3RQFA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
197
structure length
197
Chain Sequence
SMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 74
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqfA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqfA02
3L8IA 3S9OA 2PBEA 3L8JA 4XEFA 2L6FA 3JYYA 1OW7A 4GEHB 1QVXA 1OW8A 1WOLA 2HSBA 3U0CA 3RQEA 1K40A 4XEVA 4EBKA 1KNYA 5F28E 2L6HA 3W8IB 1JOGA 1K04A 2JPUA 3C8GA 3B71A 3TULA 1WTYA 3BRJA 2YWAA 3C8GD 1PV3A 3C18A 3C8GB 3O10A 4R32A 3K7DA 1UFBA 3GM1A 4XEKA 1WWPA 3RQGA 1V4AA 3JZ0A 3AJMA 3U3FA 3MFNA 3GM3A 4EBJA 1KTMA 1OW6A 4NQFA 1O3UA 1K05A 2JX0A 1ZZPA 2L6GA 2LK4A 3W8HB 3RQFA 2KK1A 3GM2A 2Q00A
chains in the Genus database with same CATH superfamily
1OCRC 1ST6A 2KYHA 4BJ6A 4CS9C 2KJGA 3A9CA 3SEOA 2GDCA 3CAXA 3UMHA 3VYWA 3U2LA 5EHHA 2R7QA 4MVRA 3IQ6A 5A69A 3RQEA 4G7ZF 4G78A 3JTLO 4RD9A 5JBWA 4IARA 3ZSUA 4YWQA 3P5MA 3DE8A 3HNIA 2EPOA 3JSZA 4U5FE 4RBNA 3DAFA 3S0XA 4I52A 1LI5A 3T89A 1QSPA 3ABMC 4MW8A 2Q7RA 1O5HA 4E0IA 5EK0A 5BUOA 2R7RA 1BR1A 2IOQA 1F1MA 5KYXA 3EZHA 1PD1A 3PZKA 3UGOA 2FFHA 2WZLA 5BQGA 4C7OB 2EPLX 1E2XA 1HZDA 1QKRA 4HE8D 1Z7Qc 3FMSA 4LLCA 1NSGB 3QVZA 1YARO 4JTDB 4CDVA 4A2NB 2J9UA 3E9VA 1G5ZA 4JCHA 3DJUB 4BJ1A 3L8IA 4OLQA 5AC5A 2I8BA 3C7JA 3LNRA 2R7XA 2LP4A 4DRJB 2L6FA 1NLXA 1NZEA 1VLSA 4L6RA 3ZIBA 2UZFA 2PX3A 4MVMA 5FCLA 5HSWA 1D1CA 2ICWG 4YT8A 1LKXA 1M2OA 1Y6DA 2QE9A 3B0PA 4N06A 3U5SA 4B6IA 3T88A 1H9GA 2P7VA 2YL7A 4BJTA 1MMNA 2OOCA 3TLFA 2WVNA 1OCCC 5JVEA 4W8PA 2XXAB 2RSEB 1E83A 4ZLCA 1TFKB 5GPGB 1SZIA 4XLPF 2VX2A 1V55C 3JZ0A 4OINF 4C3EA 5L0HA 1SMYF 2A69F 3GM3A 1LVKA 2C03A 2ASRA 2Q9BA 1T6UA 2DUBA 3I47A 1DOWA 1PD0A 2CDQA 3K1HA 4XPXA 5JLIA 1YJGA 3U9JA 4QDLA 1NFNA 2QQ3A 3RQFA 2OKUA 4IAQA 2KK1A 4JZAA 3WODF 4IRUA 2KW3C 4U9DA 5DQTA 1XWJA 4ANJA 4E17A 3UNGC 3EQLF 1XZPA 1ORSC 3UR3C 1OCZC 4IZCA 3IRBA 1K40A 5DVWA 1DOVA 2WZFA 4H54A 4U5EE 1I4YA 3Q1TA 4ELSA 3QW1A 4P9FA 1MJ3A 1LIHA 4I42A 2KC3A 4OD5A 3DMDA 2YL3A 4JW1A 1YLMA 2EIMC 4BJ6C 4CS9A 5L0GA 5T3TA 3QK8A 2CCYA 3C8GB 1LS1A 5L0JA 5L3QA 1D0XA 1FMVA 1UFBA 3FAPB 3GM1A 2FBMA 5JT4A 2CNWD 2Y3DA 4PJMA 3DKAA 1FAPB 4WABA 4WJ0A 1NZYA 1LI7A 2A1DD 1TQGA 2R25A 2RD9A 3ZVRA 1BDJB 2R02A 5CI9A 1DCIA 2LCHA 4MVZA 2G62A 1D1AA 3QTHA 4MNDA 3US6A 5DS5A 3GWNA 1WGWA 2R05A 2IXOA 3GEEA 4CDAA 1Z6AA 1Q0KA 3J06A 4Q4ZF 5A6AA 3EFOB 3HJCA 5CI8A 4JYLA 3W2VA 2WB7A 2LQGA 3E70C 3G50A 4MQ9F 5AC4A 1FNTc 4LERA 2C04A 4PACA 2OCCC 2YL1A 3SYNA 2XS1A 4LACB 4DVYP 1EKYA 4NTBA 2FGYA 2X51A 3ZTZA 1OKKA 1FFTC 1T5OA 3LLKA 3T6GB 1RKEB 3KYJA 3EFOA 3QMKA 1RKEA 2L7AA 4KBLA 4YK5A 3RF3A 4CDYA 2HUJA 1D0ZA 3U3BA 5BQIA 3ZWIA 4U5HA 5JSLA 2HSQA 2J9WA 3KQFA 2Y3BA 4U19A 3AJMA 1Q0FA 5D92A 1E86A 4CIHA 4DRIB 5B3IA 1WASA 3MOYA 1TWCA 1NU9C 2AVKA 3EJNA 4IZBA 1KU2A 2HFIA 1JAFA 3GANA 3H81A 1JPJA 1K05A 4WGZA 3OWTA 2XM4A 4XTKA 3W8HB 1HMDA 2XLWA 3EGDA 3SNHA 4DJ9A 4N6HA 4IGGA 1MMAA 1ZHYA 1Q0MA 1ZHZA 4DOZA 3H02A 2FAPB 5JRAA 2IM8A 2H7VC 1WZ8A 2HSBA 1ORYA 1QVXA 1NZYB 4NCQA 5L0CA 1RJ9A 4XEVA 2EIJC 3T8AA 5F5FA 1U6HA 3GEHA 3KL4A 3HKKA 4YL3A 3V7OA 2BE5F 2J9BA 3FOOA 3GEIA 3ITFA 2DYRC 2EINC 3C8GA 2KGOA 3DM5A 4XPYA 4CS7A 2YWAA 3LEOA 5A6BA 2MYSA 3K6BA 4D4NA 3WHNA 4CS8C 5A6BD 3POVA 2R7UA 5FZTA 2BL2A 4NTAA 4U5CE 5B1AC 3JRMO 3MYIA 3NMKA 4DVZA 2BC5A 2CGEA 4U5BE 1UX4A 3JRTA 1OR2A 3O55A 3ABKC 3U2MA 4E0HA 5DS6A 1A7VA 2L6GA 2W45A 4W8KA 3PHF2 3K66A 4E7ZA 3L1MA 1VOMA 2IEXA 4WCZA 5TJ5E 4YT4A 4UDVA 2ZXPA 4HFKB 2VCAA 2R7WA 4OIPF 2AWCA 1CPQA 2J7PD 3B0VC 2XM0A 3ASOC 2Q9CA 1AVOB 1T01A 1QZXA 1MMGA 2V26A 1W2WA 2W9YA 5DLJA 2PP4A 2IXPA 4BEJA 2OEVA 5KYWB 5DS4A 1HW2A 1Q51A 3EZIA 4CSAC 1A7DA 1WTYA 2LD6A 1YYXA 4K7BA 4EUKB 1Q0DA 4P6IC 1PV3A 1YA9A 2ZQRA 5EGYA 3UGPA 4PJLA 4D4XA 2EJ5A 4JWVA 3GORA 4U5GA 4X0RA 2W4BA 2ZXOA 3EPVA 2MWQA 2QLAA 3O6XA 2IBFA 1TKNA 2JX0A 4KNWA 4JOTA 4A4AA 4CX9A 4YN0B 3L0IA 4QIIA 2A6EF 2M64A 3FHDA 4FWVA 2HMZA 2PBEA 3EH2A 1EF8A 1FMWA 3NYMA 3GODA 3QXIA 3ZC4A 1HMOA 2H8AA 4CJGA 3TJ6A 4BEMJ 2D4UA 1AEPA 2A0BA 5E3AA 4JEAA 3C8GD 3G4XA 3QW0A 4MVQA 2UUIA 4NTFA 3LS1A 2W4MA 3M15A 2IXMA 3TRRA 2VB6A 1WWPA 3H2VA 4I1MA 3C62A 4XWJA 2DGJA 3H65A 5F5HA 1RJ9B 3AOUA 3S90A 3HRXA 5JUAA 3RW0A 1PCXA 3R9TA 2NSFA 3W4YA 2KSFA 3I5PA 1M2VA 3FVYA 4Q7CA 4FZWC 2J8WA 3HNKA 4O79A 5E3CA 5A6JA 2R7SA 4F47A 2GA0A 1OXKA 4LLEA 2ZD9A 2Y3GA 2Z15A 4OIRF 1OQCA 2Y69C 2GAQA 4HEAJ 3HNJA 1Z63A 3RH3A 1M57C 1OW8A 1SR2A 3T4RA 1VTMP 1S05A 5JBXA 1EI7A 1LE2A 1BBHA 1T6IA 2OEXA 2YHSA 3OEOA 3TK0A 3PDMP 3VAYA 4JCSA 4G7OF 2F6QA 4I44A 5T3WA 4Z9IA 3ZTMA 2YLDA 3IPMO 1TFOB 1BR4A 3Q6MA 1FFHA 2E87A 1CGOA 3O10A 3ATPA 4R32A 2CW0F 2XL4A 3NKEA 4Z9JA 3QZCA 4NNQA 1LPEA 1J8MF 2WZGA 1G8XA 1ZHXA 4AL1A 4YL0A 2LFFA 3CSKA 1E85A 2WVOA 3S28A 1ZW2A 2A6HF 3Q0JA 2KQ9A 2EILC 3U8PA 3OC7A 1VK5A 3DXJF 4GYTA 1JMWA 3DZAA 4XEFA 1YA7O 2XL8A 3LESA 2R03A 1Y4CA 1A7EA 1G4US 5T1DB 1EQ1A 2AWYA 256BA 4PJJA 1I4ZA 1YZCA 2NUPB 3I5QA 4NY3A 2L6HA 3HLZA 1VLTA 3A4LA 1M56C 2EPKX 4MS2A 3WG7C 3B71A 3IQTA 3TD7A 3AG4C 3KPHA 3A11A 3VRCA 1L7CA 4JURI 3JYHA 4I1OB 3IHUA 4QI2A 4IJJA 4LDKA 4ZU2A 2HW5A 3V5YA 3ZDLA 1I5NA 2VH3A 2G3VA 3KH2A 4JC7A 4EMLA 5JS5A 4N6CA 3S29A 2HZ8A 2OQMA 3BEHA 1R5ID 1OCOC 1C03A 2Y3HA 4O6YA 2KNHA 2L9JA 4JFCA 1M6TA 2NG1A 4K2NA 3I4UA 4IAOA 4CSAA 5KYWA 3S84A 1OXBA 2AP3A 2LIGA 3IQCA 4MW3A 3SXZA 3F46A 4G7HF 4U9EA 1JXZA 4O6MA 3NYLA 3W8IB 2CYDA 5JP7A 4MOUA 4NEKA 3V5ZA 2J0WA 4G0HA 3EH1A 3EHNA 3RSIA 3JT1A 3WAQA 3W8IA 2R7OA 3DE9A 3SP1A 1HE9A 3DAGA 3SWXA 3U8VA 1H7IA 2HMQA 2PNOA 1U89A 1NG1A 4GQHA 4K3WA 2XLDA 4FESA 4AK9A 2A68F 1JPNA 1O3UA 3N24A 3VF0A 1TWHA 4U5DE 3Q7LA 5KYXB 4WGYA 5COMA 1LS4A 3S27A 1B68A 1D0YA 2XL6A 3S9OA 5L0IA 1R4TA 2M4EA 2O9XA 2XLHA 1MMDA 3QXZA 1CGNA 1OW7A 2HJ3A 2HV7A 2PBPA 1AUEA 1EY3A 1ZHWA 2EPMX 5KYNA 4AE4A 4C7OA 2LSEA 1Y64B 1Z5ZA 2J46A 2XLOA 3DD7A 5F28E 2DB4A 3EHMA 3DJNB 3NKDA 4OIOF 3A4NA 2J7PA 3V5XA 1YYJA 3RVZA 3M1CB 3Q6NA 3CQZA 2NUTB 1UX5A 2PX0A 3EG9B 2XLVA 4MI2A 2OJED 5KYYA 1NBBA 1DUBA 2H7OA 4QIJA 2VCCA 3LNMB 4J32B 4MTOA 3RQGA 4O7GA 3W8HA 3AGUA 2Q4FA 1VYIA 1NU7D 3MFNA 2L81A 4JEBA 4QI0A 5KYUA 5HV9A 1Q0GA 4M63A 3TOMA 3LAYA 2XS8A 3K1IC 1GQAA 3PCVA 4KC9A 3DM9B 4CBEA 2MHRA 3OA1A 5AGFA 1TWGA 3Q0GA 3CEXA 3LJBA 3H2UA 4DBRA 3G64A 3U9MA 1IW7F 2XSEA 3L8JA 3SXYA 5IY5C 2IXNA 2Y39A 4MVUA 2UUHA 1G4WR 1Z3IX 1H6GA 2YRFA 2YQYA 3NRHA 1E84A 2R7VA 2X0CA 5KJPA 4EBKA 3LUTB 4J30B 1TR2A 1T6QA 1MNDA 1N1CA 3ADCA 1K04A 3B9QA 2H7BA 4CJOA 1BZ4A 3R7CA 5E2QA 1EA8A 3TULA 3K33A 4XPWA 4ULVA 4YJWA 3X1OA 3C18A 2P63A 1EF9A 1LM3B 3GWLA 1YVIA 3K7DA 2QY9A 2ZXRA 3MYFA 4H4KC 2TMVP 3DI5A 3O39A 4YL1A 3T6BA 3T6JA 5KYYB 4DXWA 1SF8A 3AQBA 4NQFA 1A41A 5KYUB 4I3MA 2D5RB 3SXKA 2FW2A 1ZHTA 4MTFA 2VC9A 3SZRA 4ER9A 2OJQA 3C63A 3C8ZA 2PFDA 4ELXA 1M2VB 2F22A 3EG9A 3N2ZB 2HJMA 4E18A 2YZSA 1RJMA 3N0TA 3K1IA 4OD4A 5DQZA 4DRHB 1Z23A 1WOLA 3MYBA 3SLLA 4BG0A 1APCA 3AQCA 3ADDA 4XLNF 5L0FA 4MVOA 4AE4B 4C3BA 5B1BC 5L3VA 3FDQA 2JPUA 2P6VA 1QQ3A 3NYJA 3ZQVA 4AX2A 4MVSA 1TWAA 2NUTA 1UIYA 3LEVA 3JCUQ 3FDUA 2J45A 4K0DA 4YT2A 4PFOA 3KKBA 3TJ5A 1NFOA 1MNEA 1O87A 1ZVZA 3AG3C 3EGXA 3KYIA 1S7ZA 4E7SA 1H9TA 2JD3A 1V54C 4KNPA 2A0UA 2AU5A 3HNLA 3FOPA 4JCZA 4FAPB 4CIPA 2LFDA 2LK4A 4BPMA 4EKWA 4DBQA 4KI2A 2EIKC 3VM6A 2Q00A 3SXMA 1HE1A 1HY5A 1UG7A 1VYKA 1YDIA 3MBGA 4FZWA 2VCBA 2HS5A 3NG1A 2YEVA 4LDQA 1VMAA 4JRZA 4JJGA 2WL8A 2ZPAA 4BJ5A 2Q3TA 5B3SC 3T9OA 3FAJA 4JTAB 3U0CA 4Z9HA 3NDBB 2R7TA 4BJ5C 1GM5A 3B0UX 5L0DA 4N4WA 3HINA 3L34A 5COGA 3TQOA 3BRJA 5K0IA 2J9VA 1WATA 3AGTA 1QLEC 3R9SA 4U18A 2G3KA 4JTCB 3G4ZA 4K1OA 4YT5A 1D1BA 4ONSA 2YKZA 4EBJA 3ABLC 1OW6A 4I4ZA 2YLIA 4JJFA 3NMJA 1BR2A 2PF4E 4JVSA 3RKOF 1ZZPA 4Q5SF 3ASNC 2V3CC 3IEEA 2QTVA 4JKVA 4AL0A 4KNVA 3GM2A 4JE9A 4J7YA 4EHPA 1Q52A 1CPRA 1RXQA 2QUPA 4F4BA 2Q9AA 1RJNA 2HKVA 2DYSC 2R9RB 3CZ6A 3M4CA 4FX5A 4O6NA 5D91A 5E33A 1XZQA 3W2WA 1FR0A 1QPUA 4PFPA 3EGXB 4OG1A 2NUPA 2OG2A 2NSGA 1RCPA 2P61A 1KNYA 3NMIA 2ETSA 4MTGA 4PR9A 4IB4A 3DWWA 1T9KA 4RDAA 1ZU5A 2NPUA 3RVYA 1V74B 2OU6A 1OR3A 4XQ1A 4CS8A 2IYLD 3PMRA 1IZMA 1U0BB 4ZLDA 2XLEA 3R2PA 2HV6A 1MQVA 2J0XA 2YVKA 3F47A 3IQ5A 3EGDB 4HFFB 5A6KA 1V4AA 4IZDA 3U3FA 2PPYA 2GWWA 2CNWA 1VB5A 1J8YF 4U1AA 1ZYRF 2GFHA 4P9TA 1C17M 2B0HA 1RKCA 4IWBA 3HTKC 3RYLA 1SYQA 2YL0A 2P0NA 3AG1C 3UMIA 1GGQA 4ULWA 1A0BA 3LLIA 4OIQF 2DI3A 3ADBA 3JYYA 2XXAA 4GEHB 3B29A 3KMIA 4PJNA 1FTSA 2ZQQA 1LE4A 2EPNA 3O4XE 2WVQA 4EBBA 1JRAA 2XRHA 1CGME 2XLMA 2ZXWC 2I15A 1JOGA 1WN0A 3RFYA 3AG2C 2B0JA 1ORJA 1YAUO 2VREA 3M4BA 3A4MA 2QNLA 3RIPA 3ZQYA 3TOLA 4EWCA 1C02A 1OKKD 3UMKA 1YZAA 3AM1A 3QVYA 3Q7GA 3MLGA 5COFA 4XEKA 2GTRA 3R0OA 4JIOA 5BQHA 4ELWA 1RMVA 4J7TA 3X2QC 1ZU4A 4LDRA 1KTMA 1HW1A 4NC3A 4GEHA 3JSEO 3ZG1A 3MX3A 1GS9A 5C9GA 2YLGA 4C3DA 1L3PA 4EIYA 5CIVA 3ECSA 2VASA 3M79A 4PK4A 1JR8A 3LS0A 4FJWD 1ZW3A 2P1AA 3FXHA
chains in the Genus database with same CATH topology
3L8IA 3S9OA 2PBEA 3L8JA 4XEFA 1RJMA 2L6FA 3ADBA 3JYYA 1OW7A 4GEHB 1QVXA 1OW8A 1WOLA 2HSBA 3U0CA 3IRBA 3RQEA 1K40A 4XEVA 3O4XE 1Y64B 3ADDA 4EBKA 1KNYA 5F28E 2L6HA 3W8IB 1JOGA 3A4LA 3ADCA 1K04A 2JPUA 3C8GA 3A4NA 3B71A 3TULA 1WTYA 3A4MA 3BRJA 1UX5A 2YWAA 3C8GD 3AM1A 1PV3A 3C18A 3C8GB 2P63A 3K7DA 1UFBA 3GM1A 3O10A 4R32A 4XEKA 1WWPA 3RQGA 1V4AA 3JZ0A 3AJMA 4NNQA 3MFNA 3GM3A 3U3FA 4EBJA 1KTMA 1UX4A 1OW6A 4NQFA 1O3UA 1K05A 2JX0A 1ZZPA 2L6GA 2LK4A 3W8HB 3RQFA 2KK1A 3GM2A 2Q00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8I A;  3S9O A;  2PBE A;  3L8J A;  4XEF A;  2L6F A;  3JYY A;  1OW7 A;  4GEH B;  1QVX A;  1OW8 A;  1WOL A;  2HSB A;  3U0C A;  3RQE A;  1K40 A;  4XEV A;  4EBK A;  1KNY A;  5F28 E;  2L6H A;  3W8I B;  1JOG A;  1K04 A;  2JPU A;  3C8G A;  3B71 A;  3TUL A;  1WTY A;  3BRJ A;  2YWA A;  3C8G D;  1PV3 A;  3C18 A;  3C8G B;  3O10 A;  4R32 A;  3K7D A;  1UFB A;  3GM1 A;  4XEK A;  1WWP A;  3RQG A;  1V4A A;  3JZ0 A;  3AJM A;  3U3F A;  3MFN A;  3GM3 A;  4EBJ A;  1KTM A;  1OW6 A;  4NQF A;  1O3U A;  1K05 A;  2JX0 A;  1ZZP A;  2L6G A;  2LK4 A;  3W8H B;  3RQF A;  2KK1 A;  3GM2 A;  2Q00 A; 
#chains in the Genus database with same CATH topology
 1OCR C;  1ST6 A;  2KYH A;  4BJ6 A;  4CS9 C;  2KJG A;  3A9C A;  3SEO A;  2GDC A;  3CAX A;  3UMH A;  3VYW A;  3U2L A;  5EHH A;  2R7Q A;  4MVR A;  3IQ6 A;  5A69 A;  3RQE A;  4G7Z F;  4G78 A;  3JTL O;  4RD9 A;  5JBW A;  4IAR A;  3ZSU A;  4YWQ A;  3P5M A;  3DE8 A;  3HNI A;  2EPO A;  3JSZ A;  4U5F E;  4RBN A;  3DAF A;  3S0X A;  4I52 A;  1LI5 A;  3T89 A;  1QSP A;  3ABM C;  4MW8 A;  2Q7R A;  1O5H A;  4E0I A;  5EK0 A;  5BUO A;  2R7R A;  1BR1 A;  2IOQ A;  1F1M A;  5KYX A;  3EZH A;  1PD1 A;  3PZK A;  3UGO A;  2FFH A;  2WZL A;  5BQG A;  4C7O B;  2EPL X;  1E2X A;  1HZD A;  1QKR A;  4HE8 D;  1Z7Q c;  3FMS A;  4LLC A;  1NSG B;  3QVZ A;  1YAR O;  4JTD B;  4CDV A;  4A2N B;  2J9U A;  3E9V A;  1G5Z A;  4JCH A;  3DJU B;  4BJ1 A;  3L8I A;  4OLQ A;  5AC5 A;  2I8B A;  3C7J A;  3LNR A;  2R7X A;  2LP4 A;  4DRJ B;  2L6F A;  1NLX A;  1NZE A;  1VLS A;  4L6R A;  3ZIB A;  2UZF A;  2PX3 A;  4MVM A;  5FCL A;  5HSW A;  1D1C A;  2ICW G;  4YT8 A;  1LKX A;  1M2O A;  1Y6D A;  2QE9 A;  3B0P A;  4N06 A;  3U5S A;  4B6I A;  3T88 A;  1H9G A;  2P7V A;  2YL7 A;  4BJT A;  1MMN A;  2OOC A;  3TLF A;  2WVN A;  1OCC C;  5JVE A;  4W8P A;  2XXA B;  2RSE B;  1E83 A;  4ZLC A;  1TFK B;  5GPG B;  1SZI A;  4XLP F;  2VX2 A;  1V55 C;  3JZ0 A;  4OIN F;  4C3E A;  5L0H A;  1SMY F;  2A69 F;  3GM3 A;  1LVK A;  2C03 A;  2ASR A;  2Q9B A;  1T6U A;  2DUB A;  3I47 A;  1DOW A;  1PD0 A;  2CDQ A;  3K1H A;  4XPX A;  5JLI A;  1YJG A;  3U9J A;  4QDL A;  1NFN A;  2QQ3 A;  3RQF A;  2OKU A;  4IAQ A;  2KK1 A;  4JZA A;  3WOD F;  4IRU A;  2KW3 C;  4U9D A;  5DQT A;  1XWJ A;  4ANJ A;  4E17 A;  3UNG C;  3EQL F;  1XZP A;  1ORS C;  3UR3 C;  1OCZ C;  4IZC A;  3IRB A;  1K40 A;  5DVW A;  1DOV A;  2WZF A;  4H54 A;  4U5E E;  1I4Y A;  3Q1T A;  4ELS A;  3QW1 A;  4P9F A;  1MJ3 A;  1LIH A;  4I42 A;  2KC3 A;  4OD5 A;  3DMD A;  2YL3 A;  4JW1 A;  1YLM A;  2EIM C;  4BJ6 C;  4CS9 A;  5L0G A;  5T3T A;  3QK8 A;  2CCY A;  3C8G B;  1LS1 A;  5L0J A;  5L3Q A;  1D0X A;  1FMV A;  1UFB A;  3FAP B;  3GM1 A;  2FBM A;  5JT4 A;  2CNW D;  2Y3D A;  4PJM A;  3DKA A;  1FAP B;  4WAB A;  4WJ0 A;  1NZY A;  1LI7 A;  2A1D D;  1TQG A;  2R25 A;  2RD9 A;  3ZVR A;  1BDJ B;  2R02 A;  5CI9 A;  1DCI A;  2LCH A;  4MVZ A;  2G62 A;  1D1A A;  3QTH A;  4MND A;  3US6 A;  5DS5 A;  3GWN A;  1WGW A;  2R05 A;  2IXO A;  3GEE A;  4CDA A;  1Z6A A;  1Q0K A;  3J06 A;  4Q4Z F;  5A6A A;  3EFO B;  3HJC A;  5CI8 A;  4JYL A;  3W2V A;  2WB7 A;  2LQG A;  3E70 C;  3G50 A;  4MQ9 F;  5AC4 A;  1FNT c;  4LER A;  2C04 A;  4PAC A;  2OCC C;  2YL1 A;  3SYN A;  2XS1 A;  4LAC B;  4DVY P;  1EKY A;  4NTB A;  2FGY A;  2X51 A;  3ZTZ A;  1OKK A;  1FFT C;  1T5O A;  3LLK A;  3T6G B;  1RKE B;  3KYJ A;  3EFO A;  3QMK A;  1RKE A;  2L7A A;  4KBL A;  4YK5 A;  3RF3 A;  4CDY A;  2HUJ A;  1D0Z A;  3U3B A;  5BQI A;  3ZWI A;  4U5H A;  5JSL A;  2HSQ A;  2J9W A;  3KQF A;  2Y3B A;  4U19 A;  3AJM A;  1Q0F A;  5D92 A;  1E86 A;  4CIH A;  4DRI B;  5B3I A;  1WAS A;  3MOY A;  1TWC A;  1NU9 C;  2AVK A;  3EJN A;  4IZB A;  1KU2 A;  2HFI A;  1JAF A;  3GAN A;  3H81 A;  1JPJ A;  1K05 A;  4WGZ A;  3OWT A;  2XM4 A;  4XTK A;  3W8H B;  1HMD A;  2XLW A;  3EGD A;  3SNH A;  4DJ9 A;  4N6H A;  4IGG A;  1MMA A;  1ZHY A;  1Q0M A;  1ZHZ A;  4DOZ A;  3H02 A;  2FAP B;  5JRA A;  2IM8 A;  2H7V C;  1WZ8 A;  2HSB A;  1ORY A;  1QVX A;  1NZY B;  4NCQ A;  5L0C A;  1RJ9 A;  4XEV A;  2EIJ C;  3T8A A;  5F5F A;  1U6H A;  3GEH A;  3KL4 A;  3HKK A;  4YL3 A;  3V7O A;  2BE5 F;  2J9B A;  3FOO A;  3GEI A;  3ITF A;  2DYR C;  2EIN C;  3C8G A;  2KGO A;  3DM5 A;  4XPY A;  4CS7 A;  2YWA A;  3LEO A;  5A6B A;  2MYS A;  3K6B A;  4D4N A;  3WHN A;  4CS8 C;  5A6B D;  3POV A;  2R7U A;  5FZT A;  2BL2 A;  4NTA A;  4U5C E;  5B1A C;  3JRM O;  3MYI A;  3NMK A;  4DVZ A;  2BC5 A;  2CGE A;  4U5B E;  1UX4 A;  3JRT A;  1OR2 A;  3O55 A;  3ABK C;  3U2M A;  4E0H A;  5DS6 A;  1A7V A;  2L6G A;  2W45 A;  4W8K A;  3PHF 2;  3K66 A;  4E7Z A;  3L1M A;  1VOM A;  2IEX A;  4WCZ A;  5TJ5 E;  4YT4 A;  4UDV A;  2ZXP A;  4HFK B;  2VCA A;  2R7W A;  4OIP F;  2AWC A;  1CPQ A;  2J7P D;  3B0V C;  2XM0 A;  3ASO C;  2Q9C A;  1AVO B;  1T01 A;  1QZX A;  1MMG A;  2V26 A;  1W2W A;  2W9Y A;  5DLJ A;  2PP4 A;  2IXP A;  4BEJ A;  2OEV A;  5KYW B;  5DS4 A;  1HW2 A;  1Q51 A;  3EZI A;  4CSA C;  1A7D A;  1WTY A;  2LD6 A;  1YYX A;  4K7B A;  4EUK B;  1Q0D A;  4P6I C;  1PV3 A;  1YA9 A;  2ZQR A;  5EGY A;  3UGP A;  4PJL A;  4D4X A;  2EJ5 A;  4JWV A;  3GOR A;  4U5G A;  4X0R A;  2W4B A;  2ZXO A;  3EPV A;  2MWQ A;  2QLA A;  3O6X A;  2IBF A;  1TKN A;  2JX0 A;  4KNW A;  4JOT A;  4A4A A;  4CX9 A;  4YN0 B;  3L0I A;  4QII A;  2A6E F;  2M64 A;  3FHD A;  4FWV A;  2HMZ A;  2PBE A;  3EH2 A;  1EF8 A;  1FMW A;  3NYM A;  3GOD A;  3QXI A;  3ZC4 A;  1HMO A;  2H8A A;  4CJG A;  3TJ6 A;  4BEM J;  2D4U A;  1AEP A;  2A0B A;  5E3A A;  4JEA A;  3C8G D;  3G4X A;  3QW0 A;  4MVQ A;  2UUI A;  4NTF A;  3LS1 A;  2W4M A;  3M15 A;  2IXM A;  3TRR A;  2VB6 A;  1WWP A;  3H2V A;  4I1M A;  3C62 A;  4XWJ A;  2DGJ A;  3H65 A;  5F5H A;  1RJ9 B;  3AOU A;  3S90 A;  3HRX A;  5JUA A;  3RW0 A;  1PCX A;  3R9T A;  2NSF A;  3W4Y A;  2KSF A;  3I5P A;  1M2V A;  3FVY A;  4Q7C A;  4FZW C;  2J8W A;  3HNK A;  4O79 A;  5E3C A;  5A6J A;  2R7S A;  4F47 A;  2GA0 A;  1OXK A;  4LLE A;  2ZD9 A;  2Y3G A;  2Z15 A;  4OIR F;  1OQC A;  2Y69 C;  2GAQ A;  4HEA J;  3HNJ A;  1Z63 A;  3RH3 A;  1M57 C;  1OW8 A;  1SR2 A;  3T4R A;  1VTM P;  1S05 A;  5JBX A;  1EI7 A;  1LE2 A;  1BBH A;  1T6I A;  2OEX A;  2YHS A;  3OEO A;  3TK0 A;  3PDM P;  3VAY A;  4JCS A;  4G7O F;  2F6Q A;  4I44 A;  5T3W A;  4Z9I A;  3ZTM A;  2YLD A;  3IPM O;  1TFO B;  1BR4 A;  3Q6M A;  1FFH A;  2E87 A;  1CGO A;  3O10 A;  3ATP A;  4R32 A;  2CW0 F;  2XL4 A;  3NKE A;  4Z9J A;  3QZC A;  4NNQ A;  1LPE A;  1J8M F;  2WZG A;  1G8X A;  1ZHX A;  4AL1 A;  4YL0 A;  2LFF A;  3CSK A;  1E85 A;  2WVO A;  3S28 A;  1ZW2 A;  2A6H F;  3Q0J A;  2KQ9 A;  2EIL C;  3U8P A;  3OC7 A;  1VK5 A;  3DXJ F;  4GYT A;  1JMW A;  3DZA A;  4XEF A;  1YA7 O;  2XL8 A;  3LES A;  2R03 A;  1Y4C A;  1A7E A;  1G4U S;  5T1D B;  1EQ1 A;  2AWY A;  256B A;  4PJJ A;  1I4Z A;  1YZC A;  2NUP B;  3I5Q A;  4NY3 A;  2L6H A;  3HLZ A;  1VLT A;  3A4L A;  1M56 C;  2EPK X;  4MS2 A;  3WG7 C;  3B71 A;  3IQT A;  3TD7 A;  3AG4 C;  3KPH A;  3A11 A;  3VRC A;  1L7C A;  4JUR I;  3JYH A;  4I1O B;  3IHU A;  4QI2 A;  4IJJ A;  4LDK A;  4ZU2 A;  2HW5 A;  3V5Y A;  3ZDL A;  1I5N A;  2VH3 A;  2G3V A;  3KH2 A;  4JC7 A;  4EML A;  5JS5 A;  4N6C A;  3S29 A;  2HZ8 A;  2OQM A;  3BEH A;  1R5I D;  1OCO C;  1C03 A;  2Y3H A;  4O6Y A;  2KNH A;  2L9J A;  4JFC A;  1M6T A;  2NG1 A;  4K2N A;  3I4U A;  4IAO A;  4CSA A;  5KYW A;  3S84 A;  1OXB A;  2AP3 A;  2LIG A;  3IQC A;  4MW3 A;  3SXZ A;  3F46 A;  4G7H F;  4U9E A;  1JXZ A;  4O6M A;  3NYL A;  3W8I B;  2CYD A;  5JP7 A;  4MOU A;  4NEK A;  3V5Z A;  2J0W A;  4G0H A;  3EH1 A;  3EHN A;  3RSI A;  3JT1 A;  3WAQ A;  3W8I A;  2R7O A;  3DE9 A;  3SP1 A;  1HE9 A;  3DAG A;  3SWX A;  3U8V A;  1H7I A;  2HMQ A;  2PNO A;  1U89 A;  1NG1 A;  4GQH A;  4K3W A;  2XLD A;  4FES A;  4AK9 A;  2A68 F;  1JPN A;  1O3U A;  3N24 A;  3VF0 A;  1TWH A;  4U5D E;  3Q7L A;  5KYX B;  4WGY A;  5COM A;  1LS4 A;  3S27 A;  1B68 A;  1D0Y A;  2XL6 A;  3S9O A;  5L0I A;  1R4T A;  2M4E A;  2O9X A;  2XLH A;  1MMD A;  3QXZ A;  1CGN A;  1OW7 A;  2HJ3 A;  2HV7 A;  2PBP A;  1AUE A;  1EY3 A;  1ZHW A;  2EPM X;  5KYN A;  4AE4 A;  4C7O A;  2LSE A;  1Y64 B;  1Z5Z A;  2J46 A;  2XLO A;  3DD7 A;  5F28 E;  2DB4 A;  3EHM A;  3DJN B;  3NKD A;  4OIO F;  3A4N A;  2J7P A;  3V5X A;  1YYJ A;  3RVZ A;  3M1C B;  3Q6N A;  3CQZ A;  2NUT B;  1UX5 A;  2PX0 A;  3EG9 B;  2XLV A;  4MI2 A;  2OJE D;  5KYY A;  1NBB A;  1DUB A;  2H7O A;  4QIJ A;  2VCC A;  3LNM B;  4J32 B;  4MTO A;  3RQG A;  4O7G A;  3W8H A;  3AGU A;  2Q4F A;  1VYI A;  1NU7 D;  3MFN A;  2L81 A;  4JEB A;  4QI0 A;  5KYU A;  5HV9 A;  1Q0G A;  4M63 A;  3TOM A;  3LAY A;  2XS8 A;  3K1I C;  1GQA A;  3PCV A;  4KC9 A;  3DM9 B;  4CBE A;  2MHR A;  3OA1 A;  5AGF A;  1TWG A;  3Q0G A;  3CEX A;  3LJB A;  3H2U A;  4DBR A;  3G64 A;  3U9M A;  1IW7 F;  2XSE A;  3L8J A;  3SXY A;  5IY5 C;  2IXN A;  2Y39 A;  4MVU A;  2UUH A;  1G4W R;  1Z3I X;  1H6G A;  2YRF A;  2YQY A;  3NRH A;  1E84 A;  2R7V A;  2X0C A;  5KJP A;  4EBK A;  3LUT B;  4J30 B;  1TR2 A;  1T6Q A;  1MND A;  1N1C A;  3ADC A;  1K04 A;  3B9Q A;  2H7B A;  4CJO A;  1BZ4 A;  3R7C A;  5E2Q A;  1EA8 A;  3TUL A;  3K33 A;  4XPW A;  4ULV A;  4YJW A;  3X1O A;  3C18 A;  2P63 A;  1EF9 A;  1LM3 B;  3GWL A;  1YVI A;  3K7D A;  2QY9 A;  2ZXR A;  3MYF A;  4H4K C;  2TMV P;  3DI5 A;  3O39 A;  4YL1 A;  3T6B A;  3T6J A;  5KYY B;  4DXW A;  1SF8 A;  3AQB A;  4NQF A;  1A41 A;  5KYU B;  4I3M A;  2D5R B;  3SXK A;  2FW2 A;  1ZHT A;  4MTF A;  2VC9 A;  3SZR A;  4ER9 A;  2OJQ A;  3C63 A;  3C8Z A;  2PFD A;  4ELX A;  1M2V B;  2F22 A;  3EG9 A;  3N2Z B;  2HJM A;  4E18 A;  2YZS A;  1RJM A;  3N0T A;  3K1I A;  4OD4 A;  5DQZ A;  4DRH B;  1Z23 A;  1WOL A;  3MYB A;  3SLL A;  4BG0 A;  1APC A;  3AQC A;  3ADD A;  4XLN F;  5L0F A;  4MVO A;  4AE4 B;  4C3B A;  5B1B C;  5L3V A;  3FDQ A;  2JPU A;  2P6V A;  1QQ3 A;  3NYJ A;  3ZQV A;  4AX2 A;  4MVS A;  1TWA A;  2NUT A;  1UIY A;  3LEV A;  3JCU Q;  3FDU A;  2J45 A;  4K0D A;  4YT2 A;  4PFO A;  3KKB A;  3TJ5 A;  1NFO A;  1MNE A;  1O87 A;  1ZVZ A;  3AG3 C;  3EGX A;  3KYI A;  1S7Z A;  4E7S A;  1H9T A;  2JD3 A;  1V54 C;  4KNP A;  2A0U A;  2AU5 A;  3HNL A;  3FOP A;  4JCZ A;  4FAP B;  4CIP A;  2LFD A;  2LK4 A;  4BPM A;  4EKW A;  4DBQ A;  4KI2 A;  2EIK C;  3VM6 A;  2Q00 A;  3SXM A;  1HE1 A;  1HY5 A;  1UG7 A;  1VYK A;  1YDI A;  3MBG A;  4FZW A;  2VCB A;  2HS5 A;  3NG1 A;  2YEV A;  4LDQ A;  1VMA A;  4JRZ A;  4JJG A;  2WL8 A;  2ZPA A;  4BJ5 A;  2Q3T A;  5B3S C;  3T9O A;  3FAJ A;  4JTA B;  3U0C A;  4Z9H A;  3NDB B;  2R7T A;  4BJ5 C;  1GM5 A;  3B0U X;  5L0D A;  4N4W A;  3HIN A;  3L34 A;  5COG A;  3TQO A;  3BRJ A;  5K0I A;  2J9V A;  1WAT A;  3AGT A;  1QLE C;  3R9S A;  4U18 A;  2G3K A;  4JTC B;  3G4Z A;  4K1O A;  4YT5 A;  1D1B A;  4ONS A;  2YKZ A;  4EBJ A;  3ABL C;  1OW6 A;  4I4Z A;  2YLI A;  4JJF A;  3NMJ A;  1BR2 A;  2PF4 E;  4JVS A;  3RKO F;  1ZZP A;  4Q5S F;  3ASN C;  2V3C C;  3IEE A;  2QTV A;  4JKV A;  4AL0 A;  4KNV A;  3GM2 A;  4JE9 A;  4J7Y A;  4EHP A;  1Q52 A;  1CPR A;  1RXQ A;  2QUP A;  4F4B A;  2Q9A A;  1RJN A;  2HKV A;  2DYS C;  2R9R B;  3CZ6 A;  3M4C A;  4FX5 A;  4O6N A;  5D91 A;  5E33 A;  1XZQ A;  3W2W A;  1FR0 A;  1QPU A;  4PFP A;  3EGX B;  4OG1 A;  2NUP A;  2OG2 A;  2NSG A;  1RCP A;  2P61 A;  1KNY A;  3NMI A;  2ETS A;  4MTG A;  4PR9 A;  4IB4 A;  3DWW A;  1T9K A;  4RDA A;  1ZU5 A;  2NPU A;  3RVY A;  1V74 B;  2OU6 A;  1OR3 A;  4XQ1 A;  4CS8 A;  2IYL D;  3PMR A;  1IZM A;  1U0B B;  4ZLD A;  2XLE A;  3R2P A;  2HV6 A;  1MQV A;  2J0X A;  2YVK A;  3F47 A;  3IQ5 A;  3EGD B;  4HFF B;  5A6K A;  1V4A A;  4IZD A;  3U3F A;  2PPY A;  2GWW A;  2CNW A;  1VB5 A;  1J8Y F;  4U1A A;  1ZYR F;  2GFH A;  4P9T A;  1C17 M;  2B0H A;  1RKC A;  4IWB A;  3HTK C;  3RYL A;  1SYQ A;  2YL0 A;  2P0N A;  3AG1 C;  3UMI A;  1GGQ A;  4ULW A;  1A0B A;  3LLI A;  4OIQ F;  2DI3 A;  3ADB A;  3JYY A;  2XXA A;  4GEH B;  3B29 A;  3KMI A;  4PJN A;  1FTS A;  2ZQQ A;  1LE4 A;  2EPN A;  3O4X E;  2WVQ A;  4EBB A;  1JRA A;  2XRH A;  1CGM E;  2XLM A;  2ZXW C;  2I15 A;  1JOG A;  1WN0 A;  3RFY A;  3AG2 C;  2B0J A;  1ORJ A;  1YAU O;  2VRE A;  3M4B A;  3A4M A;  2QNL A;  3RIP A;  3ZQY A;  3TOL A;  4EWC A;  1C02 A;  1OKK D;  3UMK A;  1YZA A;  3AM1 A;  3QVY A;  3Q7G A;  3MLG A;  5COF A;  4XEK A;  2GTR A;  3R0O A;  4JIO A;  5BQH A;  4ELW A;  1RMV A;  4J7T A;  3X2Q C;  1ZU4 A;  4LDR A;  1KTM A;  1HW1 A;  4NC3 A;  4GEH A;  3JSE O;  3ZG1 A;  3MX3 A;  1GS9 A;  5C9G A;  2YLG A;  4C3D A;  1L3P A;  4EIY A;  5CIV A;  3ECS A;  2VAS A;  3M79 A;  4PK4 A;  1JR8 A;  3LS0 A;  4FJW D;  1ZW3 A;  2P1A A;  3FXH A; 
#chains in the Genus database with same CATH homology
 3L8I A;  3S9O A;  2PBE A;  3L8J A;  4XEF A;  1RJM A;  2L6F A;  3ADB A;  3JYY A;  1OW7 A;  4GEH B;  1QVX A;  1OW8 A;  1WOL A;  2HSB A;  3U0C A;  3IRB A;  3RQE A;  1K40 A;  4XEV A;  3O4X E;  1Y64 B;  3ADD A;  4EBK A;  1KNY A;  5F28 E;  2L6H A;  3W8I B;  1JOG A;  3A4L A;  3ADC A;  1K04 A;  2JPU A;  3C8G A;  3A4N A;  3B71 A;  3TUL A;  1WTY A;  3A4M A;  3BRJ A;  1UX5 A;  2YWA A;  3C8G D;  3AM1 A;  1PV3 A;  3C18 A;  3C8G B;  2P63 A;  3K7D A;  1UFB A;  3GM1 A;  3O10 A;  4R32 A;  4XEK A;  1WWP A;  3RQG A;  1V4A A;  3JZ0 A;  3AJM A;  4NNQ A;  3MFN A;  3GM3 A;  3U3F A;  4EBJ A;  1KTM A;  1UX4 A;  1OW6 A;  4NQF A;  1O3U A;  1K05 A;  2JX0 A;  1ZZP A;  2L6G A;  2LK4 A;  3W8H B;  3RQF A;  2KK1 A;  3GM2 A;  2Q00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...