3RQFA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 74
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqfA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqfA02
3S9OA 1K05A 2JX0A 3B71A 3GM2A 3C18A 1WOLA 3W8IB 2L6GA 1PV3A 4EBKA 1ZZPA 3RQEA 2YWAA 4EBJA 2PBEA 3C8GA 3MFNA 3L8IA 2LK4A 3RQFA 4XEFA 1KTMA 3L8JA 2JPUA 2L6FA 1JOGA 1OW7A 1OW6A 3RQGA 3C8GD 1UFBA 3BRJA 4NQFA 4GEHB 1V4AA 1OW8A 2Q00A 1QVXA 3O10A 1O3UA 3JZ0A 4R32A 1K40A 3AJMA 3TULA 3U3FA 3K7DA 3GM1A 4XEVA 1WWPA 1K04A 3W8HB 1WTYA 2KK1A 2HSBA 3GM3A 2L6HA 3JYYA 5F28E 1KNYA 4XEKA 3U0CA 3C8GB
chains in the Genus database with same CATH superfamily
4C3EA 3NYMA 3LAYA 3KL4A 3SP1A 2Y3GA 2IEXA 1OCOC 2XL6A 1V4AA 3UMKA 1D1BA 4MI2A 2HV6A 3FMSA 3LLKA 1WTYA 1YZAA 1TFOB 1EKYA 3DMDA 3G50A 2FGYA 4OIRF 4BG0A 5K0IA 1E86A 1LS4A 1G4US 2KW3C 3A4LA 4K3WA 3SNHA 2P7VA 2AVKA 1F1MA 2A69F 3N0TA 3HINA 2MHRA 2HMQA 4JCSA 1B68A 1LIHA 2WZLA 3ZG1A 4JCZA 1HY5A 3C62A 3JTLO 2CYDA 4MTGA 4J7TA 1V55C 2A6HF 4MTOA 4K0DA 5JSLA 1SZIA 3W2VA 1WWPA 5D92A 2YEVA 1RMVA 2VC9A 4D4NA 5BQIA 1Q51A 2IYLD 1KU2A 5FCLA 4Z9JA 4MTFA 4RD9A 3UR3C 2I8BA 2OEXA 3NKEA 4FZWC 2A0UA 2W45A 4XPYA 2NG1A 3FXHA 1R4TA 1BDJB 1OCCC 3AM1A 4QDLA 1EF8A 2DUBA 1TQGA 1E2XA 4U5GA 4EUKB 3DD7A 2NUTB 3ZSUA 3IQTA 4KBLA 2QNLA 3N2ZB 1YARO 4JIOA 1VMAA 4DRJB 3RF3A 1Q0DA 2H7OA 3EFOB 2DYRC 3CZ6A 1OKKA 3TRRA 2Y69C 2HZ8A 1Z5ZA 4PJMA 4BJ1A 4EBBA 5JBXA 5L3QA 3WAQA 1YZCA 3S27A 3M4CA 3HKKA 4RBNA 4U5FE 3WG7C 2D5RB 2ASRA 2HSQA 2CGEA 4JC7A 2X0CA 1JPJA 3UGPA 3T89A 4D4XA 5DQTA 1ZU5A 3GEEA 3GORA 4A2NB 3OA1A 2HSBA 2EPLX 3QW0A 3JRMO 1JPNA 3T6JA 2HKVA 2ETSA 4GEHB 4U1AA 4U18A 2CNWA 2I15A 3WHNA 1V74B 1ZHWA 3LLIA 5A6BD 2FBMA 2PNOA 1WZ8A 3IQCA 4BJ5A 4E7ZA 4MVMA 1VB5A 3O10A 4Q5SF 3AG3C 2DI3A 2P1AA 3M4BA 2FFHA 3GWNA 1ZW3A 4NTAA 1W2WA 4LLCA 3UGOA 2OJED 1M2VA 4MQ9F 2LK4A 3B0PA 4MW8A 4BPMA 1Z6AA 1ORJA 3MYIA 4C7OA 1E85A 4E0IA 5JRAA 1RCPA 5KYXB 4G7HF 3TD7A 1TR2A 1FFHA 4ULWA 4PK4A 1ZZPA 4MVQA 4K1OA 3LS1A 4CS8A 3H2UA 2OEVA 1NU7D 1MMGA 4CX9A 3KPHA 2UUHA 2WVQA 4J30B 2R02A 2XLVA 4MVRA 4C3BA 2VB6A 3ABMC 1D0XA 1KTMA 2L6FA 2NUPA 5JUAA 4NEKA 3O39A 3W2WA 3LJBA 2XS1A 3RFYA 1YYXA 1ST6A 3B71A 4FX5A 4LDQA 3I4UA 3VAYA 1E84A 1J8YF 1JOGA 4XPWA 3S90A 2ZXRA 2ZXOA 4ANJA 4OD4A 1XZQA 3QK8A 3AOUA 1LI7A 1XWJA 5B1BC 2W9YA 2HJMA 1VYKA 3ECSA 4QIIA 3FDQA 3S84A 1SYQA 4JTDB 3C63A 3K66A 1UX4A 3TQOA 1IW7F 1C02A 4P9FA 5DS4A 2V26A 3MYFA 4OD5A 2G62A 4OINF 2V3CC 4MOUA 3P5MA 3DM5A 2YRFA 1LE4A 2Q00A 3RW0A 1YDIA 2UZFA 2UUIA 1OCRC 3CSKA 3E70C 2PX0A 2D4UA 1VLTA 4XQ1A 4FZWA 1ZW2A 3ZDLA 4MVSA 3NYLA 5CI8A 2PBEA 2X51A 2QUPA 1HMDA 1ZYRF 2R9RB 1DCIA 1VTMP 4YT2A 3EGXA 2GWWA 2P0NA 1ZHXA 1NBBA 3H2VA 5A6KA 4J7YA 4IWBA 4YN0B 5TJ5E 3S9OA 1E83A 4WGZA 1Q0MA 3LUTB 3KH2A 3RQGA 3IQ5A 3V5YA 5L0CA 5E2QA 3R7CA 1L3PA 2HS5A 3GODA 4N06A 4DJ9A 1U0BB 4YWQA 2KQ9A 1EF9A 1D0ZA 4DOZA 2GFHA 3IQ6A 1PV3A 4EBJA 1T6IA 4XEFA 3L34A 3H65A 1TKNA 2YLIA 4HE8D 4JCHA 1Z23A 1AVOB 4JJGA 4OG1A 3O6XA 3H02A 2GA0A 3W4YA 2XS8A 3GEIA 3KKBA 2O9XA 4G7ZF 4CSAC 4IZDA 1ZHZA 4U5BE 4JEAA 3X2QC 3MBGA 4YL1A 3ABKC 2EPNA 1RKCA 2Q3TA 3TJ6A 4JURI 3FOPA 3IPMO 3EG9A 1ORYA 2LP4A 4U5HA 2HFIA 4U9DA 1IZMA 2IXPA 2W4BA 1FFTC 5HSWA 5DS6A 4LACB 3DXJF 1CGME 3JYYA 4QI2A 4DBQA 1YVIA 2ZXPA 5GPGB 3I5QA 4EWCA 4LLEA 3TK0A 1OXKA 4WCZA 2EJ5A 3JZ0A 3EZHA 2YVKA 1I4YA 3AG4C 2ICWG 2Y39A 3SXMA 2QLAA 1TWAA 1Q0GA 3R9TA 1A7DA 3C8ZA 5JT4A 4FJWD 3MLGA 4KNPA 1G8XA 3VYWA 2KNHA 2ZQRA 4HEAJ 3HLZA 3EJNA 2CW0F 1OR3A 4X0RA 4NCQA 2JD3A 3NMJA 5EK0A 4Q4ZF 5JP7A 5A6JA 3U5SA 5KYUA 1YLMA 4B6IA 1MQVA 2R7XA 4DVYP 4ER9A 5FZTA 1K04A 2YKZA 4NC3A 1M2VB 3A4MA 2VX2A 5F5HA 5DLJA 2LFDA 4FWVA 1OW6A 4C7OB 4H4KC 1MMNA 1RXQA 2PP4A 2R7SA 2EPOA 4ELXA 4U5CE 2QQ3A 2GTRA 3T6BA 2XLDA 1NSGB 4A4AA 2DB4A 4I3MA 4DBRA 2J0WA 2XL4A 3ZC4A 3A4NA 1L7CA 3FAJA 2ZXWC 4DVZA 1CPQA 4OIQF 4PFOA 3RH3A 3RSIA 1MNDA 3B9QA 4DXWA 3W8HA 1GGQA 2NUPB 4JE9A 2VCAA 3GEHA 2TMVP 3ZTMA 2J0XA 2A6EF 4DRHB 2OQMA 2EPKX 3T9OA 2ZQQA 2Y3BA 2WZGA 3B0UX 1FR0A 4LERA 2M64A 1LKXA 4P9TA 2WL8A 1Q0KA 5KJPA 4JEBA 3Q0GA 3Q6NA 3U2MA 1QLEC 3K33A 1KNYA 5DS5A 1SR2A 4CJGA 5KYYA 5T3WA 4AX2A 2QTVA 3L8JA 4O6MA 2HV7A 4FAPB 2FW2A 4OLQA 2C04A 3CQZA 2A1DD 5CIVA 4FESA 1SF8A 2OKUA 2YLGA 3SXKA 3JCUQ 4JVSA 1K05A 1FMWA 4JW1A 3ZWIA 5BQHA 4CDAA 1N1CA 4JRZA 4G7OF 2YL0A 4WGYA 1V54C 4I42A 3HNIA 1HE9A 3JRTA 3I5PA 4JWVA 2LQGA 3J06A 3UMHA 3U0CA 3H81A 1EY3A 2JX0A 3GM2A 4CBEA 5EGYA 3EGDA 2YWAA 1O5HA 3EGXB 4CSAA 1NG1A 5L0IA 1QVXA 2XLHA 4YT4A 4AL0A 3NKDA 1UG7A 3T4RA 5A6BA 2P61A 4NY3A 1VYIA 2VCCA 3MFNA 4W8KA 3US6A 1YAUO 1RKEA 2J7PD 4YK5A 3IHUA 1O3UA 4IARA 3TJ5A 3K1HA 1T6QA 3GM3A 1GM5A 1OQCA 3S0XA 4QIJA 3ZQVA 3JSZA 1DOWA 4IRUA 2YL1A 1LI5A 1HW2A 2J7PA 4J32B 4KNVA 1D1CA 3NMKA 3R2PA 4LDRA 3U3BA 2Q9CA 2ZPAA 4G78A 2IBFA 4M63A 1RJ9A 3NMIA 5L3VA 3SZRA 4E17A 4JFCA 1TWCA 3L1MA 1GQAA 1R5ID 1H9GA 2FAPB 4AK9A 4JTAB 3EG9B 4ELWA 1OW8A 1ZHYA 256BA 3NG1A 2H7BA 1CPRA 3QW1A 1XZPA 4ZLCA 4O79A 2YHSA 3HNJA 1BR2A 4WABA 2PBPA 4N4WA 1JAFA 4H54A 2EIMC 3AQBA 2OJQA 2XLEA 4OIOF 4WJ0A 4YJWA 2IM8A 1AUEA 3EQLF 2NSGA 5F28E 1NU9C 4XLNF 1LM3B 3HNKA 4IAOA 5KYWA 4I52A 3ITFA 4K2NA 1UIYA 2YZSA 2J45A 5CI9A 2F22A 1HW1A 1FNTc 1TWHA 2RSEB 3N24A 2Y3DA 4BJ6C 1NZYA 1FTSA 3K7DA 2YQYA 2XXAA 2KK1A 5JLIA 3DKAA 1D0YA 3OWTA 4PJLA 3OC7A 2OG2A 2J9VA 2LFFA 5B3SC 3DAGA 3ADCA 4MVOA 1DOVA 2P6VA 2Q9BA 4EKWA 4YL0A 5BQGA 2P63A 1M56C 5KYUB 4AE4A 3GWLA 2B0HA 3AGTA 1MMDA 1A0BA 5COFA 2NPUA 1FAPB 2J8WA 2A0BA 2R7OA 3HJCA 1OR2A 3V5ZA 2LD6A 1EA8A 3O4XE 4C3DA 4IZCA 4PJNA 3M1CB 4MS2A 4W8PA 1T01A 3OEOA 3DJNB 1A7VA 3EHMA 1DUBA 2H8AA 2EPMX 4XEVA 2M4EA 4XEKA 3AGUA 4CDYA 2KJGA 4G0HA 3DM9B 4U19A 3NRHA 3G64A 4ZU2A 3HRXA 4O6NA 3TOMA 1CGOA 3K6BA 3JSEO 3W8HB 1OCZC 5AC5A 4NTFA 2BL2A 4JYLA 3QTHA 3EHNA 3SXYA 1NFOA 3LNMB 3U2LA 3AJMA 4CS7A 2QY9A 3R0OA 5C9GA 3RKOF 1HMOA 3EH1A 4IZBA 4F47A 1Z63A 2R7VA 3QVZA 3W8IA 3EH2A 1H7IA 2IXMA 1SMYF 1FMVA 2EINC 5KYYB 3ZIBA 1PCXA 1BR1A 3B29A 1M57C 2Z15A 3PHF2 3U9MA 3QVYA 3S28A 1G5ZA 2XLWA 3KMIA 5L0HA 2C03A 4CS9C 2DGJA 1OXBA 3FHDA 3AG1C 1QQ3A 4I1OB 2XLOA 1OW7A 2VCBA 2B0JA 5JBWA 1S7ZA 4R32A 3U3FA 4BJTA 1QPUA 1RJNA 3EGDB 2OCCC 1LVKA 4KC9A 3ZTZA 3QXIA 2CCYA 1ZU4A 4XWJA 3KYIA 4NTBA 3Q0JA 3SLLA 1VK5A 4YT5A 3MOYA 1PD0A 3A11A 4MVUA 3LESA 3SYNA 2E87A 3ATPA 3ADDA 1Y64B 1T5OA 3DI5A 1RKEB 2NSFA 3EPVA 2AP3A 4JKVA 2QE9A 3E9VA 4L6RA 4LDKA 3M79A 1ORSC 5HV9A 4EHPA 1EQ1A 2Q4FA 4I4ZA 4AL1A 3IEEA 2Q9AA 5A6AA 3L0IA 3X1OA 2XM4A 4EMLA 5COMA 5DQZA 5KYNA 3C8GD 1G4WR 3BRJA 4ULVA 3QZCA 2PF4E 1RJ9B 4IGGA 2L81A 4U5EE 2KGOA 3ASOC 2WZFA 3U8VA 4BJ6A 2PFDA 1NZEA 1H6GA 4I44A 1ZVZA 1RJMA 3PDMP 4JJFA 2F6QA 3DAFA 3C8GA 1APCA 4XLPF 2BE5F 1WN0A 2L9JA 5E3AA 1MMAA 2KSFA 3GANA 2KC3A 3C18A 2R7UA 5T1DB 2MYSA 3TLFA 1OKKD 1LE2A 5DVWA 3T6GB 1UFBA 2ZD9A 4KI2A 4U5DE 1T6UA 1NFNA 2R25A 1O87A 2EILC 1HZDA 1ZHTA 5EHHA 4U9EA 1Q0FA 5KYWB 2WB7A 1WOLA 4EBKA 1I5NA 3RQEA 1NZYB 2KYHA 2WVOA 2XXAB 4N6CA 3RIPA 3FVYA 3KYJA 2EIJC 3F47A 1AEPA 4QI0A 4F4BA 5L0DA 1QZXA 4RDAA 1LPEA 2Q7RA 3ZVRA 2VH3A 3K1IC 2L7AA 1EI7A 1JMWA 2CNWD 5E3CA 3FAPB 4AE4B 2LIGA 1VLSA 3ADBA 4ONSA 3LEVA 4P6IC 4IB4A 4BEMJ 3I47A 2XSEA 3RQFA 4IJJA 1BBHA 2AWCA 4MW3A 1MNEA 3C7JA 2VASA 3AQCA 2R7QA 1T9KA 1A7EA 1M6TA 2AWYA 2LCHA 4HFKB 1GS9A 1JR8A 1NLXA 3S29A 2IXOA 3DE9A 2W4MA 5IY5C 2R7TA 2VREA 2J9WA 3MYBA 2GDCA 3M15A 3KQFA 2HUJA 1Y6DA 1S05A 1Q52A 1A41A 3LNRA 1MJ3A 2GAQA 2OU6A 4GQHA 4NNQA 4UDVA 5A69A 2CDQA 4IAQA 4CJOA 2XLMA 5D91A 5JVEA 1YJGA 4CS9A 3R9SA 3CEXA 3U9JA 1CGNA 3DE8A 1TWGA 3FDUA 1VOMA 1H9TA 3AG2C 5JS5A 2PPYA 2YL3A 1JXZA 2EIKC 1C03A 3W8IB 2L6GA 4CDVA 3T88A 5L0JA 5E33A 2R05A 5B3IA 3RVYA 2XRHA 3CAXA 4N6HA 2MWQA 3POVA 1C17M 2HW5A 5B1AC 2NUTA 3JYHA 3RVZA 3EFOA 2RD9A 2XL8A 4JTCB 3DZAA 4I1MA 4CIPA 5F5FA 3VM6A 3GM1A 3B0VC 3BEHA 3Q6MA 4MVZA 1BR4A 3DJUB 3JT1A 5BUOA 3V5XA 2J9UA 3RYLA 4PR9A 2PX3A 1QSPA 3IRBA 4EIYA 1J8MF 5AGFA 2Y3HA 3ASNC 3LS0A 3L8IA 2J9BA 3NYJA 4XPXA 3F46A 3UNGC 2WVNA 1K40A 4Z9HA 3TULA 4GEHA 3FOOA 3ZQYA 2A68F 2H7VC 1D1AA 2G3KA 1M2OA 4YT8A 2HMZA 4PFPA 3A9CA 2R7WA 3HTKC 4DRIB 5T3TA 2IXNA 2YL7A 4GYTA 1QKRA 1LS1A 3Q7LA 3V7OA 4ELSA 2YLDA 2HJ3A 2IOQA 3VF0A 5L0GA 3HNLA 3QXZA 2XM0A 3WODF 3NDBB 2DYSC 2AU5A 4MNDA 3SEOA 4Z9IA 4O6YA 3C8GB 5KYXA 1JRAA 1PD1A 3SWXA 3MX3A 4PACA 2R03A 1TFKB 4NQFA 3G4XA 4CIHA 3EZIA 3K1IA 5AC4A 3VRCA 3TOLA 1Z3IX 1I4ZA 3SXZA 2R7RA 3PMRA 4OIPF 4ZLDA 4BJ5C 4O7GA 4E0HA 2J46A 3O55A 4PJJA 2OOCA 1HE1A 4XTKA 2G3VA 4K7BA 4BEJA 3LEOA 3Q1TA 1U89A 3U8PA 4Q7CA 3G4ZA 5COGA 1UX5A 3Q7GA 1YA7O 1WATA 1YYJA 3DWWA 1Z7Qc 4KNWA 3QMKA 4E18A 1YA9A 1WASA 3PZKA 1Y4CA 1U6HA 1WGWA 4E7SA 4JZAA 3PCVA 4CS8C 2JPUA 2BC5A 4YL3A 4JOTA 3T8AA 5L0FA 1BZ4A 2L6HA 3ABLC 4HFFB 2LSEA 3UMIA
chains in the Genus database with same CATH topology
3S9OA 1K05A 3B71A 1WOLA 4EBKA 3RQEA 3ADDA 3AM1A 1Y64B 1JOGA 3RQGA 4NNQA 3A4NA 4NQFA 1V4AA 1OW8A 3O10A 3JZ0A 3IRBA 1WTYA 3U0CA 2JX0A 3GM2A 1PV3A 3O4XE 2YWAA 4EBJA 3L8IA 2LK4A 4XEFA 3C8GD 3BRJA 1QVXA 1UX4A 3A4LA 1K40A 3TULA 4XEVA 3ADBA 5F28E 4XEKA 1RJMA 3W8IB 2L6GA 1UX5A 1ZZPA 3C8GA 3MFNA 3RQFA 1OW7A 2Q00A 1O3UA 4R32A 3U3FA 3K7DA 1WWPA 1K04A 3W8HB 2KK1A 3GM3A 2HSBA 1KNYA 3A4MA 3C18A 2PBEA 1KTMA 3L8JA 2JPUA 2L6FA 1OW6A 1UFBA 4GEHB 3ADCA 3AJMA 3GM1A 2L6HA 3JYYA 2P63A 3C8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  1K05 A;  2JX0 A;  3B71 A;  3GM2 A;  3C18 A;  1WOL A;  3W8I B;  2L6G A;  1PV3 A;  4EBK A;  1ZZP A;  3RQE A;  2YWA A;  4EBJ A;  2PBE A;  3C8G A;  3MFN A;  3L8I A;  2LK4 A;  3RQF A;  4XEF A;  1KTM A;  3L8J A;  2JPU A;  2L6F A;  1JOG A;  1OW7 A;  1OW6 A;  3RQG A;  3C8G D;  1UFB A;  3BRJ A;  4NQF A;  4GEH B;  1V4A A;  1OW8 A;  2Q00 A;  1QVX A;  3O10 A;  1O3U A;  3JZ0 A;  4R32 A;  1K40 A;  3AJM A;  3TUL A;  3U3F A;  3K7D A;  3GM1 A;  4XEV A;  1WWP A;  1K04 A;  3W8H B;  1WTY A;  2KK1 A;  2HSB A;  3GM3 A;  2L6H A;  3JYY A;  5F28 E;  1KNY A;  4XEK A;  3U0C A;  3C8G B; 
#chains in the Genus database with same CATH topology
 4C3E A;  3NYM A;  3LAY A;  3KL4 A;  3SP1 A;  2Y3G A;  2IEX A;  1OCO C;  2XL6 A;  1V4A A;  3UMK A;  1D1B A;  4MI2 A;  2HV6 A;  3FMS A;  3LLK A;  1WTY A;  1YZA A;  1TFO B;  1EKY A;  3DMD A;  3G50 A;  2FGY A;  4OIR F;  4BG0 A;  5K0I A;  1E86 A;  1LS4 A;  1G4U S;  2KW3 C;  3A4L A;  4K3W A;  3SNH A;  2P7V A;  2AVK A;  1F1M A;  2A69 F;  3N0T A;  3HIN A;  2MHR A;  2HMQ A;  4JCS A;  1B68 A;  1LIH A;  2WZL A;  3ZG1 A;  4JCZ A;  1HY5 A;  3C62 A;  3JTL O;  2CYD A;  4MTG A;  4J7T A;  1V55 C;  2A6H F;  4MTO A;  4K0D A;  5JSL A;  1SZI A;  3W2V A;  1WWP A;  5D92 A;  2YEV A;  1RMV A;  2VC9 A;  4D4N A;  5BQI A;  1Q51 A;  2IYL D;  1KU2 A;  5FCL A;  4Z9J A;  4MTF A;  4RD9 A;  3UR3 C;  2I8B A;  2OEX A;  3NKE A;  4FZW C;  2A0U A;  2W45 A;  4XPY A;  2NG1 A;  3FXH A;  1R4T A;  1BDJ B;  1OCC C;  3AM1 A;  4QDL A;  1EF8 A;  2DUB A;  1TQG A;  1E2X A;  4U5G A;  4EUK B;  3DD7 A;  2NUT B;  3ZSU A;  3IQT A;  4KBL A;  2QNL A;  3N2Z B;  1YAR O;  4JIO A;  1VMA A;  4DRJ B;  3RF3 A;  1Q0D A;  2H7O A;  3EFO B;  2DYR C;  3CZ6 A;  1OKK A;  3TRR A;  2Y69 C;  2HZ8 A;  1Z5Z A;  4PJM A;  4BJ1 A;  4EBB A;  5JBX A;  5L3Q A;  3WAQ A;  1YZC A;  3S27 A;  3M4C A;  3HKK A;  4RBN A;  4U5F E;  3WG7 C;  2D5R B;  2ASR A;  2HSQ A;  2CGE A;  4JC7 A;  2X0C A;  1JPJ A;  3UGP A;  3T89 A;  4D4X A;  5DQT A;  1ZU5 A;  3GEE A;  3GOR A;  4A2N B;  3OA1 A;  2HSB A;  2EPL X;  3QW0 A;  3JRM O;  1JPN A;  3T6J A;  2HKV A;  2ETS A;  4GEH B;  4U1A A;  4U18 A;  2CNW A;  2I15 A;  3WHN A;  1V74 B;  1ZHW A;  3LLI A;  5A6B D;  2FBM A;  2PNO A;  1WZ8 A;  3IQC A;  4BJ5 A;  4E7Z A;  4MVM A;  1VB5 A;  3O10 A;  4Q5S F;  3AG3 C;  2DI3 A;  2P1A A;  3M4B A;  2FFH A;  3GWN A;  1ZW3 A;  4NTA A;  1W2W A;  4LLC A;  3UGO A;  2OJE D;  1M2V A;  4MQ9 F;  2LK4 A;  3B0P A;  4MW8 A;  4BPM A;  1Z6A A;  1ORJ A;  3MYI A;  4C7O A;  1E85 A;  4E0I A;  5JRA A;  1RCP A;  5KYX B;  4G7H F;  3TD7 A;  1TR2 A;  1FFH A;  4ULW A;  4PK4 A;  1ZZP A;  4MVQ A;  4K1O A;  3LS1 A;  4CS8 A;  3H2U A;  2OEV A;  1NU7 D;  1MMG A;  4CX9 A;  3KPH A;  2UUH A;  2WVQ A;  4J30 B;  2R02 A;  2XLV A;  4MVR A;  4C3B A;  2VB6 A;  3ABM C;  1D0X A;  1KTM A;  2L6F A;  2NUP A;  5JUA A;  4NEK A;  3O39 A;  3W2W A;  3LJB A;  2XS1 A;  3RFY A;  1YYX A;  1ST6 A;  3B71 A;  4FX5 A;  4LDQ A;  3I4U A;  3VAY A;  1E84 A;  1J8Y F;  1JOG A;  4XPW A;  3S90 A;  2ZXR A;  2ZXO A;  4ANJ A;  4OD4 A;  1XZQ A;  3QK8 A;  3AOU A;  1LI7 A;  1XWJ A;  5B1B C;  2W9Y A;  2HJM A;  1VYK A;  3ECS A;  4QII A;  3FDQ A;  3S84 A;  1SYQ A;  4JTD B;  3C63 A;  3K66 A;  1UX4 A;  3TQO A;  1IW7 F;  1C02 A;  4P9F A;  5DS4 A;  2V26 A;  3MYF A;  4OD5 A;  2G62 A;  4OIN F;  2V3C C;  4MOU A;  3P5M A;  3DM5 A;  2YRF A;  1LE4 A;  2Q00 A;  3RW0 A;  1YDI A;  2UZF A;  2UUI A;  1OCR C;  3CSK A;  3E70 C;  2PX0 A;  2D4U A;  1VLT A;  4XQ1 A;  4FZW A;  1ZW2 A;  3ZDL A;  4MVS A;  3NYL A;  5CI8 A;  2PBE A;  2X51 A;  2QUP A;  1HMD A;  1ZYR F;  2R9R B;  1DCI A;  1VTM P;  4YT2 A;  3EGX A;  2GWW A;  2P0N A;  1ZHX A;  1NBB A;  3H2V A;  5A6K A;  4J7Y A;  4IWB A;  4YN0 B;  5TJ5 E;  3S9O A;  1E83 A;  4WGZ A;  1Q0M A;  3LUT B;  3KH2 A;  3RQG A;  3IQ5 A;  3V5Y A;  5L0C A;  5E2Q A;  3R7C A;  1L3P A;  2HS5 A;  3GOD A;  4N06 A;  4DJ9 A;  1U0B B;  4YWQ A;  2KQ9 A;  1EF9 A;  1D0Z A;  4DOZ A;  2GFH A;  3IQ6 A;  1PV3 A;  4EBJ A;  1T6I A;  4XEF A;  3L34 A;  3H65 A;  1TKN A;  2YLI A;  4HE8 D;  4JCH A;  1Z23 A;  1AVO B;  4JJG A;  4OG1 A;  3O6X A;  3H02 A;  2GA0 A;  3W4Y A;  2XS8 A;  3GEI A;  3KKB A;  2O9X A;  4G7Z F;  4CSA C;  4IZD A;  1ZHZ A;  4U5B E;  4JEA A;  3X2Q C;  3MBG A;  4YL1 A;  3ABK C;  2EPN A;  1RKC A;  2Q3T A;  3TJ6 A;  4JUR I;  3FOP A;  3IPM O;  3EG9 A;  1ORY A;  2LP4 A;  4U5H A;  2HFI A;  4U9D A;  1IZM A;  2IXP A;  2W4B A;  1FFT C;  5HSW A;  5DS6 A;  4LAC B;  3DXJ F;  1CGM E;  3JYY A;  4QI2 A;  4DBQ A;  1YVI A;  2ZXP A;  5GPG B;  3I5Q A;  4EWC A;  4LLE A;  3TK0 A;  1OXK A;  4WCZ A;  2EJ5 A;  3JZ0 A;  3EZH A;  2YVK A;  1I4Y A;  3AG4 C;  2ICW G;  2Y39 A;  3SXM A;  2QLA A;  1TWA A;  1Q0G A;  3R9T A;  1A7D A;  3C8Z A;  5JT4 A;  4FJW D;  3MLG A;  4KNP A;  1G8X A;  3VYW A;  2KNH A;  2ZQR A;  4HEA J;  3HLZ A;  3EJN A;  2CW0 F;  1OR3 A;  4X0R A;  4NCQ A;  2JD3 A;  3NMJ A;  5EK0 A;  4Q4Z F;  5JP7 A;  5A6J A;  3U5S A;  5KYU A;  1YLM A;  4B6I A;  1MQV A;  2R7X A;  4DVY P;  4ER9 A;  5FZT A;  1K04 A;  2YKZ A;  4NC3 A;  1M2V B;  3A4M A;  2VX2 A;  5F5H A;  5DLJ A;  2LFD A;  4FWV A;  1OW6 A;  4C7O B;  4H4K C;  1MMN A;  1RXQ A;  2PP4 A;  2R7S A;  2EPO A;  4ELX A;  4U5C E;  2QQ3 A;  2GTR A;  3T6B A;  2XLD A;  1NSG B;  4A4A A;  2DB4 A;  4I3M A;  4DBR A;  2J0W A;  2XL4 A;  3ZC4 A;  3A4N A;  1L7C A;  3FAJ A;  2ZXW C;  4DVZ A;  1CPQ A;  4OIQ F;  4PFO A;  3RH3 A;  3RSI A;  1MND A;  3B9Q A;  4DXW A;  3W8H A;  1GGQ A;  2NUP B;  4JE9 A;  2VCA A;  3GEH A;  2TMV P;  3ZTM A;  2J0X A;  2A6E F;  4DRH B;  2OQM A;  2EPK X;  3T9O A;  2ZQQ A;  2Y3B A;  2WZG A;  3B0U X;  1FR0 A;  4LER A;  2M64 A;  1LKX A;  4P9T A;  2WL8 A;  1Q0K A;  5KJP A;  4JEB A;  3Q0G A;  3Q6N A;  3U2M A;  1QLE C;  3K33 A;  1KNY A;  5DS5 A;  1SR2 A;  4CJG A;  5KYY A;  5T3W A;  4AX2 A;  2QTV A;  3L8J A;  4O6M A;  2HV7 A;  4FAP B;  2FW2 A;  4OLQ A;  2C04 A;  3CQZ A;  2A1D D;  5CIV A;  4FES A;  1SF8 A;  2OKU A;  2YLG A;  3SXK A;  3JCU Q;  4JVS A;  1K05 A;  1FMW A;  4JW1 A;  3ZWI A;  5BQH A;  4CDA A;  1N1C A;  4JRZ A;  4G7O F;  2YL0 A;  4WGY A;  1V54 C;  4I42 A;  3HNI A;  1HE9 A;  3JRT A;  3I5P A;  4JWV A;  2LQG A;  3J06 A;  3UMH A;  3U0C A;  3H81 A;  1EY3 A;  2JX0 A;  3GM2 A;  4CBE A;  5EGY A;  3EGD A;  2YWA A;  1O5H A;  3EGX B;  4CSA A;  1NG1 A;  5L0I A;  1QVX A;  2XLH A;  4YT4 A;  4AL0 A;  3NKD A;  1UG7 A;  3T4R A;  5A6B A;  2P61 A;  4NY3 A;  1VYI A;  2VCC A;  3MFN A;  4W8K A;  3US6 A;  1YAU O;  1RKE A;  2J7P D;  4YK5 A;  3IHU A;  1O3U A;  4IAR A;  3TJ5 A;  3K1H A;  1T6Q A;  3GM3 A;  1GM5 A;  1OQC A;  3S0X A;  4QIJ A;  3ZQV A;  3JSZ A;  1DOW A;  4IRU A;  2YL1 A;  1LI5 A;  1HW2 A;  2J7P A;  4J32 B;  4KNV A;  1D1C A;  3NMK A;  3R2P A;  4LDR A;  3U3B A;  2Q9C A;  2ZPA A;  4G78 A;  2IBF A;  4M63 A;  1RJ9 A;  3NMI A;  5L3V A;  3SZR A;  4E17 A;  4JFC A;  1TWC A;  3L1M A;  1GQA A;  1R5I D;  1H9G A;  2FAP B;  4AK9 A;  4JTA B;  3EG9 B;  4ELW A;  1OW8 A;  1ZHY A;  256B A;  3NG1 A;  2H7B A;  1CPR A;  3QW1 A;  1XZP A;  4ZLC A;  4O79 A;  2YHS A;  3HNJ A;  1BR2 A;  4WAB A;  2PBP A;  4N4W A;  1JAF A;  4H54 A;  2EIM C;  3AQB A;  2OJQ A;  2XLE A;  4OIO F;  4WJ0 A;  4YJW A;  2IM8 A;  1AUE A;  3EQL F;  2NSG A;  5F28 E;  1NU9 C;  4XLN F;  1LM3 B;  3HNK A;  4IAO A;  5KYW A;  4I52 A;  3ITF A;  4K2N A;  1UIY A;  2YZS A;  2J45 A;  5CI9 A;  2F22 A;  1HW1 A;  1FNT c;  1TWH A;  2RSE B;  3N24 A;  2Y3D A;  4BJ6 C;  1NZY A;  1FTS A;  3K7D A;  2YQY A;  2XXA A;  2KK1 A;  5JLI A;  3DKA A;  1D0Y A;  3OWT A;  4PJL A;  3OC7 A;  2OG2 A;  2J9V A;  2LFF A;  5B3S C;  3DAG A;  3ADC A;  4MVO A;  1DOV A;  2P6V A;  2Q9B A;  4EKW A;  4YL0 A;  5BQG A;  2P63 A;  1M56 C;  5KYU B;  4AE4 A;  3GWL A;  2B0H A;  3AGT A;  1MMD A;  1A0B A;  5COF A;  2NPU A;  1FAP B;  2J8W A;  2A0B A;  2R7O A;  3HJC A;  1OR2 A;  3V5Z A;  2LD6 A;  1EA8 A;  3O4X E;  4C3D A;  4IZC A;  4PJN A;  3M1C B;  4MS2 A;  4W8P A;  1T01 A;  3OEO A;  3DJN B;  1A7V A;  3EHM A;  1DUB A;  2H8A A;  2EPM X;  4XEV A;  2M4E A;  4XEK A;  3AGU A;  4CDY A;  2KJG A;  4G0H A;  3DM9 B;  4U19 A;  3NRH A;  3G64 A;  4ZU2 A;  3HRX A;  4O6N A;  3TOM A;  1CGO A;  3K6B A;  3JSE O;  3W8H B;  1OCZ C;  5AC5 A;  4NTF A;  2BL2 A;  4JYL A;  3QTH A;  3EHN A;  3SXY A;  1NFO A;  3LNM B;  3U2L A;  3AJM A;  4CS7 A;  2QY9 A;  3R0O A;  5C9G A;  3RKO F;  1HMO A;  3EH1 A;  4IZB A;  4F47 A;  1Z63 A;  2R7V A;  3QVZ A;  3W8I A;  3EH2 A;  1H7I A;  2IXM A;  1SMY F;  1FMV A;  2EIN C;  5KYY B;  3ZIB A;  1PCX A;  1BR1 A;  3B29 A;  1M57 C;  2Z15 A;  3PHF 2;  3U9M A;  3QVY A;  3S28 A;  1G5Z A;  2XLW A;  3KMI A;  5L0H A;  2C03 A;  4CS9 C;  2DGJ A;  1OXB A;  3FHD A;  3AG1 C;  1QQ3 A;  4I1O B;  2XLO A;  1OW7 A;  2VCB A;  2B0J A;  5JBW A;  1S7Z A;  4R32 A;  3U3F A;  4BJT A;  1QPU A;  1RJN A;  3EGD B;  2OCC C;  1LVK A;  4KC9 A;  3ZTZ A;  3QXI A;  2CCY A;  1ZU4 A;  4XWJ A;  3KYI A;  4NTB A;  3Q0J A;  3SLL A;  1VK5 A;  4YT5 A;  3MOY A;  1PD0 A;  3A11 A;  4MVU A;  3LES A;  3SYN A;  2E87 A;  3ATP A;  3ADD A;  1Y64 B;  1T5O A;  3DI5 A;  1RKE B;  2NSF A;  3EPV A;  2AP3 A;  4JKV A;  2QE9 A;  3E9V A;  4L6R A;  4LDK A;  3M79 A;  1ORS C;  5HV9 A;  4EHP A;  1EQ1 A;  2Q4F A;  4I4Z A;  4AL1 A;  3IEE A;  2Q9A A;  5A6A A;  3L0I A;  3X1O A;  2XM4 A;  4EML A;  5COM A;  5DQZ A;  5KYN A;  3C8G D;  1G4W R;  3BRJ A;  4ULV A;  3QZC A;  2PF4 E;  1RJ9 B;  4IGG A;  2L81 A;  4U5E E;  2KGO A;  3ASO C;  2WZF A;  3U8V A;  4BJ6 A;  2PFD A;  1NZE A;  1H6G A;  4I44 A;  1ZVZ A;  1RJM A;  3PDM P;  4JJF A;  2F6Q A;  3DAF A;  3C8G A;  1APC A;  4XLP F;  2BE5 F;  1WN0 A;  2L9J A;  5E3A A;  1MMA A;  2KSF A;  3GAN A;  2KC3 A;  3C18 A;  2R7U A;  5T1D B;  2MYS A;  3TLF A;  1OKK D;  1LE2 A;  5DVW A;  3T6G B;  1UFB A;  2ZD9 A;  4KI2 A;  4U5D E;  1T6U A;  1NFN A;  2R25 A;  1O87 A;  2EIL C;  1HZD A;  1ZHT A;  5EHH A;  4U9E A;  1Q0F A;  5KYW B;  2WB7 A;  1WOL A;  4EBK A;  1I5N A;  3RQE A;  1NZY B;  2KYH A;  2WVO A;  2XXA B;  4N6C A;  3RIP A;  3FVY A;  3KYJ A;  2EIJ C;  3F47 A;  1AEP A;  4QI0 A;  4F4B A;  5L0D A;  1QZX A;  4RDA A;  1LPE A;  2Q7R A;  3ZVR A;  2VH3 A;  3K1I C;  2L7A A;  1EI7 A;  1JMW A;  2CNW D;  5E3C A;  3FAP B;  4AE4 B;  2LIG A;  1VLS A;  3ADB A;  4ONS A;  3LEV A;  4P6I C;  4IB4 A;  4BEM J;  3I47 A;  2XSE A;  3RQF A;  4IJJ A;  1BBH A;  2AWC A;  4MW3 A;  1MNE A;  3C7J A;  2VAS A;  3AQC A;  2R7Q A;  1T9K A;  1A7E A;  1M6T A;  2AWY A;  2LCH A;  4HFK B;  1GS9 A;  1JR8 A;  1NLX A;  3S29 A;  2IXO A;  3DE9 A;  2W4M A;  5IY5 C;  2R7T A;  2VRE A;  2J9W A;  3MYB A;  2GDC A;  3M15 A;  3KQF A;  2HUJ A;  1Y6D A;  1S05 A;  1Q52 A;  1A41 A;  3LNR A;  1MJ3 A;  2GAQ A;  2OU6 A;  4GQH A;  4NNQ A;  4UDV A;  5A69 A;  2CDQ A;  4IAQ A;  4CJO A;  2XLM A;  5D91 A;  5JVE A;  1YJG A;  4CS9 A;  3R9S A;  3CEX A;  3U9J A;  1CGN A;  3DE8 A;  1TWG A;  3FDU A;  1VOM A;  1H9T A;  3AG2 C;  5JS5 A;  2PPY A;  2YL3 A;  1JXZ A;  2EIK C;  1C03 A;  3W8I B;  2L6G A;  4CDV A;  3T88 A;  5L0J A;  5E33 A;  2R05 A;  5B3I A;  3RVY A;  2XRH A;  3CAX A;  4N6H A;  2MWQ A;  3POV A;  1C17 M;  2HW5 A;  5B1A C;  2NUT A;  3JYH A;  3RVZ A;  3EFO A;  2RD9 A;  2XL8 A;  4JTC B;  3DZA A;  4I1M A;  4CIP A;  5F5F A;  3VM6 A;  3GM1 A;  3B0V C;  3BEH A;  3Q6M A;  4MVZ A;  1BR4 A;  3DJU B;  3JT1 A;  5BUO A;  3V5X A;  2J9U A;  3RYL A;  4PR9 A;  2PX3 A;  1QSP A;  3IRB A;  4EIY A;  1J8M F;  5AGF A;  2Y3H A;  3ASN C;  3LS0 A;  3L8I A;  2J9B A;  3NYJ A;  4XPX A;  3F46 A;  3UNG C;  2WVN A;  1K40 A;  4Z9H A;  3TUL A;  4GEH A;  3FOO A;  3ZQY A;  2A68 F;  2H7V C;  1D1A A;  2G3K A;  1M2O A;  4YT8 A;  2HMZ A;  4PFP A;  3A9C A;  2R7W A;  3HTK C;  4DRI B;  5T3T A;  2IXN A;  2YL7 A;  4GYT A;  1QKR A;  1LS1 A;  3Q7L A;  3V7O A;  4ELS A;  2YLD A;  2HJ3 A;  2IOQ A;  3VF0 A;  5L0G A;  3HNL A;  3QXZ A;  2XM0 A;  3WOD F;  3NDB B;  2DYS C;  2AU5 A;  4MND A;  3SEO A;  4Z9I A;  4O6Y A;  3C8G B;  5KYX A;  1JRA A;  1PD1 A;  3SWX A;  3MX3 A;  4PAC A;  2R03 A;  1TFK B;  4NQF A;  3G4X A;  4CIH A;  3EZI A;  3K1I A;  5AC4 A;  3VRC A;  3TOL A;  1Z3I X;  1I4Z A;  3SXZ A;  2R7R A;  3PMR A;  4OIP F;  4ZLD A;  4BJ5 C;  4O7G A;  4E0H A;  2J46 A;  3O55 A;  4PJJ A;  2OOC A;  1HE1 A;  4XTK A;  2G3V A;  4K7B A;  4BEJ A;  3LEO A;  3Q1T A;  1U89 A;  3U8P A;  4Q7C A;  3G4Z A;  5COG A;  1UX5 A;  3Q7G A;  1YA7 O;  1WAT A;  1YYJ A;  3DWW A;  1Z7Q c;  4KNW A;  3QMK A;  4E18 A;  1YA9 A;  1WAS A;  3PZK A;  1Y4C A;  1U6H A;  1WGW A;  4E7S A;  4JZA A;  3PCV A;  4CS8 C;  2JPU A;  2BC5 A;  4YL3 A;  4JOT A;  3T8A A;  5L0F A;  1BZ4 A;  2L6H A;  3ABL C;  4HFF B;  2LSE A;  3UMI A; 
#chains in the Genus database with same CATH homology
 3S9O A;  1K05 A;  3B71 A;  1WOL A;  4EBK A;  3RQE A;  3ADD A;  3AM1 A;  1Y64 B;  1JOG A;  3RQG A;  4NNQ A;  3A4N A;  4NQF A;  1V4A A;  1OW8 A;  3O10 A;  3JZ0 A;  3IRB A;  1WTY A;  3U0C A;  2JX0 A;  3GM2 A;  1PV3 A;  3O4X E;  2YWA A;  4EBJ A;  3L8I A;  2LK4 A;  4XEF A;  3C8G D;  3BRJ A;  1QVX A;  1UX4 A;  3A4L A;  1K40 A;  3TUL A;  4XEV A;  3ADB A;  5F28 E;  4XEK A;  1RJM A;  3W8I B;  2L6G A;  1UX5 A;  1ZZP A;  3C8G A;  3MFN A;  3RQF A;  1OW7 A;  2Q00 A;  1O3U A;  4R32 A;  3U3F A;  3K7D A;  1WWP A;  1K04 A;  3W8H B;  2KK1 A;  3GM3 A;  2HSB A;  1KNY A;  3A4M A;  3C18 A;  2PBE A;  1KTM A;  3L8J A;  2JPU A;  2L6F A;  1OW6 A;  1UFB A;  4GEH B;  3ADC A;  3AJM A;  3GM1 A;  2L6H A;  3JYY A;  2P63 A;  3C8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...