3A4N A;  3QVZ A;  3IQT A;  3RH3 A;  3C8G B;  4JEB A;  3JYY A;  4OG1 A;  2A69 F;  5A6J A;  2IM8 A;  2EIN C;  4EHP A;  3DE8 A;  1YLM A;  2Q9B A;  4XPW A;  3U8P A;  2LSE A;  4EKW A;  1XZQ A;  4NTA A;  2WVQ A;  4X0R A;  2XL8 A;  4FES A;  5HSW A;  3RSI A;  1SR2 A;  4NY3 A;  1Q0D A;  3MYI A;  3QW1 A;  3EJN A;  1BR1 A;  3LNR A;  2Y3H A;  3M15 A;  4IWB A;  1LS4 A;  4LDK A;  5L0D A;  2LK4 A;  2OG2 A;  4PJN A;  1ZHW A;  1PCX A;  2IXP A;  1I5N A;  1H9T A;  2XXA A;  4XTK A;  3B29 A;  1D0Y A;  3QTH A;  1UX4 A;  3ZTZ A;  3QVY A;  4LDR A;  1OR3 A;  2NSG A;  2EIJ C;  2RSE B;  5DS5 A;  1Z3I X;  3AGU A;  4KNW A;  1EI7 A;  2LIG A;  3LJB A;  3SZR A;  1OCZ C;  2Y39 A;  5JS5 A;  1A7V A;  2OJE D;  5BQG A;  4JCH A;  1TFO B;  5L3Q A;  2G62 A;  3T89 A;  2HZ8 A;  2KQ9 A;  3O10 A;  4JUR I;  2PPY A;  2GWW A;  4F4B A;  1XWJ A;  4NTB A;  2CW0 F;  4YT2 A;  1A0B A;  2IXO A;  2NUP A;  1CPR A;  3C8G D;  4PJJ A;  1M2V A;  4BPM A;  1FMV A;  2ZPA A;  1YVI A;  3T88 A;  1U6H A;  2PF4 E;  3A11 A;  1QZX A;  2HJ3 A;  5HV9 A;  2XLD A;  4IZB A;  4P9F A;  2W45 A;  4LDQ A;  1D0X A;  4O6N A;  3ASN C;  1E2X A;  2CDQ A;  1OXB A;  5FCL A;  4EUK B;  3QMK A;  4XWJ A;  4JW1 A;  3DWW A;  1KU2 A;  1YYJ A;  1GQA A;  1ORS C;  4CDV A;  2FW2 A;  3CSK A;  4YL1 A;  4R32 A;  5JRA A;  2WVO A;  2MYS A;  2Y3D A;  1Q0G A;  3B0P A;  2LCH A;  5KYN A;  1Q52 A;  4G7H F;  4JTD B;  3CZ6 A;  1D1B A;  4EBB A;  3EZH A;  4W8K A;  5KYU A;  3ADD A;  2ZD9 A;  2M4E A;  3LAY A;  5KJP A;  4LLE A;  2Q3T A;  1DOW A;  1NZY B;  1JMW A;  1FFH A;  2P1A A;  4JTA B;  5B1B C;  4HEA J;  1FTS A;  2FAP B;  1RJN A;  1HY5 A;  3SP1 A;  4G7O F;  1UX5 A;  5D91 A;  3EG9 B;  1O87 A;  1HMD A;  3LEV A;  3RVZ A;  5JVE A;  1YDI A;  1OCR C;  3W8H B;  2XLO A;  3DJU B;  1VYK A;  2WB7 A;  1T9K A;  5A6K A;  2EPL X;  1FFT C;  2X51 A;  4O6Y A;  5EHH A;  1T5O A;  4MVU A;  3TRR A;  2R02 A;  3W2V A;  3EQL F;  1BBH A;  2FBM A;  1ZHY A;  1ZU5 A;  2QLA A;  1Y6D A;  4EBJ A;  3VAY A;  3V5X A;  4K7B A;  3U2M A;  1ZW2 A;  2ASR A;  2HV7 A;  4EIY A;  3K66 A;  3IQC A;  1MNE A;  2E87 A;  3FAJ A;  1ST6 A;  5AC4 A;  2Y69 C;  4MI2 A;  2HKV A;  3OA1 A;  4A2N B;  3T4R A;  3FOO A;  1RKC A;  4XLP F;  2HMZ A;  3X2Q C;  2XLW A;  3LS1 A;  1RJ9 B;  3EZI A;  4KBL A;  1VLS A;  3Q6M A;  1BR4 A;  3KKB A;  2GDC A;  1NSG B;  1EF8 A;  2HS5 A;  3IHU A;  3WHN A;  3C8G A;  4JE9 A;  5L0I A;  2LFF A;  5L0F A;  1YA9 A;  2VC9 A;  3MBG A;  4PK4 A;  3SXM A;  3U8V A;  3G4X A;  1LS1 A;  2R7O A;  2ICW G;  4NTF A;  5GPG B;  2IOQ A;  3UR3 C;  3C62 A;  3WG7 C;  4GQH A;  1K04 A;  1TR2 A;  4MOU A;  1VLT A;  2L7A A;  5E33 A;  1NZE A;  1M56 C;  2AWC A;  2MWQ A;  4OIR F;  3B9Q A;  1NFO A;  1VOM A;  4ELW A;  3BRJ A;  1D1C A;  1WTY A;  3LEO A;  1OW8 A;  3WOD F;  4H4K C;  3EH1 A;  3HJC A;  1YJG A;  4U1A A;  5B3I A;  3FAP B;  3GOD A;  4W8P A;  4CIP A;  1O3U A;  3NG1 A;  2YRF A;  2QTV A;  4K1O A;  5T1D B;  1V55 C;  2EPK X;  2L9J A;  1TKN A;  3V5Z A;  3N0T A;  3WAQ A;  1IW7 F;  1XZP A;  3T6J A;  3G64 A;  1WOL A;  3SXZ A;  1TWG A;  4FAP B;  1ORY A;  3SLL A;  1NBB A;  3DM5 A;  5F5H A;  3B0U X;  3A4M A;  4JVS A;  5DVW A;  5DQZ A;  3RFY A;  4CS8 C;  3LS0 A;  1CGN A;  4MVR A;  4KI2 A;  2OU6 A;  3QXZ A;  3HRX A;  3Q0G A;  1R5I D;  4KNV A;  4M63 A;  1ORJ A;  4K0D A;  2HV6 A;  3HLZ A;  4U5E E;  2LQG A;  3PZK A;  5CI9 A;  3SWX A;  3IQ6 A;  4FZW C;  4XPX A;  3K33 A;  4DRI B;  2C03 A;  4LLC A;  1FAP B;  3SNH A;  3DI5 A;  2R7S A;  2PX0 A;  2UZF A;  2OCC C;  1V54 C;  3QXI A;  1RCP A;  1TFK B;  2CNW D;  1PD0 A;  1Q0K A;  3S90 A;  3SEO A;  4JJG A;  1V4A A;  2P7V A;  5CIV A;  2VCA A;  2IYL D;  2W9Y A;  2WVN A;  3B0V C;  4O79 A;  5E2Q A;  1QSP A;  3LES A;  1VMA A;  2JPU A;  1BR2 A;  3JRM O;  1NZY A;  4E0I A;  3L34 A;  1QKR A;  1F1M A;  2UUI A;  2L81 A;  2XLM A;  4QDL A;  2NUT B;  4XEK A;  1BDJ B;  2VX2 A;  4PJL A;  3SXK A;  2RD9 A;  1EF9 A;  2NSF A;  2Q7R A;  3ZC4 A;  3R7C A;  4JTC B;  2JX0 A;  4QI2 A;  3K1I C;  1OR2 A;  5KYW B;  3W8H A;  1KTM A;  4CX9 A;  4ZLC A;  2EPM X;  4MW8 A;  3EGD A;  1LI5 A;  3NYM A;  3B71 A;  4ELS A;  2VRE A;  1JR8 A;  3DJN B;  3W8I B;  3W2W A;  1LVK A;  3NMK A;  1NFN A;  2CGE A;  2P6V A;  3AQC A;  3GM2 A;  1D0Z A;  3L8J A;  4IAQ A;  1S7Z A;  2J9W A;  4JKV A;  4CS8 A;  5D92 A;  2GA0 A;  2HMQ A;  5BUO A;  5A69 A;  4IRU A;  4EWC A;  1OW7 A;  4CS9 C;  1Z6A A;  1UIY A;  1OQC A;  3KH2 A;  3NMJ A;  4OD4 A;  3Q7G A;  4P9T A;  3JTL O;  2KGO A;  1D1A A;  4FZW A;  4PFO A;  1LKX A;  4IZD A;  3TUL A;  4XLN F;  4XEF A;  1Z5Z A;  3US6 A;  3AG3 C;  1W2W A;  3AM1 A;  2ZXP A;  5TJ5 E;  3ABK C;  4LAC B;  3LLI A;  1RJ9 A;  5JP7 A;  2A1D D;  1CPQ A;  1JPJ A;  1YZA A;  3HKK A;  2YHS A;  3R9S A;  3HIN A;  5DLJ A;  4DBQ A;  2I8B A;  5JBX A;  3ASO C;  4C3D A;  4O6M A;  3DXJ F;  4MTF A;  2TMV P;  3O6X A;  2H8A A;  3K1I A;  4OIN F;  3JZ0 A;  4GYT A;  2CNW A;  1LPE A;  2XLH A;  3KQF A;  1PV3 A;  3A4L A;  4I1O B;  3ITF A;  1CGO A;  4H54 A;  4LER A;  4EML A;  2J8W A;  2HJM A;  2R7U A;  3AG2 C;  2DYR C;  2OJQ A;  3HTK C;  3M4B A;  3GEI A;  3AQB A;  2GAQ A;  5L0C A;  4DVY P;  3K7D A;  2EIM C;  2A6E F;  1ZZP A;  2W4B A;  2Q00 A;  2QUP A;  4DBR A;  4ER9 A;  1TWA A;  2YWA A;  1MJ3 A;  3F46 A;  4J30 B;  4CS9 A;  3ZQV A;  2UUH A;  1YAR O;  2G3K A;  4O7G A;  4U5G A;  4IGG A;  4CSA A;  1S05 A;  4E0H A;  2YL7 A;  5KYX B;  3POV A;  3NYJ A;  3O39 A;  4BJ1 A;  4ULW A;  2YLG A;  1HMO A;  2J0X A;  2A0B A;  4MVO A;  3M1C B;  2LP4 A;  3U9M A;  4YN0 B;  2R05 A;  4ANJ A;  1JRA A;  3AG1 C;  1Z7Q c;  4K3W A;  3EH2 A;  4FWV A;  3MOY A;  1NU7 D;  3M4C A;  3GM1 A;  2L6F A;  4ELX A;  3P5M A;  2V3C C;  2KNH A;  3RF3 A;  1E83 A; 
#chains in the Genus database with same CATH homology
 1K04 A;  1PV3 A;  3MFN A;  4NNQ A;  4EBJ A;  3A4L A;  5F28 E;  3O4X E;  1OW7 A;  3C18 A;  3BRJ A;  1WTY A;  1V4A A;  2P63 A;  4EBK A;  3S9O A;  1UFB A;  1OW8 A;  4R32 A;  3ADC A;  2LK4 A;  3ADB A;  3U3F A;  3GM3 A;  3RQE A;  3K7D A;  1O3U A;  2L6H A;  3TUL A;  1ZZP A;  2Q00 A;  2JPU A;  4XEF A;  4GEH B;  3RQF A;  1UX4 A;  3IRB A;  3ADD A;  3AM1 A;  2YWA A;  3RQG A;  1WWP A;  2L6G A;  1RJM A;  1WOL A;  1Y64 B;  4NQF A;  1K40 A;  4XEK A;  3U0C A;  1KNY A;  2JX0 A;  3A4N A;  1UX5 A;  3C8G A;  3L8I A;  3O10 A;  3A4M A;  1KTM A;  1QVX A;  3C8G B;  3JYY A;  3W8H B;  2PBE A;  3B71 A;  3AJM A;  3C8G D;  3W8I B;  2HSB A;  4XEV A;  1OW6 A;  3GM2 A;  3L8J A;  3GM1 A;  2L6F A;  2KK1 A;  1JOG A;  1K05 A;  3JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...