3RQEA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
190
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 73
structure length 190
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqeA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqeA02
3C8GA 3JYYA 4R32A 3C8GD 2Q00A 1PV3A 2HSBA 3GM1A 1OW7A 3GM3A 2YWAA 4XEFA 3W8HB 3U0CA 1O3UA 3K7DA 3C8GB 3MFNA 3RQFA 1WWPA 3GM2A 2L6FA 5F28E 1KNYA 2JX0A 3C18A 3L8JA 1JOGA 1QVXA 1K40A 3JZ0A 3AJMA 4XEKA 3BRJA 1V4AA 3O10A 1UFBA 3B71A 2LK4A 2L6GA 1KTMA 3RQEA 4XEVA 3W8IB 1WTYA 3S9OA 3TULA 4EBJA 1OW8A 1OW6A 3RQGA 1ZZPA 4GEHB 2KK1A 3L8IA 1WOLA 1K04A 2PBEA 4EBKA 1K05A 3U3FA 4NQFA 2JPUA 2L6HA
chains in the Genus database with same CATH superfamily
4IJJA 1H6GA 2QNLA 1L7CA 1Y4CA 4BJ1A 3A9CA 3O10A 2M4EA 4DVYP 1WGWA 3A4MA 3TK0A 1CGOA 3AGTA 4IWBA 3T6JA 3H65A 4JEBA 4MNDA 4E7ZA 2AWYA 3TD7A 3TRRA 4J7TA 3AM1A 1GQAA 2R7WA 1RKEB 3WAQA 2P63A 1JAFA 3FDQA 2XXAB 5JT4A 4DRJB 1MJ3A 2NUTA 1QSPA 3HINA 1LS4A 2Q4FA 1D1AA 1NZYA 5BQHA 3L0IA 5KYXA 2BL2A 3P5MA 4A2NB 3Q6MA 1YLMA 4E7SA 1ST6A 3K1IC 3F46A 3RF3A 2ZQRA 2R7QA 2ZPAA 3QZCA 3SEOA 1NZEA 3ASNC 1G8XA 1GGQA 1JMWA 1OCCC 5KYWB 4FX5A 2FBMA 2R25A 1ZW3A 3L8IA 2PPYA 3U2LA 4O79A 2H7VC 4CS9A 1HMDA 3EJNA 2J9UA 4MW3A 2VCCA 2L6GA 4PR9A 2YLIA 2EPOA 3ZQYA 3EGDA 4O7GA 1BR2A 2OEVA 3B29A 2VC9A 4JRZA 3EH1A 2R02A 4OINF 4G7ZF 3EFOB 3M4BA 1BR1A 2F6QA 1Y64B 4CS7A 4OIPF 1VMAA 3PMRA 3M4CA 1LI5A 4EBKA 1V55C 1D1CA 3Q1TA 1ZW2A 5BQIA 4YT4A 2GDCA 1WWPA 3HLZA 3VRCA 1TFKB 3W2VA 4J32B 3NKDA 2XS1A 4MVSA 1YZCA 1RJ9B 3T4RA 2ZXPA 3DM5A 2PX0A 4QIIA 4G0HA 3QXIA 1QPUA 3C8GB 4HFFB 1QKRA 1R5ID 3DE8A 2EIMC 1MQVA 4AL1A 3ECSA 3K66A 5A6BA 2YHSA 3J06A 1HW2A 1SR2A 2LP4A 3A11A 1TWAA 3ZSUA 3ABLC 5T3WA 1ZHYA 3ADCA 4I42A 4JJGA 2YVKA 4HE8D 4NNQA 5K0IA 5AC4A 4XPYA 4BJ5C 3GEHA 4IAQA 3DE9A 3M79A 3IQTA 3R2PA 1UX5A 1YVIA 2CCYA 1SF8A 2FFHA 3C62A 4NEKA 1M2OA 2IYLD 3TJ5A 1Q0GA 5F28E 3C7JA 4BEMJ 1VTMP 2DB4A 1WASA 3ADDA 4RD9A 3Q0GA 5EHHA 3FHDA 4QI2A 2J9VA 2ZD9A 2UUIA 2Q3TA 4JTCB 3E9VA 2PP4A 5JBWA 3O4XE 1SYQA 4IAOA 3HNKA 1OCZC 3NYJA 4Q4ZF 4JWVA 3RVZA 1NLXA 1FAPB 1MMNA 2IOQA 3U8VA 4BJ6A 2MWQA 4JURI 4ONSA 4I52A 3LEVA 1Q0FA 1JOGA 2QY9A 4J7YA 2ASRA 4XPXA 3IRBA 1KTMA 2XM0A 2WVNA 1ORJA 1NFOA 3S0XA 1E86A 2PNOA 3EHNA 5FZTA 2Q00A 3M15A 3LLKA 4MVMA 4P6IC 4I1OB 4WGZA 3E70C 3KQFA 2CGEA 1AEPA 1K04A 4MQ9F 2VX2A 1YYJA 2YL3A 4XLNF 5COMA 4F4BA 3TOLA 2R7SA 3TQOA 1YZAA 2Q9CA 1ORSC 1SMYF 2R05A 2H7OA 1M2VB 2XLMA 3EQLF 3S29A 4WCZA 3K1IA 3TOMA 4PJMA 4Z9HA 3K1HA 5L0HA 1T6QA 4MVZA 2KSFA 3MBGA 5EK0A 3QVYA 3EGXA 3RQGA 3WHNA 4ELSA 3ZTZA 2YLGA 1D0XA 3KKBA 5F5FA 2Y3GA 4E0IA 3SXZA 4MVQA 3JSEO 3FAPB 1G5ZA 4CX9A 2KGOA 3NDBB 3DM9B 4OIRF 1OXBA 2AWCA 1Q0KA 2YL1A 3GEIA 4HEAJ 4YWQA 2BC5A 2YQYA 4CDYA 2WVQA 3L1MA 4LACB 4IGGA 3HKKA 5DS4A 2EJ5A 1ZHZA 4KNPA 2OJQA 1O87A 4E17A 4XPWA 4M63A 1E85A 2NSFA 1LVKA 3HJCA 5JLIA 5EGYA 4JJFA 1VK5A 2LQGA 3MX3A 3DKAA 4DXWA 1ZHTA 3MOYA 2OOCA 3FOOA 2AU5A 3W8IB 1RKEA 3SXYA 3I47A 4IZDA 3EHMA 3LESA 2UZFA 4U19A 1C17M 4YN0B 2R9RB 3ASOC 3FMSA 4HFKB 3ZC4A 1CGME 5JVEA 4N6HA 1XZPA 3G4ZA 1RKCA 2VB6A 2PBPA 2J45A 1K05A 1HE9A 3DWWA 3F47A 3LNMB 1ZYRF 3AJMA 1D0YA 4JCHA 3T6GB 2WZLA 3IPMO 2IEXA 4CJGA 3CQZA 5A6BD 4BJ6C 1ZVZA 1J8MF 1MMAA 2L81A 1S7ZA 4MVRA 3LLIA 3R7CA 2WZFA 3JRMO 4Z9JA 1M56C 1OKKA 4XEFA 5JRAA 4CIHA 3L8JA 3ZIBA 4FJWD 5HV9A 1WTYA 3UMIA 1B68A 5L3QA 3DXJF 2CNWA 3W4YA 1ZHXA 5D92A 4K2NA 3SYNA 4DBRA 1HZDA 3G64A 3SWXA 4GEHB 2YRFA 3AG1C 3HNLA 4U5CE 3HNIA 5L3VA 3ADBA 3AOUA 3H2UA 3EFOA 4EMLA 4L6RA 5KYUA 4WGYA 5B1AC 4U9DA 1ZU5A 1Y6DA 3I5PA 1IZMA 4U5HA 1RMVA 2DYSC 5BUOA 3EPVA 2YLDA 3QK8A 3WODF 5E2QA 4IZBA 3NYMA 3DAGA 2PX3A 2AP3A 2IXMA 3RQEA 4JCSA 1RJ9A 5DQZA 3AG3C 3QW0A 2A6EF 3T6BA 3MYFA 3C8GA 2R7OA 4LDQA 3EG9B 2H7BA 2Y3DA 4MS2A 5B3SC 1K40A 3R9SA 2A0UA 4I1MA 2R03A 2V3CC 1Q51A 3OC7A 4EBJA 1YARO 1T6IA 3TLFA 3GWLA 2HS5A 3V5YA 1MNEA 1DUBA 3S27A 1R4TA 1KNYA 5F5HA 2EPMX 4U18A 3ABMC 5JUAA 2C03A 1OXKA 3FVYA 1MMDA 4C3DA 3C8ZA 5A69A 1VLTA 2J0XA 1WN0A 3U3FA 1EF9A 1T01A 3X2QC 4R32A 4LLCA 1E2XA 1KU2A 1GS9A 4PJLA 2V26A 3QW1A 1WATA 2HJ3A 1JXZA 4JZAA 3LAYA 2KC3A 3DJUB 4YL3A 1LKXA 1YA9A 3B9QA 5BQGA 1OCOC 4CS8A 4C3BA 3DD7A 3GM3A 3LNRA 1LIHA 2HKVA 2B0HA 2G3KA 3FXHA 3NMIA 2OU6A 2JD3A 4DBQA 5DQTA 2QE9A 1VYKA 2JPUA 4ER9A 1EQ1A 3NG1A 3RSIA 2J7PD 3MFNA 4O6MA 1FTSA 2YL0A 4DRHB 5KYYA 2Q7RA 3NMKA 2L7AA 3TULA 4CSAA 1PD1A 3V7OA 2Y69C 3KYJA 4JYLA 2XLOA 3EGDB 4MVOA 3LJBA 1ORYA 4JKVA 4YT8A 4I4ZA 3QTHA 4EKWA 3ZWIA 4D4XA 2ZQQA 1G4WR 1JR8A 1PCXA 4J30B 5DLJA 4G7OF 3T89A 1RCPA 2VCBA 4KI2A 4MVUA 4YT2A 3R9TA 1D1BA 3C18A 4CIPA 3JT1A 2R7XA 4XTKA 1M2VA 2LFFA 5D91A 3NKEA 4JIOA 4JEAA 3S28A 1D0ZA 2LD6A 4BEJA 2HW5A 1FFHA 2KJGA 1TQGA 4P9FA 3W8HB 3K7DA 3JCUQ 3UGPA 1U89A 2W9YA 2A69F 1BDJB 3Q7GA 4AK9A 3MYIA 2HV7A 3LUTB 2QTVA 1Q52A 3UR3C 1H9TA 5CI8A 1NFNA 2XSEA 1LM3B 3O39A 5JP7A 1V4AA 4ZLDA 3H81A 5L0CA 3FAJA 1TWCA 1A0BA 3KYIA 1FMWA 1HMOA 3U2MA 5L0DA 1JPNA 2GWWA 3IQ5A 4GYTA 4EWCA 4CBEA 3PHF2 3LEOA 2Q9BA 3BEHA 2P61A 3CZ6A 1RJMA 4K7BA 3POVA 4YL1A 2YEVA 2J9WA 4A4AA 2YL7A 1V74B 4EIYA 2HMZA 3GODA 5L0IA 1V54C 2P0NA 4KC9A 3V5ZA 1DOVA 3T9OA 3A4LA 2WB7A 1OR3A 4CDAA 5GPGB 2EPKX 4KNWA 3GM2A 2QLAA 2NSGA 1AVOB 2A0BA 4PJNA 5JSLA 2CDQA 4IZCA 4FESA 2R7VA 2WZGA 3ZQVA 2Y39A 3MYBA 2EIJC 3RQFA 2KYHA 5B1BC 1QVXA 1TKNA 3W8IA 1HY5A 1WZ8A 2EINC 3K33A 3OEOA 2LIGA 4QI0A 4OIOF 256BA 1LI7A 2IBFA 2D4UA 1H9GA 5DVWA 3S84A 1Z63A 3QMKA 1NU7D 3AQBA 1PD0A 3PZKA 4XEKA 1I5NA 2XM4A 4NY3A 3US6A 1QZXA 4K1OA 5E3CA 4CS8C 3X1OA 1Q0DA 2CYDA 2DGJA 1EI7A 4C7OB 1HW1A 3R0OA 1VOMA 1FMVA 3C8GD 3U0CA 4D4NA 4JFCA 3IQ6A 3ZG1A 2LSEA 3N24A 5T1DB 2QQ3A 4LDRA 1CPRA 3RIPA 1QQ3A 2RSEB 5KJPA 2YZSA 2XL6A 2FAPB 3A4NA 5AGFA 4F47A 2J46A 2NUPB 4U5FE 2OJED 1E84A 2M64A 4CSAC 1CPQA 1I4ZA 1OW6A 2H8AA 2G3VA 3EGXB 4AE4B 4OIQF 4W8PA 2J0WA 3B0UX 2J8WA 3G4XA 2XXAA 1OR2A 4XWJA 5TJ5E 1RXQA 3HTKC 4GEHA 4YK5A 2Y3HA 1W2WA 2GAQA 4RBNA 4U9EA 3RFYA 1UIYA 3JYYA 4YT5A 2OQMA 1YJGA 1M6TA 1YDIA 3B0VC 4U5DE 4JOTA 2XL8A 5IY5C 1LE2A 3NMJA 2F22A 2KK1A 3B0PA 2W4MA 4NTAA 2MHRA 3VF0A 1T6UA 4EBBA 4ZU2A 1Z6AA 4C3EA 2R7TA 5KYWA 3U9JA 4E18A 1DCIA 2VASA 1JPJA 1L3PA 4PACA 5L0JA 2GTRA 2VH3A 4QIJA 4U5GA 3EG9A 4IB4A 1MNDA 1C02A 3KPHA 3RYLA 1Z5ZA 1I4YA 4KNVA 1FFTC 1C03A 4WABA 1M57C 4DJ9A 2OG2A 4LERA 2QUPA 2L9JA 1XZQA 4MTOA 3AG4C 3ZTMA 4X0RA 1AUEA 5CI9A 5KYNA 2W4BA 4G78A 1VYIA 2X0CA 5DS6A 2LFDA 4I3MA 3UGOA 4MTFA 1PV3A 3LS1A 3H2VA 4EUKB 2AVKA 1UFBA 4OD5A 1RJNA 3L34A 4Q7CA 5FCLA 4DRIB 3H02A 3LS0A 4JTAB 1O5HA 1MMGA 3S90A 2VREA 4OD4A 1EY3A 1UX4A 1BZ4A 4BPMA 4U1AA 4MOUA 5AC5A 3O6XA 2OEXA 3ITFA 1H7IA 2HFIA 5L0FA 2D5RB 2DYRC 1TR2A 4MTGA 4RDAA 2A1DD 3U8PA 1Q0MA 2I15A 4CDVA 4LDKA 2EPNA 2HV6A 3CEXA 3I5QA 2A6HF 4PFPA 2NUTB 4ELXA 3JRTA 2O9XA 2HSBA 2EILC 3HRXA 1ZHWA 1NZYB 5KYXB 5KYUB 2OCCC 4JVSA 2GA0A 4FWVA 4P9TA 3OWTA 1CGNA 4ULVA 3GEEA 2XLDA 1FR0A 3ZVRA 3VYWA 2I8BA 1JRAA 4PFOA 1DOWA 2KNHA 4BJTA 3DJNB 1A7EA 3B71A 4QDLA 2KQ9A 3SZRA 3WG7C 2J9BA 2CW0F 2DUBA 3Q7LA 2KW3C 2PFDA 2IXNA 2XLEA 3T8AA 2EPLX 2MYSA 3W8HA 2LCHA 2VCAA 4IARA 4KBLA 4K3WA 2XLWA 2YWAA 4NTBA 4B6IA 3AQCA 3EZIA 3DI5A 1BBHA 3NRHA 3NYLA 2Y3BA 5E33A 3VM6A 3UNGC 2XLHA 5HSWA 3KH2A 4YJWA 2NG1A 4G7HF 1HE1A 1EA8A 2R7UA 4AL0A 1EF8A 5A6KA 3FDUA 4UDVA 3N0TA 4FZWA 2WL8A 3AG2C 3I4UA 3M1CB 4OLQA 3GM1A 1TWGA 3N2ZB 1NSGB 1IW7F 3VAYA 3BRJA 1NU9C 1Z3IX 1LPEA 4NC3A 2IXOA 2XL4A 5DS5A 1UG7A 2XRHA 3T88A 3RVYA 4EHPA 2HSQA 3GORA 2YKZA 4DVZA 3U3BA 2NPUA 4OG1A 3DZAA 4WJ0A 5JBXA 2FW2A 4Z9IA 1ZU4A 3KMIA 1VB5A 4PK4A 4GQHA 4MI2A 2IXPA 2BE5F 5A6JA 1GM5A 4AX2A 5A6AA 1J8YF 5KYYB 3S9OA 3AGUA 3SP1A 3U5SA 1LS1A 1FNTc 3EH2A 2L6HA 3DMDA 1OQCA 2C04A 3Q6NA 4FAPB 4ANJA 4JC7A 1OKKD 3W2WA 1U0BB 4U5EE 3RW0A 4ULWA 1F1MA 5E3AA 3IEEA 2G62A 2HZ8A 2LK4A 4E0HA 2HJMA 1ZZPA 4ELWA 4C7OA 2TMVP 2CNWD 5CIVA 1O3UA 2L6FA 3GWNA 3SXKA 1XWJA 4LLEA 1EKYA 3DAFA 4MW8A 3O55A 2FGYA 5COFA 3ATPA 3QVZA 4CS9C 4H4KC 5L0GA 1NBBA 2NUPA 3UMKA 4XQ1A 1G4US 2P6VA 4DOZA 3JSZA 4NCQA 2OKUA 4U5BE 1N1CA 3EZHA 3PCVA 3KL4A 2ZXRA 2RD9A 2ZXWC 4O6YA 4AE4A 2B0JA 1SZIA 4BG0A 4W8KA 2ETSA 4PJJA 2Z15A 3JYHA 2X51A 2R7RA 3JTLO 3SLLA 4IRUA 4ZLCA 1YAUO 4N6CA 3V5XA 4O6NA 3RH3A 4NTFA 2WVOA 1OW8A 1TFOB 2W45A 5C9GA 1NG1A 2DI3A 2EIKC 2HMQA 1BR4A 3FOPA 2A68F 2ZXOA 2J7PA 4K0DA 2GFHA 2ICWG 3JZ0A 2UUHA 3OA1A 1A7DA 4XEVA 1A41A 1VLSA 1WOLA 4I44A 5COGA 1TWHA 5JS5A 2IM8A 4H54A 3U9MA 1Z23A 5B3IA 1E83A 3QXZA 5T3TA 4YL0A 2HUJA 3RKOF 2XS8A 2E87A 4JE9A 1YA7O 3CSKA 3GANA 3ABKC 1APCA 1QLEC 4JTDB 3IHUA 4NQFA 1U6HA 3IQCA 2Q9AA 4Q5SF 3TJ6A 1OW7A 2P7VA 3ZDLA 3MLGA 3Q0JA 1T9KA 1S05A 2P1AA 4JCZA 4CJOA 4JW1A 4N06A 1YYXA 3G50A 4N4WA 4FZWC 3PDMP 1A7VA 3C63A 3SXMA 2PBEA 1LE4A 2XLVA 3SNHA 1Z7Qc 2JX0A 3K6BA 3HNJA 1OCRC 1T5OA 4BJ5A 4XLPF 2PF4E 3UMHA 3CAXA
chains in the Genus database with same CATH topology
4R32A 3C8GB 3GM2A 3C18A 1JOGA 3JZ0A 3O10A 2LK4A 3IRBA 1KTMA 4XEVA 1OW6A 1ZZPA 3L8IA 3A4MA 1WOLA 1K05A 3ADCA 2Q00A 2HSBA 3GM1A 3GM3A 3W8HB 1O3UA 3K7DA 3RQFA 2L6FA 4NNQA 1QVXA 3AJMA 3BRJA 2L6GA 3RQEA 3AM1A 1UX5A 1K04A 2P63A 4NQFA 2JPUA 3C8GA 3JYYA 1PV3A 1OW7A 4XEFA 3MFNA 5F28E 3L8JA 1K40A 4XEKA 1V4AA 1UFBA 3B71A 3ADDA 1WTYA 1Y64B 3TULA 4EBJA 2KK1A 2PBEA 4EBKA 3C8GD 1RJMA 2YWAA 3U0CA 1WWPA 1KNYA 2JX0A 1UX4A 3O4XE 3W8IB 3S9OA 1OW8A 3RQGA 4GEHB 3ADBA 3A4LA 3A4NA 3U3FA 2L6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G A;  3JYY A;  4R32 A;  3C8G D;  2Q00 A;  1PV3 A;  2HSB A;  3GM1 A;  1OW7 A;  3GM3 A;  2YWA A;  4XEF A;  3W8H B;  3U0C A;  1O3U A;  3K7D A;  3C8G B;  3MFN A;  3RQF A;  1WWP A;  3GM2 A;  2L6F A;  5F28 E;  1KNY A;  2JX0 A;  3C18 A;  3L8J A;  1JOG A;  1QVX A;  1K40 A;  3JZ0 A;  3AJM A;  4XEK A;  3BRJ A;  1V4A A;  3O10 A;  1UFB A;  3B71 A;  2LK4 A;  2L6G A;  1KTM A;  3RQE A;  4XEV A;  3W8I B;  1WTY A;  3S9O A;  3TUL A;  4EBJ A;  1OW8 A;  1OW6 A;  3RQG A;  1ZZP A;  4GEH B;  2KK1 A;  3L8I A;  1WOL A;  1K04 A;  2PBE A;  4EBK A;  1K05 A;  3U3F A;  4NQF A;  2JPU A;  2L6H A; 
#chains in the Genus database with same CATH topology
 4IJJ A;  1H6G A;  2QNL A;  1L7C A;  1Y4C A;  4BJ1 A;  3A9C A;  3O10 A;  2M4E A;  4DVY P;  1WGW A;  3A4M A;  3TK0 A;  1CGO A;  3AGT A;  4IWB A;  3T6J A;  3H65 A;  4JEB A;  4MND A;  4E7Z A;  2AWY A;  3TD7 A;  3TRR A;  4J7T A;  3AM1 A;  1GQA A;  2R7W A;  1RKE B;  3WAQ A;  2P63 A;  1JAF A;  3FDQ A;  2XXA B;  5JT4 A;  4DRJ B;  1MJ3 A;  2NUT A;  1QSP A;  3HIN A;  1LS4 A;  2Q4F A;  1D1A A;  1NZY A;  5BQH A;  3L0I A;  5KYX A;  2BL2 A;  3P5M A;  4A2N B;  3Q6M A;  1YLM A;  4E7S A;  1ST6 A;  3K1I C;  3F46 A;  3RF3 A;  2ZQR A;  2R7Q A;  2ZPA A;  3QZC A;  3SEO A;  1NZE A;  3ASN C;  1G8X A;  1GGQ A;  1JMW A;  1OCC C;  5KYW B;  4FX5 A;  2FBM A;  2R25 A;  1ZW3 A;  3L8I A;  2PPY A;  3U2L A;  4O79 A;  2H7V C;  4CS9 A;  1HMD A;  3EJN A;  2J9U A;  4MW3 A;  2VCC A;  2L6G A;  4PR9 A;  2YLI A;  2EPO A;  3ZQY A;  3EGD A;  4O7G A;  1BR2 A;  2OEV A;  3B29 A;  2VC9 A;  4JRZ A;  3EH1 A;  2R02 A;  4OIN F;  4G7Z F;  3EFO B;  3M4B A;  1BR1 A;  2F6Q A;  1Y64 B;  4CS7 A;  4OIP F;  1VMA A;  3PMR A;  3M4C A;  1LI5 A;  4EBK A;  1V55 C;  1D1C A;  3Q1T A;  1ZW2 A;  5BQI A;  4YT4 A;  2GDC A;  1WWP A;  3HLZ A;  3VRC A;  1TFK B;  3W2V A;  4J32 B;  3NKD A;  2XS1 A;  4MVS A;  1YZC A;  1RJ9 B;  3T4R A;  2ZXP A;  3DM5 A;  2PX0 A;  4QII A;  4G0H A;  3QXI A;  1QPU A;  3C8G B;  4HFF B;  1QKR A;  1R5I D;  3DE8 A;  2EIM C;  1MQV A;  4AL1 A;  3ECS A;  3K66 A;  5A6B A;  2YHS A;  3J06 A;  1HW2 A;  1SR2 A;  2LP4 A;  3A11 A;  1TWA A;  3ZSU A;  3ABL C;  5T3W A;  1ZHY A;  3ADC A;  4I42 A;  4JJG A;  2YVK A;  4HE8 D;  4NNQ A;  5K0I A;  5AC4 A;  4XPY A;  4BJ5 C;  3GEH A;  4IAQ A;  3DE9 A;  3M79 A;  3IQT A;  3R2P A;  1UX5 A;  1YVI A;  2CCY A;  1SF8 A;  2FFH A;  3C62 A;  4NEK A;  1M2O A;  2IYL D;  3TJ5 A;  1Q0G A;  5F28 E;  3C7J A;  4BEM J;  1VTM P;  2DB4 A;  1WAS A;  3ADD A;  4RD9 A;  3Q0G A;  5EHH A;  3FHD A;  4QI2 A;  2J9V A;  2ZD9 A;  2UUI A;  2Q3T A;  4JTC B;  3E9V A;  2PP4 A;  5JBW A;  3O4X E;  1SYQ A;  4IAO A;  3HNK A;  1OCZ C;  3NYJ A;  4Q4Z F;  4JWV A;  3RVZ A;  1NLX A;  1FAP B;  1MMN A;  2IOQ A;  3U8V A;  4BJ6 A;  2MWQ A;  4JUR I;  4ONS A;  4I52 A;  3LEV A;  1Q0F A;  1JOG A;  2QY9 A;  4J7Y A;  2ASR A;  4XPX A;  3IRB A;  1KTM A;  2XM0 A;  2WVN A;  1ORJ A;  1NFO A;  3S0X A;  1E86 A;  2PNO A;  3EHN A;  5FZT A;  2Q00 A;  3M15 A;  3LLK A;  4MVM A;  4P6I C;  4I1O B;  4WGZ A;  3E70 C;  3KQF A;  2CGE A;  1AEP A;  1K04 A;  4MQ9 F;  2VX2 A;  1YYJ A;  2YL3 A;  4XLN F;  5COM A;  4F4B A;  3TOL A;  2R7S A;  3TQO A;  1YZA A;  2Q9C A;  1ORS C;  1SMY F;  2R05 A;  2H7O A;  1M2V B;  2XLM A;  3EQL F;  3S29 A;  4WCZ A;  3K1I A;  3TOM A;  4PJM A;  4Z9H A;  3K1H A;  5L0H A;  1T6Q A;  4MVZ A;  2KSF A;  3MBG A;  5EK0 A;  3QVY A;  3EGX A;  3RQG A;  3WHN A;  4ELS A;  3ZTZ A;  2YLG A;  1D0X A;  3KKB A;  5F5F A;  2Y3G A;  4E0I A;  3SXZ A;  4MVQ A;  3JSE O;  3FAP B;  1G5Z A;  4CX9 A;  2KGO A;  3NDB B;  3DM9 B;  4OIR F;  1OXB A;  2AWC A;  1Q0K A;  2YL1 A;  3GEI A;  4HEA J;  4YWQ A;  2BC5 A;  2YQY A;  4CDY A;  2WVQ A;  3L1M A;  4LAC B;  4IGG A;  3HKK A;  5DS4 A;  2EJ5 A;  1ZHZ A;  4KNP A;  2OJQ A;  1O87 A;  4E17 A;  4XPW A;  4M63 A;  1E85 A;  2NSF A;  1LVK A;  3HJC A;  5JLI A;  5EGY A;  4JJF A;  1VK5 A;  2LQG A;  3MX3 A;  3DKA A;  4DXW A;  1ZHT A;  3MOY A;  2OOC A;  3FOO A;  2AU5 A;  3W8I B;  1RKE A;  3SXY A;  3I47 A;  4IZD A;  3EHM A;  3LES A;  2UZF A;  4U19 A;  1C17 M;  4YN0 B;  2R9R B;  3ASO C;  3FMS A;  4HFK B;  3ZC4 A;  1CGM E;  5JVE A;  4N6H A;  1XZP A;  3G4Z A;  1RKC A;  2VB6 A;  2PBP A;  2J45 A;  1K05 A;  1HE9 A;  3DWW A;  3F47 A;  3LNM B;  1ZYR F;  3AJM A;  1D0Y A;  4JCH A;  3T6G B;  2WZL A;  3IPM O;  2IEX A;  4CJG A;  3CQZ A;  5A6B D;  4BJ6 C;  1ZVZ A;  1J8M F;  1MMA A;  2L81 A;  1S7Z A;  4MVR A;  3LLI A;  3R7C A;  2WZF A;  3JRM O;  4Z9J A;  1M56 C;  1OKK A;  4XEF A;  5JRA A;  4CIH A;  3L8J A;  3ZIB A;  4FJW D;  5HV9 A;  1WTY A;  3UMI A;  1B68 A;  5L3Q A;  3DXJ F;  2CNW A;  3W4Y A;  1ZHX A;  5D92 A;  4K2N A;  3SYN A;  4DBR A;  1HZD A;  3G64 A;  3SWX A;  4GEH B;  2YRF A;  3AG1 C;  3HNL A;  4U5C E;  3HNI A;  5L3V A;  3ADB A;  3AOU A;  3H2U A;  3EFO A;  4EML A;  4L6R A;  5KYU A;  4WGY A;  5B1A C;  4U9D A;  1ZU5 A;  1Y6D A;  3I5P A;  1IZM A;  4U5H A;  1RMV A;  2DYS C;  5BUO A;  3EPV A;  2YLD A;  3QK8 A;  3WOD F;  5E2Q A;  4IZB A;  3NYM A;  3DAG A;  2PX3 A;  2AP3 A;  2IXM A;  3RQE A;  4JCS A;  1RJ9 A;  5DQZ A;  3AG3 C;  3QW0 A;  2A6E F;  3T6B A;  3MYF A;  3C8G A;  2R7O A;  4LDQ A;  3EG9 B;  2H7B A;  2Y3D A;  4MS2 A;  5B3S C;  1K40 A;  3R9S A;  2A0U A;  4I1M A;  2R03 A;  2V3C C;  1Q51 A;  3OC7 A;  4EBJ A;  1YAR O;  1T6I A;  3TLF A;  3GWL A;  2HS5 A;  3V5Y A;  1MNE A;  1DUB A;  3S27 A;  1R4T A;  1KNY A;  5F5H A;  2EPM X;  4U18 A;  3ABM C;  5JUA A;  2C03 A;  1OXK A;  3FVY A;  1MMD A;  4C3D A;  3C8Z A;  5A69 A;  1VLT A;  2J0X A;  1WN0 A;  3U3F A;  1EF9 A;  1T01 A;  3X2Q C;  4R32 A;  4LLC A;  1E2X A;  1KU2 A;  1GS9 A;  4PJL A;  2V26 A;  3QW1 A;  1WAT A;  2HJ3 A;  1JXZ A;  4JZA A;  3LAY A;  2KC3 A;  3DJU B;  4YL3 A;  1LKX A;  1YA9 A;  3B9Q A;  5BQG A;  1OCO C;  4CS8 A;  4C3B A;  3DD7 A;  3GM3 A;  3LNR A;  1LIH A;  2HKV A;  2B0H A;  2G3K A;  3FXH A;  3NMI A;  2OU6 A;  2JD3 A;  4DBQ A;  5DQT A;  2QE9 A;  1VYK A;  2JPU A;  4ER9 A;  1EQ1 A;  3NG1 A;  3RSI A;  2J7P D;  3MFN A;  4O6M A;  1FTS A;  2YL0 A;  4DRH B;  5KYY A;  2Q7R A;  3NMK A;  2L7A A;  3TUL A;  4CSA A;  1PD1 A;  3V7O A;  2Y69 C;  3KYJ A;  4JYL A;  2XLO A;  3EGD B;  4MVO A;  3LJB A;  1ORY A;  4JKV A;  4YT8 A;  4I4Z A;  3QTH A;  4EKW A;  3ZWI A;  4D4X A;  2ZQQ A;  1G4W R;  1JR8 A;  1PCX A;  4J30 B;  5DLJ A;  4G7O F;  3T89 A;  1RCP A;  2VCB A;  4KI2 A;  4MVU A;  4YT2 A;  3R9T A;  1D1B A;  3C18 A;  4CIP A;  3JT1 A;  2R7X A;  4XTK A;  1M2V A;  2LFF A;  5D91 A;  3NKE A;  4JIO A;  4JEA A;  3S28 A;  1D0Z A;  2LD6 A;  4BEJ A;  2HW5 A;  1FFH A;  2KJG A;  1TQG A;  4P9F A;  3W8H B;  3K7D A;  3JCU Q;  3UGP A;  1U89 A;  2W9Y A;  2A69 F;  1BDJ B;  3Q7G A;  4AK9 A;  3MYI A;  2HV7 A;  3LUT B;  2QTV A;  1Q52 A;  3UR3 C;  1H9T A;  5CI8 A;  1NFN A;  2XSE A;  1LM3 B;  3O39 A;  5JP7 A;  1V4A A;  4ZLD A;  3H81 A;  5L0C A;  3FAJ A;  1TWC A;  1A0B A;  3KYI A;  1FMW A;  1HMO A;  3U2M A;  5L0D A;  1JPN A;  2GWW A;  3IQ5 A;  4GYT A;  4EWC A;  4CBE A;  3PHF 2;  3LEO A;  2Q9B A;  3BEH A;  2P61 A;  3CZ6 A;  1RJM A;  4K7B A;  3POV A;  4YL1 A;  2YEV A;  2J9W A;  4A4A A;  2YL7 A;  1V74 B;  4EIY A;  2HMZ A;  3GOD A;  5L0I A;  1V54 C;  2P0N A;  4KC9 A;  3V5Z A;  1DOV A;  3T9O A;  3A4L A;  2WB7 A;  1OR3 A;  4CDA A;  5GPG B;  2EPK X;  4KNW A;  3GM2 A;  2QLA A;  2NSG A;  1AVO B;  2A0B A;  4PJN A;  5JSL A;  2CDQ A;  4IZC A;  4FES A;  2R7V A;  2WZG A;  3ZQV A;  2Y39 A;  3MYB A;  2EIJ C;  3RQF A;  2KYH A;  5B1B C;  1QVX A;  1TKN A;  3W8I A;  1HY5 A;  1WZ8 A;  2EIN C;  3K33 A;  3OEO A;  2LIG A;  4QI0 A;  4OIO F;  256B A;  1LI7 A;  2IBF A;  2D4U A;  1H9G A;  5DVW A;  3S84 A;  1Z63 A;  3QMK A;  1NU7 D;  3AQB A;  1PD0 A;  3PZK A;  4XEK A;  1I5N A;  2XM4 A;  4NY3 A;  3US6 A;  1QZX A;  4K1O A;  5E3C A;  4CS8 C;  3X1O A;  1Q0D A;  2CYD A;  2DGJ A;  1EI7 A;  4C7O B;  1HW1 A;  3R0O A;  1VOM A;  1FMV A;  3C8G D;  3U0C A;  4D4N A;  4JFC A;  3IQ6 A;  3ZG1 A;  2LSE A;  3N24 A;  5T1D B;  2QQ3 A;  4LDR A;  1CPR A;  3RIP A;  1QQ3 A;  2RSE B;  5KJP A;  2YZS A;  2XL6 A;  2FAP B;  3A4N A;  5AGF A;  4F47 A;  2J46 A;  2NUP B;  4U5F E;  2OJE D;  1E84 A;  2M64 A;  4CSA C;  1CPQ A;  1I4Z A;  1OW6 A;  2H8A A;  2G3V A;  3EGX B;  4AE4 B;  4OIQ F;  4W8P A;  2J0W A;  3B0U X;  2J8W A;  3G4X A;  2XXA A;  1OR2 A;  4XWJ A;  5TJ5 E;  1RXQ A;  3HTK C;  4GEH A;  4YK5 A;  2Y3H A;  1W2W A;  2GAQ A;  4RBN A;  4U9E A;  3RFY A;  1UIY A;  3JYY A;  4YT5 A;  2OQM A;  1YJG A;  1M6T A;  1YDI A;  3B0V C;  4U5D E;  4JOT A;  2XL8 A;  5IY5 C;  1LE2 A;  3NMJ A;  2F22 A;  2KK1 A;  3B0P A;  2W4M A;  4NTA A;  2MHR A;  3VF0 A;  1T6U A;  4EBB A;  4ZU2 A;  1Z6A A;  4C3E A;  2R7T A;  5KYW A;  3U9J A;  4E18 A;  1DCI A;  2VAS A;  1JPJ A;  1L3P A;  4PAC A;  5L0J A;  2GTR A;  2VH3 A;  4QIJ A;  4U5G A;  3EG9 A;  4IB4 A;  1MND A;  1C02 A;  3KPH A;  3RYL A;  1Z5Z A;  1I4Y A;  4KNV A;  1FFT C;  1C03 A;  4WAB A;  1M57 C;  4DJ9 A;  2OG2 A;  4LER A;  2QUP A;  2L9J A;  1XZQ A;  4MTO A;  3AG4 C;  3ZTM A;  4X0R A;  1AUE A;  5CI9 A;  5KYN A;  2W4B A;  4G78 A;  1VYI A;  2X0C A;  5DS6 A;  2LFD A;  4I3M A;  3UGO A;  4MTF A;  1PV3 A;  3LS1 A;  3H2V A;  4EUK B;  2AVK A;  1UFB A;  4OD5 A;  1RJN A;  3L34 A;  4Q7C A;  5FCL A;  4DRI B;  3H02 A;  3LS0 A;  4JTA B;  1O5H A;  1MMG A;  3S90 A;  2VRE A;  4OD4 A;  1EY3 A;  1UX4 A;  1BZ4 A;  4BPM A;  4U1A A;  4MOU A;  5AC5 A;  3O6X A;  2OEX A;  3ITF A;  1H7I A;  2HFI A;  5L0F A;  2D5R B;  2DYR C;  1TR2 A;  4MTG A;  4RDA A;  2A1D D;  3U8P A;  1Q0M A;  2I15 A;  4CDV A;  4LDK A;  2EPN A;  2HV6 A;  3CEX A;  3I5Q A;  2A6H F;  4PFP A;  2NUT B;  4ELX A;  3JRT A;  2O9X A;  2HSB A;  2EIL C;  3HRX A;  1ZHW A;  1NZY B;  5KYX B;  5KYU B;  2OCC C;  4JVS A;  2GA0 A;  4FWV A;  4P9T A;  3OWT A;  1CGN A;  4ULV A;  3GEE A;  2XLD A;  1FR0 A;  3ZVR A;  3VYW A;  2I8B A;  1JRA A;  4PFO A;  1DOW A;  2KNH A;  4BJT A;  3DJN B;  1A7E A;  3B71 A;  4QDL A;  2KQ9 A;  3SZR A;  3WG7 C;  2J9B A;  2CW0 F;  2DUB A;  3Q7L A;  2KW3 C;  2PFD A;  2IXN A;  2XLE A;  3T8A A;  2EPL X;  2MYS A;  3W8H A;  2LCH A;  2VCA A;  4IAR A;  4KBL A;  4K3W A;  2XLW A;  2YWA A;  4NTB A;  4B6I A;  3AQC A;  3EZI A;  3DI5 A;  1BBH A;  3NRH A;  3NYL A;  2Y3B A;  5E33 A;  3VM6 A;  3UNG C;  2XLH A;  5HSW A;  3KH2 A;  4YJW A;  2NG1 A;  4G7H F;  1HE1 A;  1EA8 A;  2R7U A;  4AL0 A;  1EF8 A;  5A6K A;  3FDU A;  4UDV A;  3N0T A;  4FZW A;  2WL8 A;  3AG2 C;  3I4U A;  3M1C B;  4OLQ A;  3GM1 A;  1TWG A;  3N2Z B;  1NSG B;  1IW7 F;  3VAY A;  3BRJ A;  1NU9 C;  1Z3I X;  1LPE A;  4NC3 A;  2IXO A;  2XL4 A;  5DS5 A;  1UG7 A;  2XRH A;  3T88 A;  3RVY A;  4EHP A;  2HSQ A;  3GOR A;  2YKZ A;  4DVZ A;  3U3B A;  2NPU A;  4OG1 A;  3DZA A;  4WJ0 A;  5JBX A;  2FW2 A;  4Z9I A;  1ZU4 A;  3KMI A;  1VB5 A;  4PK4 A;  4GQH A;  4MI2 A;  2IXP A;  2BE5 F;  5A6J A;  1GM5 A;  4AX2 A;  5A6A A;  1J8Y F;  5KYY B;  3S9O A;  3AGU A;  3SP1 A;  3U5S A;  1LS1 A;  1FNT c;  3EH2 A;  2L6H A;  3DMD A;  1OQC A;  2C04 A;  3Q6N A;  4FAP B;  4ANJ A;  4JC7 A;  1OKK D;  3W2W A;  1U0B B;  4U5E E;  3RW0 A;  4ULW A;  1F1M A;  5E3A A;  3IEE A;  2G62 A;  2HZ8 A;  2LK4 A;  4E0H A;  2HJM A;  1ZZP A;  4ELW A;  4C7O A;  2TMV P;  2CNW D;  5CIV A;  1O3U A;  2L6F A;  3GWN A;  3SXK A;  1XWJ A;  4LLE A;  1EKY A;  3DAF A;  4MW8 A;  3O55 A;  2FGY A;  5COF A;  3ATP A;  3QVZ A;  4CS9 C;  4H4K C;  5L0G A;  1NBB A;  2NUP A;  3UMK A;  4XQ1 A;  1G4U S;  2P6V A;  4DOZ A;  3JSZ A;  4NCQ A;  2OKU A;  4U5B E;  1N1C A;  3EZH A;  3PCV A;  3KL4 A;  2ZXR A;  2RD9 A;  2ZXW C;  4O6Y A;  4AE4 A;  2B0J A;  1SZI A;  4BG0 A;  4W8K A;  2ETS A;  4PJJ A;  2Z15 A;  3JYH A;  2X51 A;  2R7R A;  3JTL O;  3SLL A;  4IRU A;  4ZLC A;  1YAU O;  4N6C A;  3V5X A;  4O6N A;  3RH3 A;  4NTF A;  2WVO A;  1OW8 A;  1TFO B;  2W45 A;  5C9G A;  1NG1 A;  2DI3 A;  2EIK C;  2HMQ A;  1BR4 A;  3FOP A;  2A68 F;  2ZXO A;  2J7P A;  4K0D A;  2GFH A;  2ICW G;  3JZ0 A;  2UUH A;  3OA1 A;  1A7D A;  4XEV A;  1A41 A;  1VLS A;  1WOL A;  4I44 A;  5COG A;  1TWH A;  5JS5 A;  2IM8 A;  4H54 A;  3U9M A;  1Z23 A;  5B3I A;  1E83 A;  3QXZ A;  5T3T A;  4YL0 A;  2HUJ A;  3RKO F;  2XS8 A;  2E87 A;  4JE9 A;  1YA7 O;  3CSK A;  3GAN A;  3ABK C;  1APC A;  1QLE C;  4JTD B;  3IHU A;  4NQF A;  1U6H A;  3IQC A;  2Q9A A;  4Q5S F;  3TJ6 A;  1OW7 A;  2P7V A;  3ZDL A;  3MLG A;  3Q0J A;  1T9K A;  1S05 A;  2P1A A;  4JCZ A;  4CJO A;  4JW1 A;  4N06 A;  1YYX A;  3G50 A;  4N4W A;  4FZW C;  3PDM P;  1A7V A;  3C63 A;  3SXM A;  2PBE A;  1LE4 A;  2XLV A;  3SNH A;  1Z7Q c;  2JX0 A;  3K6B A;  3HNJ A;  1OCR C;  1T5O A;  4BJ5 A;  4XLP F;  2PF4 E;  3UMH A;  3CAX A; 
#chains in the Genus database with same CATH homology
 4R32 A;  3C8G B;  3GM2 A;  3C18 A;  1JOG A;  3JZ0 A;  3O10 A;  2LK4 A;  3IRB A;  1KTM A;  4XEV A;  1OW6 A;  1ZZP A;  3L8I A;  3A4M A;  1WOL A;  1K05 A;  3ADC A;  2Q00 A;  2HSB A;  3GM1 A;  3GM3 A;  3W8H B;  1O3U A;  3K7D A;  3RQF A;  2L6F A;  4NNQ A;  1QVX A;  3AJM A;  3BRJ A;  2L6G A;  3RQE A;  3AM1 A;  1UX5 A;  1K04 A;  2P63 A;  4NQF A;  2JPU A;  3C8G A;  3JYY A;  1PV3 A;  1OW7 A;  4XEF A;  3MFN A;  5F28 E;  3L8J A;  1K40 A;  4XEK A;  1V4A A;  1UFB A;  3B71 A;  3ADD A;  1WTY A;  1Y64 B;  3TUL A;  4EBJ A;  2KK1 A;  2PBE A;  4EBK A;  3C8G D;  1RJM A;  2YWA A;  3U0C A;  1WWP A;  1KNY A;  2JX0 A;  1UX4 A;  3O4X E;  3W8I B;  3S9O A;  1OW8 A;  3RQG A;  4GEH B;  3ADB A;  3A4L A;  3A4N A;  3U3F A;  2L6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...