3RQFA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
197
structure length
197
Chain Sequence
b'SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 74
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqfA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqfA02
1K05A 4NQFA 3C18A 3U0CA 1OW8A 1OW6A 5F28E 1KTMA 2HSBA 1OW7A 2L6GA 3JZ0A 3RQGA 3K7DA 3W8IB 1O3UA 1QVXA 3L8JA 2JX0A 3C8GA 2L6FA 3BRJA 3JYYA 3B71A 1WTYA 2L6HA 1WOLA 1WWPA 3GM2A 3MFNA 3O10A 2YWAA 3AJMA 4XEKA 2KK1A 4EBJA 3C8GB 3RQEA 3W8HB 1PV3A 4R32A 2Q00A 4EBKA 3GM1A 3RQFA 3U3FA 1K40A 3S9OA 3L8IA 1KNYA 2JPUA 2PBEA 3C8GD 4GEHB 1UFBA 1K04A 2LK4A 4XEFA 4XEVA 1JOGA 1V4AA 3GM3A 1ZZPA 3TULA
chains in the Genus database with same CATH superfamily
1M56C 4BEMJ 2XS1A 1ZVZA 3S28A 3DD7A 3RF3A 2J9VA 5JUAA 1TWGA 3JTLO 4JTCB 4OD4A 1H6GA 3K66A 4XEFA 4OLQA 5AC5A 1OW6A 1OCOC 3SYNA 3QVZA 3OA1A 2DUBA 3P5MA 4MVOA 2W45A 2Q9CA 5T3WA 3IQ6A 1FTSA 2CDQA 3LLIA 4YT5A 2L6GA 2A0UA 4MS2A 3O55A 2L6HA 1G5ZA 3AOUA 3RQFA 4KI2A 3TLFA 2HV6A 1RMVA 2CNWA 4P6IC 3K1IA 2QUPA 1Y64B 4N4WA 2ETSA 3O4XE 3SP1A 1RJ9B 4JE9A 2G62A 5A6KA 1VLTA 3TRRA 1ZHWA 4PJLA 3POVA 3AM1A 3RFYA 1NU7D 1JOGA 2XLVA 5DQTA 1UX4A 3GEIA 3OWTA 5JLIA 2HSBA 2KW3C 1D0YA 2VASA 1L7CA 4XEKA 4HEAJ 4K7BA 4LDRA 3TULA 3PDMP 5GPGB 3R9SA 5JSLA 4LDKA 4GQHA 1XWJA 5DS4A 4JWVA 3UMKA 3GODA 4IB4A 5A6AA 4Q7CA 3FDQA 2HSQA 4IAQA 1QPUA 4E7SA 2P0NA 2A68F 5IY5C 1H9TA 3EGXA 4BJ6C 4U9EA 2ZQQA 1H7IA 1JAFA 3HRXA 2LP4A 1NLXA 3KYIA 1Z5ZA 3K1HA 2JPUA 3FHDA 4ELSA 5JRAA 2H7VC 2XLOA 4IZDA 2IM8A 2R9RB 1A7EA 2PX3A 3DJNB 2A6EF 3AJMA 5L0FA 3AQBA 4N06A 4D4XA 3JYHA 3SXZA 3T6JA 1ZU4A 1KU2A 3ATPA 2QY9A 2L7AA 5EK0A 1IW7F 2MWQA 3B71A 4MVSA 5D91A 4M63A 4YL3A 4C3BA 2PP4A 4NNQA 1G4WR 3EGXB 1QLEC 2Q9BA 2PPYA 3ZG1A 5BUOA 4JVSA 5B3SC 2ZXWC 2Q9AA 1SR2A 3EJNA 3B0PA 3EHNA 2IOQA 1V74B 4MTFA 1I5NA 4MI2A 4ELWA 3RSIA 2YL3A 1ZHXA 5CI8A 4CS9A 3AGTA 4MVUA 2CCYA 2WZLA 1O87A 1V54C 1FMVA 1BBHA 1GS9A 4UDVA 3MYFA 1BR4A 3KKBA 2EJ5A 3UMIA 2XL8A 3B9QA 1C03A 2NSFA 2HMQA 2R7VA 4OD5A 3U9JA 2YVKA 2UUIA 2Y3DA 3ABKC 2P61A 4CDVA 4ZLCA 1VYKA 3RQEA 4O6YA 1YYJA 3FOPA 2HKVA 1MNDA 1QSPA 2HZ8A 3ABLC 4HE8D 4YT2A 1WN0A 4NQFA 4CBEA 3U0CA 3V5YA 1TR2A 5F5FA 1G8XA 1NFNA 4DRIB 2IXPA 3G50A 5L0DA 3HLZA 2X51A 4JEAA 5KYXA 3R9TA 5E3AA 4EHPA 2OOCA 2VCCA 3B0VC 3R7CA 2C03A 4HFFB 4YK5A 1FR0A 1LS4A 4R32A 1A7VA 2ICWG 2R7SA 2YL7A 3K7DA 5A6JA 2WVOA 1JR8A 3A4MA 3CAXA 2PNOA 1OW7A 4ULWA 4RD9A 2WB7A 2OCCC 1WWPA 2WZGA 3GEHA 3ASNC 3M4CA 1SF8A 1CGNA 3SEOA 2WVQA 5EHHA 3DE9A 3RYLA 1CPQA 2YL0A 2YRFA 3C8GD 2GWWA 4NCQA 1M6TA 4K1OA 5KYXB 3ITFA 2R03A 1TWCA 3ASOC 5D92A 3A11A 1XZPA 4YT8A 3Q1TA 3EGDB 3SNHA 2F22A 2XM0A 4E7ZA 4GEHB 3ZDLA 4C3EA 3EZHA 4N6HA 4E0IA 1FMWA 1TFOB 4OIOF 256BA 2R7RA 3I5QA 1TQGA 1AVOB 3QXIA 1YVIA 1J8YF 4XPWA 1MMDA 4FAPB 4PFOA 3UR3C 5AC4A 1EF8A 5K0IA 1YA7O 1LPEA 4K2NA 3U2LA 1M57C 2XM4A 5F28E 4DBRA 2IEXA 1VK5A 3U8VA 1BDJB 3G4ZA 2XLMA 2OEVA 3DM5A 3IPMO 1N1CA 3M4BA 3EH2A 2B0HA 3EG9A 3IQCA 3NYLA 3U5SA 2XRHA 3UGPA 1A0BA 3Q0GA 1OCZC 1FAPB 1KTMA 1M2VA 1OKKD 5KYUA 4P9TA 2J0XA 1D1CA 3KYJA 2IXNA 3AG2C 4CS8C 2AWYA 2LFDA 1ZZPA 3LS1A 4KNVA 2P63A 2FGYA 4NTFA 1LIHA 3L0IA 3J06A 4E18A 1D0ZA 2VCBA 3VAYA 2BC5A 3WG7C 3OEOA 3QK8A 5DVWA 3RVZA 1BZ4A 2AP3A 4CIPA 3FDUA 3EG9B 3X2QC 2JD3A 2HV7A 2J46A 1Q0GA 1QQ3A 2F6QA 2GTRA 3MFNA 3TD7A 2YWAA 4BG0A 2Y39A 4J7YA 5KYUB 2H7OA 2XL4A 1TKNA 1IZMA 2EPLX 3FAPB 4J32B 4KNPA 3QMKA 3RH3A 3SLLA 1OCCC 1JPJA 4U5DE 2YLGA 3K6BA 1CGOA 1E85A 4G7HF 2OJED 3NMIA 2BE5F 3KQFA 4AL0A 1MNEA 4MVZA 4CDYA 4RDAA 5JBXA 4QIIA 3HKKA 2V3CC 2EPKX 3U3FA 1NSGB 4CJOA 5A69A 5KYNA 5TJ5E 1LE2A 1HW1A 4AL1A 3JRTA 4I52A 1Q0DA 3ADBA 2PFDA 4CIHA 3ZTMA 3B0UX 3GANA 4NY3A 4PR9A 3MYIA 3PMRA 1OKKA 3AQCA 1RKCA 2Q7RA 3EPVA 3C18A 2EIKC 4OIRF 2QE9A 3GWNA 4WGZA 1LVKA 3EQLF 2ASRA 4IGGA 1ZHYA 4JCHA 2HUJA 4L6RA 2YLIA 1VMAA 1FFTC 4ELXA 1S7ZA 2EILC 1NU9C 3KMIA 1M2OA 4BJ5C 3T9OA 1UIYA 2QQ3A 1NG1A 4JCZA 3CQZA 1D1BA 4EBJA 4JC7A 2XS8A 3W2VA 2J7PD 3ZC4A 3LJBA 1T6QA 3H2VA 5BQHA 1XZQA 3T6BA 3FAJA 1MMAA 1WOLA 1T5OA 1RKEA 2R7UA 3JSZA 5JBWA 3NMJA 1K04A 1RJNA 2W9YA 1HE1A 4U1AA 4RBNA 3O39A 3PHF2 3W8HA 3JYYA 3CSKA 2R05A 3JRMO 1MMGA 4ONSA 4U5HA 2O9XA 3KL4A 1H9GA 4JCSA 1HY5A 4FZWA 5C9GA 3H02A 1QKRA 4NEKA 3IQ5A 1L3PA 1WGWA 4EUKB 2OKUA 3F46A 4BJ1A 3I4UA 2R7TA 4H4KC 1U6HA 4ULVA 1RKEB 3ABMC 3MX3A 5BQIA 3Q0JA 1OXKA 1LI7A 1D1AA 1I4YA 1GQAA 3C62A 3JSEO 5JT4A 3TQOA 5JVEA 2YKZA 4DXWA 3W8HB 1YZCA 3K1IC 5E3CA 4CSAA 4H54A 1YLMA 1JRAA 5EGYA 3A4NA 2A6HF 1G4US 3V7OA 2PBPA 3N24A 3K33A 3DE8A 1OW8A 1VB5A 4IZCA 1F1MA 1LI5A 2NG1A 3S90A 1DOWA 5KYWA 4JTAB 4CDAA 3QXZA 3G64A 2NPUA 2J7PA 4U9DA 3EH1A 4MOUA 5DLJA 1AEPA 2ZPAA 4XPYA 4J30B 3VYWA 3W2WA 1U89A 4XPXA 3A4LA 4DRHB 3Q6NA 2J0WA 3L34A 5E33A 3TJ6A 3Q7LA 5T3TA 4AE4A 1Y6DA 4OG1A 3X1OA 1T01A 1EA8A 4JRZA 3ZVRA 1DUBA 3RW0A 3HTKC 2LQGA 2W4BA 3I5PA 1EKYA 5B1AC 3O6XA 1AUEA 4PK4A 2P1AA 1R5ID 4EBBA 2OG2A 4NTBA 4XWJA 2GDCA 1OR2A 2YL1A 2WZFA 4PJJA 1VOMA 1DCIA 3LEOA 3T8AA 1JPNA 1EQ1A 3U3BA 2ZXRA 2M4EA 2V26A 3Q7GA 4LACB 4EBKA 5F5HA 3L8IA 1OR3A 4BEJA 3GWLA 1Q52A 4B6IA 3CEXA 5COGA 1YDIA 4JEBA 4CSAC 3B29A 2W4MA 2HJMA 2R7QA 2VREA 1TWHA 4WGYA 1Q0KA 3N2ZB 1SMYF 3RKOF 4IAOA 2HFIA 5HV9A 3L8JA 2ZXOA 3W4YA 4JTDB 3FVYA 4MVQA 2G3VA 4WCZA 4YN0B 4IARA 4CS9C 1UG7A 1UX5A 5BQGA 3ZWIA 3TK0A 4Z9HA 2MHRA 3ZSUA 1LE4A 4C7OA 4AX2A 2VCAA 1K05A 5T1DB 2PF4E 2LIGA 3SZRA 2L6FA 2IYLD 4DRJB 4E0HA 3ZQYA 3U9MA 4F47A 4X0RA 3US6A 1DOVA 1EF9A 3NRHA 5KJPA 3MYBA 3AGUA 3IEEA 4IZBA 4NC3A 1A41A 2DI3A 3UGOA 3TOMA 3FOOA 1OXBA 2VC9A 2KYHA 4U5FE 4OINF 3WAQA 4MW8A 4FX5A 2DYRC 4NTAA 3SWXA 2Q00A 3ECSA 5FZTA 3L1MA 4QIJA 1Q0MA 2PBEA 5L0HA 3IHUA 2B0JA 2HW5A 3LNRA 1ZW2A 5E2QA 4EKWA 2YQYA 2KJGA 3RVYA 2DB4A 4C7OB 3DXJF 4EWCA 2XLWA 2YZSA 3G4XA 4MNDA 1PCXA 3E9VA 2C04A 2YLDA 1Y4CA 2FBMA 3IRBA 4MQ9F 3GM3A 3M1CB 4XQ1A 2L9JA 3LNMB 4MTGA 1T6IA 1OQCA 1HMOA 4G7ZF 1GM5A 2CNWD 2P7VA 3DAGA 3ADDA 2ZQRA 2H8AA 1PD0A 4OIPF 3C63A 3T4RA 2CW0F 3U8PA 3PZKA 4DVZA 2OEXA 3DAFA 1JXZA 2IXOA 2J45A 3C8GA 4BJTA 1RXQA 3S0XA 3GM2A 1M2VB 2D5RB 1Z6AA 2HMZA 3LEVA 4CJGA 3GORA 1YA9A 1Q51A 1ORSC 4DJ9A 4WJ0A 4EIYA 2YEVA 1E2XA 2H7BA 4IJJA 4Z9IA 3QZCA 4QI2A 3BEHA 4DBQA 3V5ZA 1Z23A 2X0CA 2AVKA 1ZHTA 2KGOA 3EHMA 3TOLA 4JW1A 2WL8A 4W8PA 1NFOA 5B1BC 3MOYA 3T88A 1WTYA 4MW3A 2PX0A 2HS5A 4G78A 3QW1A 4BJ6A 3C8GB 3HNKA 1PD1A 3JCUQ 1RJ9A 3IQTA 2WVNA 1E84A 4EMLA 1ZW3A 4ZU2A 4YT4A 4XLPF 2EIJC 2QNLA 3M79A 4ZLDA 2UUHA 3U2MA 2LFFA 5FCLA 2NUPA 2R02A 3T89A 1W2WA 4YJWA 3SXMA 4I3MA 3GM1A 3LUTB 2LD6A 2EPOA 4G7OF 5L0IA 2XLHA 1BR1A 5A6BD 4CS7A 1YYXA 3AG1C 2QTVA 2MYSA 3NDBB 2DYSC 4I44A 1NBBA 2XLDA 3NMKA 3ZIBA 2VB6A 2XLEA 4W8KA 3VRCA 5CIVA 2Y3BA 5DQZA 1ST6A 5COFA 4N6CA 1HMDA 2EPNA 4U19A 4E17A 4LLCA 3VF0A 1I4ZA 5L3QA 1LKXA 1KNYA 2NUPB 3W8IA 2LK4A 4FWVA 4Z9JA 4WABA 1EI7A 4XLNF 3LAYA 4LLEA 3AG3C 1TWAA 3NG1A 3UNGC 3QVYA 2Z15A 2RD9A 1Q0FA 4JFCA 4DOZA 4ER9A 5KYYA 2GFHA 3QW0A 3E70C 1NZEA 3A9CA 3V5XA 1VTMP 1E86A 1ORYA 1C02A 3AG4C 3HNLA 2OU6A 2Y3HA 4Q5SF 5L0CA 1FFHA 2I8BA 4IRUA 3SXYA 1LM3B 1ZYRF 3ADCA 3JZ0A 3RQGA 3W8IB 2Q3TA 1ZU5A 1J8MF 4P9FA 4I1OB 2BL2A 2GA0A 2KQ9A 5L0GA 3Q6MA 2CGEA 1E83A 5KYYB 3DM9B 4HFKB 5A6BA 1T9KA 2GAQA 5COMA 1T6UA 3DJUB 5HSWA 2E87A 1U0BB 3C7JA 1UFBA 5JP7A 2XXAA 4MTOA 1YJGA 3HINA 4ANJA 3N0TA 4K0DA 2IBFA 4DVYP 1RCPA 3VM6A 4D4NA 4YL0A 2D4UA 1FNTc 2VX2A 1OCRC 3NKEA 2ZD9A 3WODF 1SYQA 2JX0A 3QTHA 3H81A 4O6MA 5JS5A 2J9UA 2QLAA 3EFOA 1PV3A 3S9OA 3HNJA 1HW2A 2OQMA 4JIOA 3RIPA 3F47A 2XXAB 4C3DA 1BR2A 2NSGA 4QI0A 4JKVA 4U5EE 4JOTA 1V55C 4G0HA 3CZ6A 1MJ3A 1HE9A 3OC7A 2EIMC 4FESA 2AWCA 5KYWB 2R7XA 3R2PA 4F4BA 4U5BE 4AK9A 1HZDA 2FAPB 4J7TA 4KC9A 3MBGA 1VLSA 5DS6A 3NYMA 5L0JA 3EFOB 4FZWC 3NKDA 4K3WA 4JJGA 1CGME 4QDLA 5DS5A 2KNHA 4U5CE 2A1DD 2R7WA 1ORJA 1Z3IX 2R25A 2KK1A 3R0OA 1Z7Qc 3I47A 3UMHA 1C17M 2R7OA 4A2NB 4U5GA 2Y3GA 4AE4B 5L3VA 4PJMA 4PJNA 4CS8A 3H2UA 2LCHA 4FJWD 3EGDA 1WZ8A 2XSEA 3T6GB 4GEHA 4YWQA 4I42A 2DGJA 3GEEA 1LS1A 2KC3A 1S05A 2M64A 3EZIA 2P6VA 5CI9A 2HJ3A 5B3IA 3DKAA 2OJQA 1NZYA 2UZFA 2CYDA 3WHNA 4PFPA 1EY3A 5AGFA 3BRJA 1WASA 4JYLA 1Z63A 2G3KA 2A69F 3KPHA 1B68A 1WATA 2RSEB 2I15A 2J9WA 1O3UA 1RJMA 1QVXA 1JMWA 3FXHA 2VH3A 3O10A 1QZXA 2AU5A 4A4AA 3DI5A 1APCA 4YL1A 3S84A 1YZAA 1NZYB 1GGQA 2J9BA 2J8WA 2NUTA 3MLGA 2IXMA 3HJCA 2XL6A 4KBLA 3FMSA 4BPMA 3DMDA 3H65A 3S27A 3S29A 1MMNA 3LESA 2LSEA 4O79A 3KH2A 4MVMA 4JZAA 4O7GA 3DWWA 2Y69C 4O6NA 4LDQA 1MQVA 3C8ZA 2YHSA 4Q4ZF 1D0XA 2L81A 4GYTA 4KNWA 2EINC 3ZQVA 2KSFA 4OIQF 4U18A 2NUTB 1CPRA 3NYJA 4BJ5A 2Q4FA 3JT1A 1R4TA 1YARO 4PACA 4I1MA 3DZAA 4XTKA 3TJ5A 2TMVP 4IWBA 4XEVA 1V4AA 3HNIA 4CX9A 2EPMX 1A7DA 2A0BA 4MVRA 3LLKA 3SXKA 3LS0A 4I4ZA 1YAUO 2FW2A 3PCVA 1VYIA 1TFKB 2FFHA 3M15A 3ZTZA 1O5HA 1K40A 2ZXPA 1SZIA 1ZHZA 4JURI 4JJFA 4LERA
chains in the Genus database with same CATH topology
4NQFA 1UX4A 3C18A 3U0CA 2HSBA 3L8JA 2JX0A 3B71A 3MFNA 2YWAA 4XEKA 3ADDA 4NNQA 1PV3A 1UX5A 3GM1A 3S9OA 4XEFA 3TULA 1K05A 1OW6A 5F28E 3ADCA 3JZ0A 3RQGA 3W8IB 3C8GA 2L6FA 3GM2A 4EBJA 3W8HB 4R32A 3A4NA 3K7DA 3A4MA 1OW8A 1KTMA 1OW7A 2L6GA 3BRJA 2L6HA 1WOLA 1WWPA 2Q00A 4EBKA 3U3FA 3RQFA 3L8IA 1KNYA 2JPUA 2PBEA 3C8GD 1UFBA 1K04A 2LK4A 4XEVA 1V4AA 1ZZPA 1Y64B 2P63A 3O4XE 3ADBA 1O3UA 1RJMA 1QVXA 3JYYA 1WTYA 3O10A 3AJMA 2KK1A 3C8GB 3RQEA 3AM1A 3A4LA 1K40A 4GEHB 3IRBA 1JOGA 3GM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  4NQF A;  3C18 A;  3U0C A;  1OW8 A;  1OW6 A;  5F28 E;  1KTM A;  2HSB A;  1OW7 A;  2L6G A;  3JZ0 A;  3RQG A;  3K7D A;  3W8I B;  1O3U A;  1QVX A;  3L8J A;  2JX0 A;  3C8G A;  2L6F A;  3BRJ A;  3JYY A;  3B71 A;  1WTY A;  2L6H A;  1WOL A;  1WWP A;  3GM2 A;  3MFN A;  3O10 A;  2YWA A;  3AJM A;  4XEK A;  2KK1 A;  4EBJ A;  3C8G B;  3RQE A;  3W8H B;  1PV3 A;  4R32 A;  2Q00 A;  4EBK A;  3GM1 A;  3RQF A;  3U3F A;  1K40 A;  3S9O A;  3L8I A;  1KNY A;  2JPU A;  2PBE A;  3C8G D;  4GEH B;  1UFB A;  1K04 A;  2LK4 A;  4XEF A;  4XEV A;  1JOG A;  1V4A A;  3GM3 A;  1ZZP A;  3TUL A; 
#chains in the Genus database with same CATH topology
 1M56 C;  4BEM J;  2XS1 A;  1ZVZ A;  3S28 A;  3DD7 A;  3RF3 A;  2J9V A;  5JUA A;  1TWG A;  3JTL O;  4JTC B;  4OD4 A;  1H6G A;  3K66 A;  4XEF A;  4OLQ A;  5AC5 A;  1OW6 A;  1OCO C;  3SYN A;  3QVZ A;  3OA1 A;  2DUB A;  3P5M A;  4MVO A;  2W45 A;  2Q9C A;  5T3W A;  3IQ6 A;  1FTS A;  2CDQ A;  3LLI A;  4YT5 A;  2L6G A;  2A0U A;  4MS2 A;  3O55 A;  2L6H A;  1G5Z A;  3AOU A;  3RQF A;  4KI2 A;  3TLF A;  2HV6 A;  1RMV A;  2CNW A;  4P6I C;  3K1I A;  2QUP A;  1Y64 B;  4N4W A;  2ETS A;  3O4X E;  3SP1 A;  1RJ9 B;  4JE9 A;  2G62 A;  5A6K A;  1VLT A;  3TRR A;  1ZHW A;  4PJL A;  3POV A;  3AM1 A;  3RFY A;  1NU7 D;  1JOG A;  2XLV A;  5DQT A;  1UX4 A;  3GEI A;  3OWT A;  5JLI A;  2HSB A;  2KW3 C;  1D0Y A;  2VAS A;  1L7C A;  4XEK A;  4HEA J;  4K7B A;  4LDR A;  3TUL A;  3PDM P;  5GPG B;  3R9S A;  5JSL A;  4LDK A;  4GQH A;  1XWJ A;  5DS4 A;  4JWV A;  3UMK A;  3GOD A;  4IB4 A;  5A6A A;  4Q7C A;  3FDQ A;  2HSQ A;  4IAQ A;  1QPU A;  4E7S A;  2P0N A;  2A68 F;  5IY5 C;  1H9T A;  3EGX A;  4BJ6 C;  4U9E A;  2ZQQ A;  1H7I A;  1JAF A;  3HRX A;  2LP4 A;  1NLX A;  3KYI A;  1Z5Z A;  3K1H A;  2JPU A;  3FHD A;  4ELS A;  5JRA A;  2H7V C;  2XLO A;  4IZD A;  2IM8 A;  2R9R B;  1A7E A;  2PX3 A;  3DJN B;  2A6E F;  3AJM A;  5L0F A;  3AQB A;  4N06 A;  4D4X A;  3JYH A;  3SXZ A;  3T6J A;  1ZU4 A;  1KU2 A;  3ATP A;  2QY9 A;  2L7A A;  5EK0 A;  1IW7 F;  2MWQ A;  3B71 A;  4MVS A;  5D91 A;  4M63 A;  4YL3 A;  4C3B A;  2PP4 A;  4NNQ A;  1G4W R;  3EGX B;  1QLE C;  2Q9B A;  2PPY A;  3ZG1 A;  5BUO A;  4JVS A;  5B3S C;  2ZXW C;  2Q9A A;  1SR2 A;  3EJN A;  3B0P A;  3EHN A;  2IOQ A;  1V74 B;  4MTF A;  1I5N A;  4MI2 A;  4ELW A;  3RSI A;  2YL3 A;  1ZHX A;  5CI8 A;  4CS9 A;  3AGT A;  4MVU A;  2CCY A;  2WZL A;  1O87 A;  1V54 C;  1FMV A;  1BBH A;  1GS9 A;  4UDV A;  3MYF A;  1BR4 A;  3KKB A;  2EJ5 A;  3UMI A;  2XL8 A;  3B9Q A;  1C03 A;  2NSF A;  2HMQ A;  2R7V A;  4OD5 A;  3U9J A;  2YVK A;  2UUI A;  2Y3D A;  3ABK C;  2P61 A;  4CDV A;  4ZLC A;  1VYK A;  3RQE A;  4O6Y A;  1YYJ A;  3FOP A;  2HKV A;  1MND A;  1QSP A;  2HZ8 A;  3ABL C;  4HE8 D;  4YT2 A;  1WN0 A;  4NQF A;  4CBE A;  3U0C A;  3V5Y A;  1TR2 A;  5F5F A;  1G8X A;  1NFN A;  4DRI B;  2IXP A;  3G50 A;  5L0D A;  3HLZ A;  2X51 A;  4JEA A;  5KYX A;  3R9T A;  5E3A A;  4EHP A;  2OOC A;  2VCC A;  3B0V C;  3R7C A;  2C03 A;  4HFF B;  4YK5 A;  1FR0 A;  1LS4 A;  4R32 A;  1A7V A;  2ICW G;  2R7S A;  2YL7 A;  3K7D A;  5A6J A;  2WVO A;  1JR8 A;  3A4M A;  3CAX A;  2PNO A;  1OW7 A;  4ULW A;  4RD9 A;  2WB7 A;  2OCC C;  1WWP A;  2WZG A;  3GEH A;  3ASN C;  3M4C A;  1SF8 A;  1CGN A;  3SEO A;  2WVQ A;  5EHH A;  3DE9 A;  3RYL A;  1CPQ A;  2YL0 A;  2YRF A;  3C8G D;  2GWW A;  4NCQ A;  1M6T A;  4K1O A;  5KYX B;  3ITF A;  2R03 A;  1TWC A;  3ASO C;  5D92 A;  3A11 A;  1XZP A;  4YT8 A;  3Q1T A;  3EGD B;  3SNH A;  2F22 A;  2XM0 A;  4E7Z A;  4GEH B;  3ZDL A;  4C3E A;  3EZH A;  4N6H A;  4E0I A;  1FMW A;  1TFO B;  4OIO F;  256B A;  2R7R A;  3I5Q A;  1TQG A;  1AVO B;  3QXI A;  1YVI A;  1J8Y F;  4XPW A;  1MMD A;  4FAP B;  4PFO A;  3UR3 C;  5AC4 A;  1EF8 A;  5K0I A;  1YA7 O;  1LPE A;  4K2N A;  3U2L A;  1M57 C;  2XM4 A;  5F28 E;  4DBR A;  2IEX A;  1VK5 A;  3U8V A;  1BDJ B;  3G4Z A;  2XLM A;  2OEV A;  3DM5 A;  3IPM O;  1N1C A;  3M4B A;  3EH2 A;  2B0H A;  3EG9 A;  3IQC A;  3NYL A;  3U5S A;  2XRH A;  3UGP A;  1A0B A;  3Q0G A;  1OCZ C;  1FAP B;  1KTM A;  1M2V A;  1OKK D;  5KYU A;  4P9T A;  2J0X A;  1D1C A;  3KYJ A;  2IXN A;  3AG2 C;  4CS8 C;  2AWY A;  2LFD A;  1ZZP A;  3LS1 A;  4KNV A;  2P63 A;  2FGY A;  4NTF A;  1LIH A;  3L0I A;  3J06 A;  4E18 A;  1D0Z A;  2VCB A;  3VAY A;  2BC5 A;  3WG7 C;  3OEO A;  3QK8 A;  5DVW A;  3RVZ A;  1BZ4 A;  2AP3 A;  4CIP A;  3FDU A;  3EG9 B;  3X2Q C;  2JD3 A;  2HV7 A;  2J46 A;  1Q0G A;  1QQ3 A;  2F6Q A;  2GTR A;  3MFN A;  3TD7 A;  2YWA A;  4BG0 A;  2Y39 A;  4J7Y A;  5KYU B;  2H7O A;  2XL4 A;  1TKN A;  1IZM A;  2EPL X;  3FAP B;  4J32 B;  4KNP A;  3QMK A;  3RH3 A;  3SLL A;  1OCC C;  1JPJ A;  4U5D E;  2YLG A;  3K6B A;  1CGO A;  1E85 A;  4G7H F;  2OJE D;  3NMI A;  2BE5 F;  3KQF A;  4AL0 A;  1MNE A;  4MVZ A;  4CDY A;  4RDA A;  5JBX A;  4QII A;  3HKK A;  2V3C C;  2EPK X;  3U3F A;  1NSG B;  4CJO A;  5A69 A;  5KYN A;  5TJ5 E;  1LE2 A;  1HW1 A;  4AL1 A;  3JRT A;  4I52 A;  1Q0D A;  3ADB A;  2PFD A;  4CIH A;  3ZTM A;  3B0U X;  3GAN A;  4NY3 A;  4PR9 A;  3MYI A;  3PMR A;  1OKK A;  3AQC A;  1RKC A;  2Q7R A;  3EPV A;  3C18 A;  2EIK C;  4OIR F;  2QE9 A;  3GWN A;  4WGZ A;  1LVK A;  3EQL F;  2ASR A;  4IGG A;  1ZHY A;  4JCH A;  2HUJ A;  4L6R A;  2YLI A;  1VMA A;  1FFT C;  4ELX A;  1S7Z A;  2EIL C;  1NU9 C;  3KMI A;  1M2O A;  4BJ5 C;  3T9O A;  1UIY A;  2QQ3 A;  1NG1 A;  4JCZ A;  3CQZ A;  1D1B A;  4EBJ A;  4JC7 A;  2XS8 A;  3W2V A;  2J7P D;  3ZC4 A;  3LJB A;  1T6Q A;  3H2V A;  5BQH A;  1XZQ A;  3T6B A;  3FAJ A;  1MMA A;  1WOL A;  1T5O A;  1RKE A;  2R7U A;  3JSZ A;  5JBW A;  3NMJ A;  1K04 A;  1RJN A;  2W9Y A;  1HE1 A;  4U1A A;  4RBN A;  3O39 A;  3PHF 2;  3W8H A;  3JYY A;  3CSK A;  2R05 A;  3JRM O;  1MMG A;  4ONS A;  4U5H A;  2O9X A;  3KL4 A;  1H9G A;  4JCS A;  1HY5 A;  4FZW A;  5C9G A;  3H02 A;  1QKR A;  4NEK A;  3IQ5 A;  1L3P A;  1WGW A;  4EUK B;  2OKU A;  3F46 A;  4BJ1 A;  3I4U A;  2R7T A;  4H4K C;  1U6H A;  4ULV A;  1RKE B;  3ABM C;  3MX3 A;  5BQI A;  3Q0J A;  1OXK A;  1LI7 A;  1D1A A;  1I4Y A;  1GQA A;  3C62 A;  3JSE O;  5JT4 A;  3TQO A;  5JVE A;  2YKZ A;  4DXW A;  3W8H B;  1YZC A;  3K1I C;  5E3C A;  4CSA A;  4H54 A;  1YLM A;  1JRA A;  5EGY A;  3A4N A;  2A6H F;  1G4U S;  3V7O A;  2PBP A;  3N24 A;  3K33 A;  3DE8 A;  1OW8 A;  1VB5 A;  4IZC A;  1F1M A;  1LI5 A;  2NG1 A;  3S90 A;  1DOW A;  5KYW A;  4JTA B;  4CDA A;  3QXZ A;  3G64 A;  2NPU A;  2J7P A;  4U9D A;  3EH1 A;  4MOU A;  5DLJ A;  1AEP A;  2ZPA A;  4XPY A;  4J30 B;  3VYW A;  3W2W A;  1U89 A;  4XPX A;  3A4L A;  4DRH B;  3Q6N A;  2J0W A;  3L34 A;  5E33 A;  3TJ6 A;  3Q7L A;  5T3T A;  4AE4 A;  1Y6D A;  4OG1 A;  3X1O A;  1T01 A;  1EA8 A;  4JRZ A;  3ZVR A;  1DUB A;  3RW0 A;  3HTK C;  2LQG A;  2W4B A;  3I5P A;  1EKY A;  5B1A C;  3O6X A;  1AUE A;  4PK4 A;  2P1A A;  1R5I D;  4EBB A;  2OG2 A;  4NTB A;  4XWJ A;  2GDC A;  1OR2 A;  2YL1 A;  2WZF A;  4PJJ A;  1VOM A;  1DCI A;  3LEO A;  3T8A A;  1JPN A;  1EQ1 A;  3U3B A;  2ZXR A;  2M4E A;  2V26 A;  3Q7G A;  4LAC B;  4EBK A;  5F5H A;  3L8I A;  1OR3 A;  4BEJ A;  3GWL A;  1Q52 A;  4B6I A;  3CEX A;  5COG A;  1YDI A;  4JEB A;  4CSA C;  3B29 A;  2W4M A;  2HJM A;  2R7Q A;  2VRE A;  1TWH A;  4WGY A;  1Q0K A;  3N2Z B;  1SMY F;  3RKO F;  4IAO A;  2HFI A;  5HV9 A;  3L8J A;  2ZXO A;  3W4Y A;  4JTD B;  3FVY A;  4MVQ A;  2G3V A;  4WCZ A;  4YN0 B;  4IAR A;  4CS9 C;  1UG7 A;  1UX5 A;  5BQG A;  3ZWI A;  3TK0 A;  4Z9H A;  2MHR A;  3ZSU A;  1LE4 A;  4C7O A;  4AX2 A;  2VCA A;  1K05 A;  5T1D B;  2PF4 E;  2LIG A;  3SZR A;  2L6F A;  2IYL D;  4DRJ B;  4E0H A;  3ZQY A;  3U9M A;  4F47 A;  4X0R A;  3US6 A;  1DOV A;  1EF9 A;  3NRH A;  5KJP A;  3MYB A;  3AGU A;  3IEE A;  4IZB A;  4NC3 A;  1A41 A;  2DI3 A;  3UGO A;  3TOM A;  3FOO A;  1OXB A;  2VC9 A;  2KYH A;  4U5F E;  4OIN F;  3WAQ A;  4MW8 A;  4FX5 A;  2DYR C;  4NTA A;  3SWX A;  2Q00 A;  3ECS A;  5FZT A;  3L1M A;  4QIJ A;  1Q0M A;  2PBE A;  5L0H A;  3IHU A;  2B0J A;  2HW5 A;  3LNR A;  1ZW2 A;  5E2Q A;  4EKW A;  2YQY A;  2KJG A;  3RVY A;  2DB4 A;  4C7O B;  3DXJ F;  4EWC A;  2XLW A;  2YZS A;  3G4X A;  4MND A;  1PCX A;  3E9V A;  2C04 A;  2YLD A;  1Y4C A;  2FBM A;  3IRB A;  4MQ9 F;  3GM3 A;  3M1C B;  4XQ1 A;  2L9J A;  3LNM B;  4MTG A;  1T6I A;  1OQC A;  1HMO A;  4G7Z F;  1GM5 A;  2CNW D;  2P7V A;  3DAG A;  3ADD A;  2ZQR A;  2H8A A;  1PD0 A;  4OIP F;  3C63 A;  3T4R A;  2CW0 F;  3U8P A;  3PZK A;  4DVZ A;  2OEX A;  3DAF A;  1JXZ A;  2IXO A;  2J45 A;  3C8G A;  4BJT A;  1RXQ A;  3S0X A;  3GM2 A;  1M2V B;  2D5R B;  1Z6A A;  2HMZ A;  3LEV A;  4CJG A;  3GOR A;  1YA9 A;  1Q51 A;  1ORS C;  4DJ9 A;  4WJ0 A;  4EIY A;  2YEV A;  1E2X A;  2H7B A;  4IJJ A;  4Z9I A;  3QZC A;  4QI2 A;  3BEH A;  4DBQ A;  3V5Z A;  1Z23 A;  2X0C A;  2AVK A;  1ZHT A;  2KGO A;  3EHM A;  3TOL A;  4JW1 A;  2WL8 A;  4W8P A;  1NFO A;  5B1B C;  3MOY A;  3T88 A;  1WTY A;  4MW3 A;  2PX0 A;  2HS5 A;  4G78 A;  3QW1 A;  4BJ6 A;  3C8G B;  3HNK A;  1PD1 A;  3JCU Q;  1RJ9 A;  3IQT A;  2WVN A;  1E84 A;  4EML A;  1ZW3 A;  4ZU2 A;  4YT4 A;  4XLP F;  2EIJ C;  2QNL A;  3M79 A;  4ZLD A;  2UUH A;  3U2M A;  2LFF A;  5FCL A;  2NUP A;  2R02 A;  3T89 A;  1W2W A;  4YJW A;  3SXM A;  4I3M A;  3GM1 A;  3LUT B;  2LD6 A;  2EPO A;  4G7O F;  5L0I A;  2XLH A;  1BR1 A;  5A6B D;  4CS7 A;  1YYX A;  3AG1 C;  2QTV A;  2MYS A;  3NDB B;  2DYS C;  4I44 A;  1NBB A;  2XLD A;  3NMK A;  3ZIB A;  2VB6 A;  2XLE A;  4W8K A;  3VRC A;  5CIV A;  2Y3B A;  5DQZ A;  1ST6 A;  5COF A;  4N6C A;  1HMD A;  2EPN A;  4U19 A;  4E17 A;  4LLC A;  3VF0 A;  1I4Z A;  5L3Q A;  1LKX A;  1KNY A;  2NUP B;  3W8I A;  2LK4 A;  4FWV A;  4Z9J A;  4WAB A;  1EI7 A;  4XLN F;  3LAY A;  4LLE A;  3AG3 C;  1TWA A;  3NG1 A;  3UNG C;  3QVY A;  2Z15 A;  2RD9 A;  1Q0F A;  4JFC A;  4DOZ A;  4ER9 A;  5KYY A;  2GFH A;  3QW0 A;  3E70 C;  1NZE A;  3A9C A;  3V5X A;  1VTM P;  1E86 A;  1ORY A;  1C02 A;  3AG4 C;  3HNL A;  2OU6 A;  2Y3H A;  4Q5S F;  5L0C A;  1FFH A;  2I8B A;  4IRU A;  3SXY A;  1LM3 B;  1ZYR F;  3ADC A;  3JZ0 A;  3RQG A;  3W8I B;  2Q3T A;  1ZU5 A;  1J8M F;  4P9F A;  4I1O B;  2BL2 A;  2GA0 A;  2KQ9 A;  5L0G A;  3Q6M A;  2CGE A;  1E83 A;  5KYY B;  3DM9 B;  4HFK B;  5A6B A;  1T9K A;  2GAQ A;  5COM A;  1T6U A;  3DJU B;  5HSW A;  2E87 A;  1U0B B;  3C7J A;  1UFB A;  5JP7 A;  2XXA A;  4MTO A;  1YJG A;  3HIN A;  4ANJ A;  3N0T A;  4K0D A;  2IBF A;  4DVY P;  1RCP A;  3VM6 A;  4D4N A;  4YL0 A;  2D4U A;  1FNT c;  2VX2 A;  1OCR C;  3NKE A;  2ZD9 A;  3WOD F;  1SYQ A;  2JX0 A;  3QTH A;  3H81 A;  4O6M A;  5JS5 A;  2J9U A;  2QLA A;  3EFO A;  1PV3 A;  3S9O A;  3HNJ A;  1HW2 A;  2OQM A;  4JIO A;  3RIP A;  3F47 A;  2XXA B;  4C3D A;  1BR2 A;  2NSG A;  4QI0 A;  4JKV A;  4U5E E;  4JOT A;  1V55 C;  4G0H A;  3CZ6 A;  1MJ3 A;  1HE9 A;  3OC7 A;  2EIM C;  4FES A;  2AWC A;  5KYW B;  2R7X A;  3R2P A;  4F4B A;  4U5B E;  4AK9 A;  1HZD A;  2FAP B;  4J7T A;  4KC9 A;  3MBG A;  1VLS A;  5DS6 A;  3NYM A;  5L0J A;  3EFO B;  4FZW C;  3NKD A;  4K3W A;  4JJG A;  1CGM E;  4QDL A;  5DS5 A;  2KNH A;  4U5C E;  2A1D D;  2R7W A;  1ORJ A;  1Z3I X;  2R25 A;  2KK1 A;  3R0O A;  1Z7Q c;  3I47 A;  3UMH A;  1C17 M;  2R7O A;  4A2N B;  4U5G A;  2Y3G A;  4AE4 B;  5L3V A;  4PJM A;  4PJN A;  4CS8 A;  3H2U A;  2LCH A;  4FJW D;  3EGD A;  1WZ8 A;  2XSE A;  3T6G B;  4GEH A;  4YWQ A;  4I42 A;  2DGJ A;  3GEE A;  1LS1 A;  2KC3 A;  1S05 A;  2M64 A;  3EZI A;  2P6V A;  5CI9 A;  2HJ3 A;  5B3I A;  3DKA A;  2OJQ A;  1NZY A;  2UZF A;  2CYD A;  3WHN A;  4PFP A;  1EY3 A;  5AGF A;  3BRJ A;  1WAS A;  4JYL A;  1Z63 A;  2G3K A;  2A69 F;  3KPH A;  1B68 A;  1WAT A;  2RSE B;  2I15 A;  2J9W A;  1O3U A;  1RJM A;  1QVX A;  1JMW A;  3FXH A;  2VH3 A;  3O10 A;  1QZX A;  2AU5 A;  4A4A A;  3DI5 A;  1APC A;  4YL1 A;  3S84 A;  1YZA A;  1NZY B;  1GGQ A;  2J9B A;  2J8W A;  2NUT A;  3MLG A;  2IXM A;  3HJC A;  2XL6 A;  4KBL A;  3FMS A;  4BPM A;  3DMD A;  3H65 A;  3S27 A;  3S29 A;  1MMN A;  3LES A;  2LSE A;  4O79 A;  3KH2 A;  4MVM A;  4JZA A;  4O7G A;  3DWW A;  2Y69 C;  4O6N A;  4LDQ A;  1MQV A;  3C8Z A;  2YHS A;  4Q4Z F;  1D0X A;  2L81 A;  4GYT A;  4KNW A;  2EIN C;  3ZQV A;  2KSF A;  4OIQ F;  4U18 A;  2NUT B;  1CPR A;  3NYJ A;  4BJ5 A;  2Q4F A;  3JT1 A;  1R4T A;  1YAR O;  4PAC A;  4I1M A;  3DZA A;  4XTK A;  3TJ5 A;  2TMV P;  4IWB A;  4XEV A;  1V4A A;  3HNI A;  4CX9 A;  2EPM X;  1A7D A;  2A0B A;  4MVR A;  3LLK A;  3SXK A;  3LS0 A;  4I4Z A;  1YAU O;  2FW2 A;  3PCV A;  1VYI A;  1TFK B;  2FFH A;  3M15 A;  3ZTZ A;  1O5H A;  1K40 A;  2ZXP A;  1SZI A;  1ZHZ A;  4JUR I;  4JJF A;  4LER A; 
#chains in the Genus database with same CATH homology
 4NQF A;  1UX4 A;  3C18 A;  3U0C A;  2HSB A;  3L8J A;  2JX0 A;  3B71 A;  3MFN A;  2YWA A;  4XEK A;  3ADD A;  4NNQ A;  1PV3 A;  1UX5 A;  3GM1 A;  3S9O A;  4XEF A;  3TUL A;  1K05 A;  1OW6 A;  5F28 E;  3ADC A;  3JZ0 A;  3RQG A;  3W8I B;  3C8G A;  2L6F A;  3GM2 A;  4EBJ A;  3W8H B;  4R32 A;  3A4N A;  3K7D A;  3A4M A;  1OW8 A;  1KTM A;  1OW7 A;  2L6G A;  3BRJ A;  2L6H A;  1WOL A;  1WWP A;  2Q00 A;  4EBK A;  3U3F A;  3RQF A;  3L8I A;  1KNY A;  2JPU A;  2PBE A;  3C8G D;  1UFB A;  1K04 A;  2LK4 A;  4XEV A;  1V4A A;  1ZZP A;  1Y64 B;  2P63 A;  3O4X E;  3ADB A;  1O3U A;  1RJM A;  1QVX A;  3JYY A;  1WTY A;  3O10 A;  3AJM A;  2KK1 A;  3C8G B;  3RQE A;  3AM1 A;  3A4L A;  1K40 A;  4GEH B;  3IRB A;  1JOG A;  3GM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...