3RQEA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
190
Chain Sequence
b'TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 73
structure length 190
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqeA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqeA02
2L6FA 3RQEA 3C8GA 1K40A 1OW6A 1WOLA 2L6HA 2JX0A 3RQFA 3W8HB 4XEKA 3W8IB 3O10A 1WWPA 3TULA 1OW8A 5F28E 3GM2A 3AJMA 3B71A 3S9OA 3L8JA 1O3UA 1OW7A 1JOGA 3BRJA 3L8IA 1V4AA 2YWAA 3K7DA 3U3FA 1KTMA 2PBEA 4XEFA 1PV3A 4R32A 1K05A 3MFNA 3JZ0A 1KNYA 4NQFA 3GM1A 4XEVA 2LK4A 4GEHB 3GM3A 3C8GB 3RQGA 2KK1A 4EBJA 3U0CA 2L6GA 1K04A 3JYYA 2Q00A 1UFBA 4EBKA 1ZZPA 3C8GD 1WTYA 2HSBA 1QVXA 3C18A 2JPUA
chains in the Genus database with same CATH superfamily
3OC7A 2YEVA 4U5HA 1OCCC 4WCZA 3RYLA 3EQLF 1TQGA 1HZDA 4MVZA 4IB4A 2CGEA 4NQFA 3HKKA 4JOTA 1OCRC 2J0XA 3EFOA 2WZLA 3ZWIA 2HSBA 1OW8A 3ABKC 1Q0KA 1DUBA 5EGYA 4PJJA 2IXMA 4YT5A 3NMKA 1RJMA 2XRHA 4NNQA 1OR3A 1HW2A 4EWCA 4G0HA 1IW7F 4O79A 1NG1A 1G8XA 3GEEA 5L0HA 4DXWA 5KYWA 1ZHWA 2CCYA 3L1MA 5BQHA 4CIHA 1R4TA 4C7OA 2V3CC 2NUTB 1LIHA 3SYNA 3JYHA 1SR2A 2WZFA 2KC3A 1TWGA 2IOQA 4JCSA 4PR9A 1YDIA 2GWWA 5JS5A 3JCUQ 3FXHA 1EI7A 4HEAJ 1LI5A 1ORSC 3H2VA 2OG2A 1UX5A 4EKWA 1K05A 5L3VA 2EIMC 4XEVA 4G7OF 3TOMA 1G4WR 1T6QA 1KU2A 5KYYB 4CS8C 1OQCA 4YL3A 3CQZA 2GDCA 1OCOC 2Y39A 4OIPF 1D0ZA 2HSQA 2Q7RA 3C62A 3SLLA 3T8AA 2A0BA 2M64A 2EIJC 3HNLA 4NTFA 5JSLA 3WAQA 4JKVA 2R7SA 2LQGA 1LS4A 2PF4E 1N1CA 5B3IA 3I4UA 3UMKA 3W2WA 3G50A 3A9CA 4QI0A 2OEVA 2R05A 2EIKC 3M15A 4JC7A 2Q4FA 3KH2A 3H2UA 1TFKB 3V5YA 2WL8A 3DAFA 2YL1A 4BJTA 1VK5A 2B0HA 2X51A 3GWLA 3RSIA 4MW3A 2ZXPA 1JXZA 1WTYA 2FAPB 4XTKA 5DLJA 3KMIA 2CYDA 1A7EA 4EBBA 2MWQA 2VREA 1D1BA 1FNTc 2Q9BA 4E0HA 2ZD9A 5BUOA 4KI2A 1VYKA 1YVIA 3RFYA 5K0IA 1NLXA 2UZFA 3I47A 3IQTA 1RCPA 4FX5A 2XLHA 5L0CA 1TWAA 1LVKA 3TOLA 3EHNA 4GYTA 4BJ5C 3WHNA 2KK1A 3LEVA 3KPHA 1BZ4A 3SNHA 4EBKA 5DVWA 4MTGA 2OJQA 3QXIA 1M56C 3W8HB 3A4LA 2R7UA 2UUIA 1I4ZA 4ULVA 3IPMO 4DRJB 2W4BA 2Q00A 2HZ8A 4MS2A 1HMDA 3T4RA 1M6TA 5BQGA 3ZDLA 3K6BA 1SMYF 4BJ6C 3QTHA 4AL1A 2LSEA 3NG1A 4K3WA 4JURI 1HMOA 3AG2C 2J7PD 4W8PA 3RH3A 2J45A 5B1BC 4O6NA 3DE8A 1HW1A 1Y64B 1BDJB 2PP4A 1TKNA 4CJOA 2MHRA 4J30B 5DS6A 3EPVA 1CGME 4IZCA 2A0UA 3RQFA 3ADDA 1JR8A 2KYHA 1JPJA 1UX4A 3JSEO 2QE9A 4ULWA 2R7RA 4I52A 2DYSC 3E9VA 1QPUA 1A0BA 2HUJA 1DOWA 5A6BD 1QQ3A 3EH1A 1M2VA 3RIPA 4JIOA 4G78A 4PFOA 2P61A 1NU9C 4OINF 3T6JA 1KNYA 4HFKB 1DCIA 1RXQA 5JRAA 3ZSUA 4PACA 3G4ZA 2G62A 2OU6A 4MTOA 5F28E 2L7AA 1VB5A 5E33A 2CW0F 2LCHA 1WGWA 3LAYA 5GPGB 2Z15A 2XXAB 3C8ZA 2A68F 2J9BA 4AL0A 4RDAA 1ZHXA 2MYSA 2ZPAA 4JCHA 5L0GA 4ER9A 2JPUA 1K40A 4I4ZA 4G7HF 2R7OA 4FZWA 2F6QA 5JBWA 2NUPB 3AGUA 1CGNA 1VLSA 4EUKB 4U5CE 3AJMA 4O6MA 2PX3A 4CSAC 1ZU5A 3WG7C 1D0XA 2YHSA 3NYLA 1FAPB 2FGYA 1FMVA 2AWCA 3U9JA 5E2QA 2YQYA 4Z9HA 3KL4A 1ST6A 2XXAA 3ZQYA 2PFDA 4JJGA 5JLIA 4U5GA 1Q0FA 3DAGA 4MVSA 3F47A 3U5SA 1MQVA 1MMDA 4YT8A 4U9EA 5B3SC 4DRHB 4IARA 3FOPA 2ZXOA 1V55C 4CX9A 2NUPA 3GANA 1SYQA 3B71A 4CDYA 1FFTC 3HNIA 1TR2A 1EQ1A 3FMSA 5L0FA 3U3BA 4L6RA 2E87A 2ASRA 4CIPA 4JEAA 2A69F 3K7DA 2AP3A 3L0IA 3T6BA 5AC5A 2ZXRA 2HW5A 3S84A 3OEOA 1LE2A 3CEXA 5L0DA 2NSGA 1VMAA 2KNHA 5E3CA 1Q52A 1APCA 4CS9A 2BL2A 1W2WA 1ZVZA 2DB4A 4R32A 4C7OB 2KW3C 4N6CA 3RF3A 3OA1A 2F22A 3ABLC 4UDVA 2W4MA 3Q0GA 2C04A 1Z5ZA 1A41A 4JJFA 2YVKA 3JT1A 1OKKA 4LLEA 2XLDA 4DVZA 2YKZA 1BR1A 3RVYA 4KNVA 3TD7A 4E17A 3PZKA 1JAFA 2VCBA 1RJ9B 3VYWA 2XM4A 4NTAA 3G64A 2HJMA 3HNJA 2PBEA 3MFNA 4Q7CA 2ICWG 1ZU4A 4U5BE 2IM8A 3Q6NA 1ORJA 4O6YA 4YN0B 4H4KC 2VB6A 1CGOA 4CS7A 1YA7O 1LPEA 1M2OA 5JT4A 3EZIA 1FFHA 5DS5A 3ZIBA 5IY5C 1ZHTA 2O9XA 2R25A 3EGDA 1NFOA 5KJPA 3H65A 2DYRC 4ZU2A 4FJWD 4IRUA 4IJJA 4OIOF 4JWVA 3LNMB 1TWHA 1RJ9A 3TLFA 3DD7A 3W8IA 2VC9A 3ATPA 1L3PA 1I4YA 4WGYA 3S28A 2P6VA 4I42A 4JE9A 5AGFA 1RKCA 2VASA 3RQEA 4JZAA 3GORA 3T9OA 2IBFA 4O7GA 3ASNC 1RKEB 3ADCA 2J9VA 1EKYA 3JSZA 2J9UA 3I5QA 1WASA 2QTVA 4U18A 2OKUA 5T3TA 2DUBA 4DRIB 4BJ1A 1UG7A 2XS8A 3KYIA 2VCAA 4A4AA 2JD3A 4OIRF 4ANJA 3O39A 4G7ZF 4JW1A 4U9DA 1EF8A 3T88A 4BG0A 3S90A 3N24A 3KQFA 2I8BA 3MYFA 1V54C 2Y3BA 1C03A 2R7VA 3AG3C 4GEHB 3VRCA 3LEOA 4P9FA 2WZGA 1RKEA 4ZLCA 3Q6MA 3GODA 4XLPF 4MVOA 4YT2A 3HINA 1AUEA 3IRBA 2YLDA 3MOYA 3DMDA 3VM6A 4JTDB 2L81A 3RQGA 2R7WA 3DM5A 4K0DA 3IEEA 4J32B 2ZQRA 3UGPA 4EIYA 4AE4A 2KGOA 4I44A 1J8YF 4FZWC 1YAUO 3S27A 3U2MA 1ZHYA 2HMQA 5CI8A 1XZQA 5HV9A 1GS9A 4IGGA 2EPLX 3CAXA 4GEHA 5DQTA 4J7TA 1LKXA 2H7BA 2YL0A 3K66A 3FHDA 4OLQA 3FOOA 3V7OA 1EF9A 4BEJA 2JX0A 1YZAA 5EK0A 3QW1A 3L8IA 3U3FA 3DM9B 1LI7A 2FW2A 4JTCB 2AU5A 2PX0A 3NKDA 4QIIA 1ZW2A 2OOCA 3LESA 3MYBA 2L9JA 1T6IA 2R02A 4I1OB 1M2VB 3UMIA 3A11A 3RKOF 2QQ3A 1BR2A 5JP7A 3I5PA 1HY5A 256BA 3FVYA 3JTLO 3LUTB 5T1DB 2NSFA 2W45A 2XM0A 2VH3A 3A4MA 4XQ1A 1OXBA 2EINC 3AG4C 1JMWA 1I5NA 3BRJA 1QKRA 3VF0A 2IXNA 4CJGA 3PCVA 1SF8A 3U9MA 2XLEA 1QSPA 4CS9C 3SEOA 2EJ5A 1LS1A 2J0WA 3DZAA 1SZIA 4MQ9F 1O3UA 4OD4A 2I15A 3V5XA 5KYUB 2Y3HA 3N0TA 1UIYA 5KYXB 4YL0A 1EY3A 4H54A 2LFDA 3FDUA 1CPQA 4NC3A 1LM3B 2Q9AA 3QZCA 4FWVA 3PDMP 1Y6DA 4PJNA 3LNRA 5D92A 1YJGA 4IZBA 4JVSA 4E18A 4MTFA 4DBQA 2UUHA 1OKKD 1WATA 2PPYA 4CDVA 1Y4CA 2Q3TA 1OW7A 3C7JA 4QI2A 2WVOA 1PV3A 3LLIA 2R7QA 3HJCA 3M1CB 2ETSA 2WVQA 5KYUA 5A6KA 2A6HF 2HFIA 3DWWA 4FAPB 4KNWA 3AQCA 5L3QA 1J8MF 4J7YA 2J9WA 5KYXA 1D1AA 4IWBA 5T3WA 4PK4A 1XWJA 5E3AA 5L0IA 3K1IA 3R2PA 3ECSA 3SXYA 3GM1A 4OG1A 3EHMA 1OXKA 4RBNA 3SXMA 3EGXB 2EILC 2Y3GA 1YA9A 1E84A 3MX3A 2D5RB 4OIQF 2EPOA 3R0OA 3GEIA 3M79A 3P5MA 2EPMX 1FR0A 2XL6A 1OR2A 3RVZA 4P9TA 1MMAA 4HE8D 1Q51A 4I1MA 4XPXA 2GFHA 2YLIA 1O5HA 4C3BA 3ZQVA 1AEPA 4P6IC 2PNOA 1OW6A 3GEHA 2J7PA 3JRMO 3QK8A 1FMWA 1GQAA 5JUAA 4K1OA 4MNDA 4W8KA 2LIGA 2YZSA 2WB7A 3HRXA 4QIJA 1TFOB 3QMKA 3R9SA 5EHHA 3VAYA 3MYIA 1HE9A 1Q0GA 2KJGA 3B9QA 3T6GB 3EGXA 3EJNA 1E85A 2C03A 4FESA 2HJ3A 3C63A 2IYLD 2FFHA 3ITFA 4F4BA 1E2XA 2XSEA 3L34A 4Z9IA 1XZPA 4WGZA 4YL1A 3QVZA 3EH2A 5A6BA 2XL8A 1H7IA 4A2NB 1D0YA 1WN0A 4IZDA 2A6EF 3C8GB 3FAJA 1C02A 2H8AA 3AOUA 2IXOA 2LP4A 3BEHA 2X0CA 2A1DD 3O10A 4YWQA 3EGDB 3NMJA 1JPNA 3DE9A 4IAQA 3POVA 3H02A 3N2ZB 1U89A 3B29A 3MBGA 3U0CA 1NZEA 1UFBA 1PCXA 4GQHA 2AVKA 4QDLA 5COGA 4NCQA 3AQBA 1RJNA 5A6AA 1U0BB 3W8IB 1YZCA 2VCCA 4WABA 2TMVP 3QXZA 2CNWA 1YARO 1ZHZA 2HMZA 3TQOA 4ELXA 1HE1A 1A7VA 4Q4ZF 3ASOC 2YRFA 3C8GA 3ZG1A 3B0VC 3SZRA 4C3DA 4JYLA 3TULA 4N4WA 2OJED 4PJMA 5BQIA 3B0UX 2LD6A 3ZVRA 3IHUA 4I3MA 3V5ZA 3NMIA 3S0XA 1Z63A 1QLEC 4XLNF 1RMVA 4DBRA 3X2QC 2BE5F 1YYXA 3DI5A 3SWXA 2QNLA 4CSAA 4NTBA 4LDKA 3GWNA 4E7ZA 2B0JA 4IAOA 3M4CA 4RD9A 1QVXA 4U5DE 2OQMA 3IQ5A 3SXZA 5F5FA 2WVNA 1PD0A 5JVEA 3MLGA 3UR3C 1O87A 2V26A 1H9TA 2XL4A 1YLMA 1T5OA 4NEKA 1S05A 3NYMA 3W2VA 1ZW3A 3W4YA 3ABMC 2OCCC 4HFFB 3TK0A 3L8JA 2NUTA 1Q0DA 4AE4B 1MMNA 2YL7A 4JFCA 5KYNA 1LE4A 1NU7D 3CSKA 5FCLA 2KQ9A 2Q9CA 1T9KA 2J8WA 4JRZA 5FZTA 2G3KA 4MVRA 3NDBB 4U1AA 2RD9A 4MVUA 2OEXA 2VX2A 2G3VA 3U2LA 3A4NA 3PHF2 2L6FA 4E7SA 2GTRA 5L0JA 4MVMA 1Z7Qc 4D4XA 5KYYA 1VTMP 4N06A 3LS1A 1GGQA 3F46A 4MOUA 3NKEA 2XLOA 1Z3IX 3EG9B 2DGJA 1VYIA 3X1OA 2P63A 1ORYA 1WOLA 1Q0MA 2H7OA 3TJ6A 1JOGA 2BC5A 4U5EE 3O4XE 3NYJA 3WODF 2KSFA 2YL3A 3O55A 1H6GA 1NBBA 4AK9A 2P1AA 2R7TA 2XLWA 5TJ5E 3K1IC 5AC4A 1MNEA 3E70C 1BBHA 1V4AA 3AM1A 3H81A 4K2NA 4XEFA 1H9GA 4DOZA 1YYJA 1L7CA 3LS0A 3PMRA 4M63A 2P7VA 3DJUB 1Z6AA 1M57C 1ZZPA 3FDQA 2CDQA 1A7DA 2GAQA 2H7VC 2EPNA 1EA8A 2RSEB 3EG9A 3O6XA 2XLVA 2QY9A 4NY3A 2ZXWC 1S7ZA 4WJ0A 2HV6A 3UMHA 4DJ9A 2AWYA 3M4BA 1U6HA 4LACB 1QZXA 1AVOB 3DXJF 2YWAA 3TRRA 2QLAA 4AX2A 4U5FE 3UGOA 3JZ0A 3IQCA 2Y69C 3Q7LA 1TWCA 2EPKX 5CI9A 1T01A 4ELWA 4C3EA 3GM2A 3ZC4A 4CS8A 3KKBA 3W8HA 1G5ZA 1FTSA 1G4US 2LK4A 2GA0A 4EBJA 2W9YA 4OD5A 4JEBA 4KC9A 5F5HA 1V74B 3KYJA 4ELSA 3K33A 2R7XA 4PFPA 4D4NA 4YT4A 2IEXA 2P0NA 1NZYB 4EHPA 1PD1A 1K04A 1VOMA 3R7CA 2HS5A 1IZMA 3B0PA 2M4EA 4JCZA 3Q0JA 2L6HA 3T89A 1B68A 1Z23A 5A69A 4K7BA 3R9TA 4LDQA 4JTAB 5DQZA 4Q5SF 1BR4A 4XPYA 2L6GA 3AGTA 1GM5A 3ZTMA 5B1AC 4Z9JA 3US6A 4F47A 3J06A 3UNGC 5DS4A 4BEMJ 4LLCA 4PJLA 4YJWA 2Y3DA 1OCZC 4N6HA 5C9GA 3CZ6A 3HTKC 5JBXA 1NZYA 3ADBA 3K1HA 2R9RB 2QUPA 1NSGB 5COMA 4BPMA 4MVQA 2CNWD 1KTMA 2XLMA 3HLZA 3LLKA 2HV7A 3DKAA 4BJ5A 3TJ5A 5COFA 3EZHA 3IQ6A 3JRTA 3JYYA 2LFFA 3C8GD 2D4UA 3QVYA 1JRAA 1E83A 4ZLDA 3U8PA 3Q7GA 3G4XA 1WZ8A 4KNPA 2FBMA 4E0IA 1T6UA 3GM3A 3LJBA 3SP1A 3C18A 1E86A 1ZYRF 3U8VA 4XEKA 2YLGA 4CDAA 3OWTA 1MJ3A 2XS1A 4CBEA 4EMLA 4MW8A 3HNKA 1C17M 4BJ6A 4XPWA 1R5ID 1D1CA 3QW0A 3S29A 3SXKA 4ONSA 4U19A 4KBLA 5D91A 1WWPA 3NRHA 3EFOB 2DI3A 3FAPB 2IXPA 2NG1A 4DVYP 3AG1C 1CPRA 4YK5A 5CIVA 4XWJA 2ZQQA 3DJNB 3ZTZA 1VLTA 4MI2A 4LERA 4LDRA 2HKVA 3S9OA 2NPUA 4B6IA 1DOVA 2J46A 1MNDA 4X0RA 1MMGA 5HSWA 2PBPA 1F1MA 3Q1TA 5A6JA 1NFNA 5KYWB 2R03A 3RW0A
chains in the Genus database with same CATH topology
1K40A 1OW6A 1UX5A 2JX0A 3W8IB 3L8JA 3K7DA 3L8IA 1V4AA 3U3FA 3AM1A 4XEFA 1K05A 1Y64B 4NQFA 4XEVA 4GEHB 3GM3A 1K04A 1ZZPA 2HSBA 3C18A 3C8GA 2L6HA 3RQFA 4XEKA 3ADDA 3TULA 1OW8A 3AJMA 1OW7A 3IRBA 1PV3A 1UX4A 4R32A 1RJMA 4NNQA 3RQGA 2KK1A 2L6GA 4EBKA 3A4NA 3A4MA 2L6FA 3RQEA 3W8HB 3A4LA 1WWPA 3BRJA 2YWAA 3ADCA 3JZ0A 1KNYA 3GM1A 3C8GB 2Q00A 3O10A 1QVXA 2P63A 1WOLA 3ADBA 5F28E 3GM2A 3B71A 3S9OA 1O3UA 1JOGA 1KTMA 2PBEA 3O4XE 3MFNA 2LK4A 4EBJA 3U0CA 3JYYA 1UFBA 3C8GD 1WTYA 2JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6F A;  3RQE A;  3C8G A;  1K40 A;  1OW6 A;  1WOL A;  2L6H A;  2JX0 A;  3RQF A;  3W8H B;  4XEK A;  3W8I B;  3O10 A;  1WWP A;  3TUL A;  1OW8 A;  5F28 E;  3GM2 A;  3AJM A;  3B71 A;  3S9O A;  3L8J A;  1O3U A;  1OW7 A;  1JOG A;  3BRJ A;  3L8I A;  1V4A A;  2YWA A;  3K7D A;  3U3F A;  1KTM A;  2PBE A;  4XEF A;  1PV3 A;  4R32 A;  1K05 A;  3MFN A;  3JZ0 A;  1KNY A;  4NQF A;  3GM1 A;  4XEV A;  2LK4 A;  4GEH B;  3GM3 A;  3C8G B;  3RQG A;  2KK1 A;  4EBJ A;  3U0C A;  2L6G A;  1K04 A;  3JYY A;  2Q00 A;  1UFB A;  4EBK A;  1ZZP A;  3C8G D;  1WTY A;  2HSB A;  1QVX A;  3C18 A;  2JPU A; 
#chains in the Genus database with same CATH topology
 3OC7 A;  2YEV A;  4U5H A;  1OCC C;  4WCZ A;  3RYL A;  3EQL F;  1TQG A;  1HZD A;  4MVZ A;  4IB4 A;  2CGE A;  4NQF A;  3HKK A;  4JOT A;  1OCR C;  2J0X A;  3EFO A;  2WZL A;  3ZWI A;  2HSB A;  1OW8 A;  3ABK C;  1Q0K A;  1DUB A;  5EGY A;  4PJJ A;  2IXM A;  4YT5 A;  3NMK A;  1RJM A;  2XRH A;  4NNQ A;  1OR3 A;  1HW2 A;  4EWC A;  4G0H A;  1IW7 F;  4O79 A;  1NG1 A;  1G8X A;  3GEE A;  5L0H A;  4DXW A;  5KYW A;  1ZHW A;  2CCY A;  3L1M A;  5BQH A;  4CIH A;  1R4T A;  4C7O A;  2V3C C;  2NUT B;  1LIH A;  3SYN A;  3JYH A;  1SR2 A;  2WZF A;  2KC3 A;  1TWG A;  2IOQ A;  4JCS A;  4PR9 A;  1YDI A;  2GWW A;  5JS5 A;  3JCU Q;  3FXH A;  1EI7 A;  4HEA J;  1LI5 A;  1ORS C;  3H2V A;  2OG2 A;  1UX5 A;  4EKW A;  1K05 A;  5L3V A;  2EIM C;  4XEV A;  4G7O F;  3TOM A;  1G4W R;  1T6Q A;  1KU2 A;  5KYY B;  4CS8 C;  1OQC A;  4YL3 A;  3CQZ A;  2GDC A;  1OCO C;  2Y39 A;  4OIP F;  1D0Z A;  2HSQ A;  2Q7R A;  3C62 A;  3SLL A;  3T8A A;  2A0B A;  2M64 A;  2EIJ C;  3HNL A;  4NTF A;  5JSL A;  3WAQ A;  4JKV A;  2R7S A;  2LQG A;  1LS4 A;  2PF4 E;  1N1C A;  5B3I A;  3I4U A;  3UMK A;  3W2W A;  3G50 A;  3A9C A;  4QI0 A;  2OEV A;  2R05 A;  2EIK C;  3M15 A;  4JC7 A;  2Q4F A;  3KH2 A;  3H2U A;  1TFK B;  3V5Y A;  2WL8 A;  3DAF A;  2YL1 A;  4BJT A;  1VK5 A;  2B0H A;  2X51 A;  3GWL A;  3RSI A;  4MW3 A;  2ZXP A;  1JXZ A;  1WTY A;  2FAP B;  4XTK A;  5DLJ A;  3KMI A;  2CYD A;  1A7E A;  4EBB A;  2MWQ A;  2VRE A;  1D1B A;  1FNT c;  2Q9B A;  4E0H A;  2ZD9 A;  5BUO A;  4KI2 A;  1VYK A;  1YVI A;  3RFY A;  5K0I A;  1NLX A;  2UZF A;  3I47 A;  3IQT A;  1RCP A;  4FX5 A;  2XLH A;  5L0C A;  1TWA A;  1LVK A;  3TOL A;  3EHN A;  4GYT A;  4BJ5 C;  3WHN A;  2KK1 A;  3LEV A;  3KPH A;  1BZ4 A;  3SNH A;  4EBK A;  5DVW A;  4MTG A;  2OJQ A;  3QXI A;  1M56 C;  3W8H B;  3A4L A;  2R7U A;  2UUI A;  1I4Z A;  4ULV A;  3IPM O;  4DRJ B;  2W4B A;  2Q00 A;  2HZ8 A;  4MS2 A;  1HMD A;  3T4R A;  1M6T A;  5BQG A;  3ZDL A;  3K6B A;  1SMY F;  4BJ6 C;  3QTH A;  4AL1 A;  2LSE A;  3NG1 A;  4K3W A;  4JUR I;  1HMO A;  3AG2 C;  2J7P D;  4W8P A;  3RH3 A;  2J45 A;  5B1B C;  4O6N A;  3DE8 A;  1HW1 A;  1Y64 B;  1BDJ B;  2PP4 A;  1TKN A;  4CJO A;  2MHR A;  4J30 B;  5DS6 A;  3EPV A;  1CGM E;  4IZC A;  2A0U A;  3RQF A;  3ADD A;  1JR8 A;  2KYH A;  1JPJ A;  1UX4 A;  3JSE O;  2QE9 A;  4ULW A;  2R7R A;  4I52 A;  2DYS C;  3E9V A;  1QPU A;  1A0B A;  2HUJ A;  1DOW A;  5A6B D;  1QQ3 A;  3EH1 A;  1M2V A;  3RIP A;  4JIO A;  4G78 A;  4PFO A;  2P61 A;  1NU9 C;  4OIN F;  3T6J A;  1KNY A;  4HFK B;  1DCI A;  1RXQ A;  5JRA A;  3ZSU A;  4PAC A;  3G4Z A;  2G62 A;  2OU6 A;  4MTO A;  5F28 E;  2L7A A;  1VB5 A;  5E33 A;  2CW0 F;  2LCH A;  1WGW A;  3LAY A;  5GPG B;  2Z15 A;  2XXA B;  3C8Z A;  2A68 F;  2J9B A;  4AL0 A;  4RDA A;  1ZHX A;  2MYS A;  2ZPA A;  4JCH A;  5L0G A;  4ER9 A;  2JPU A;  1K40 A;  4I4Z A;  4G7H F;  2R7O A;  4FZW A;  2F6Q A;  5JBW A;  2NUP B;  3AGU A;  1CGN A;  1VLS A;  4EUK B;  4U5C E;  3AJM A;  4O6M A;  2PX3 A;  4CSA C;  1ZU5 A;  3WG7 C;  1D0X A;  2YHS A;  3NYL A;  1FAP B;  2FGY A;  1FMV A;  2AWC A;  3U9J A;  5E2Q A;  2YQY A;  4Z9H A;  3KL4 A;  1ST6 A;  2XXA A;  3ZQY A;  2PFD A;  4JJG A;  5JLI A;  4U5G A;  1Q0F A;  3DAG A;  4MVS A;  3F47 A;  3U5S A;  1MQV A;  1MMD A;  4YT8 A;  4U9E A;  5B3S C;  4DRH B;  4IAR A;  3FOP A;  2ZXO A;  1V55 C;  4CX9 A;  2NUP A;  3GAN A;  1SYQ A;  3B71 A;  4CDY A;  1FFT C;  3HNI A;  1TR2 A;  1EQ1 A;  3FMS A;  5L0F A;  3U3B A;  4L6R A;  2E87 A;  2ASR A;  4CIP A;  4JEA A;  2A69 F;  3K7D A;  2AP3 A;  3L0I A;  3T6B A;  5AC5 A;  2ZXR A;  2HW5 A;  3S84 A;  3OEO A;  1LE2 A;  3CEX A;  5L0D A;  2NSG A;  1VMA A;  2KNH A;  5E3C A;  1Q52 A;  1APC A;  4CS9 A;  2BL2 A;  1W2W A;  1ZVZ A;  2DB4 A;  4R32 A;  4C7O B;  2KW3 C;  4N6C A;  3RF3 A;  3OA1 A;  2F22 A;  3ABL C;  4UDV A;  2W4M A;  3Q0G A;  2C04 A;  1Z5Z A;  1A41 A;  4JJF A;  2YVK A;  3JT1 A;  1OKK A;  4LLE A;  2XLD A;  4DVZ A;  2YKZ A;  1BR1 A;  3RVY A;  4KNV A;  3TD7 A;  4E17 A;  3PZK A;  1JAF A;  2VCB A;  1RJ9 B;  3VYW A;  2XM4 A;  4NTA A;  3G64 A;  2HJM A;  3HNJ A;  2PBE A;  3MFN A;  4Q7C A;  2ICW G;  1ZU4 A;  4U5B E;  2IM8 A;  3Q6N A;  1ORJ A;  4O6Y A;  4YN0 B;  4H4K C;  2VB6 A;  1CGO A;  4CS7 A;  1YA7 O;  1LPE A;  1M2O A;  5JT4 A;  3EZI A;  1FFH A;  5DS5 A;  3ZIB A;  5IY5 C;  1ZHT A;  2O9X A;  2R25 A;  3EGD A;  1NFO A;  5KJP A;  3H65 A;  2DYR C;  4ZU2 A;  4FJW D;  4IRU A;  4IJJ A;  4OIO F;  4JWV A;  3LNM B;  1TWH A;  1RJ9 A;  3TLF A;  3DD7 A;  3W8I A;  2VC9 A;  3ATP A;  1L3P A;  1I4Y A;  4WGY A;  3S28 A;  2P6V A;  4I42 A;  4JE9 A;  5AGF A;  1RKC A;  2VAS A;  3RQE A;  4JZA A;  3GOR A;  3T9O A;  2IBF A;  4O7G A;  3ASN C;  1RKE B;  3ADC A;  2J9V A;  1EKY A;  3JSZ A;  2J9U A;  3I5Q A;  1WAS A;  2QTV A;  4U18 A;  2OKU A;  5T3T A;  2DUB A;  4DRI B;  4BJ1 A;  1UG7 A;  2XS8 A;  3KYI A;  2VCA A;  4A4A A;  2JD3 A;  4OIR F;  4ANJ A;  3O39 A;  4G7Z F;  4JW1 A;  4U9D A;  1EF8 A;  3T88 A;  4BG0 A;  3S90 A;  3N24 A;  3KQF A;  2I8B A;  3MYF A;  1V54 C;  2Y3B A;  1C03 A;  2R7V A;  3AG3 C;  4GEH B;  3VRC A;  3LEO A;  4P9F A;  2WZG A;  1RKE A;  4ZLC A;  3Q6M A;  3GOD A;  4XLP F;  4MVO A;  4YT2 A;  3HIN A;  1AUE A;  3IRB A;  2YLD A;  3MOY A;  3DMD A;  3VM6 A;  4JTD B;  2L81 A;  3RQG A;  2R7W A;  3DM5 A;  4K0D A;  3IEE A;  4J32 B;  2ZQR A;  3UGP A;  4EIY A;  4AE4 A;  2KGO A;  4I44 A;  1J8Y F;  4FZW C;  1YAU O;  3S27 A;  3U2M A;  1ZHY A;  2HMQ A;  5CI8 A;  1XZQ A;  5HV9 A;  1GS9 A;  4IGG A;  2EPL X;  3CAX A;  4GEH A;  5DQT A;  4J7T A;  1LKX A;  2H7B A;  2YL0 A;  3K66 A;  3FHD A;  4OLQ A;  3FOO A;  3V7O A;  1EF9 A;  4BEJ A;  2JX0 A;  1YZA A;  5EK0 A;  3QW1 A;  3L8I A;  3U3F A;  3DM9 B;  1LI7 A;  2FW2 A;  4JTC B;  2AU5 A;  2PX0 A;  3NKD A;  4QII A;  1ZW2 A;  2OOC A;  3LES A;  3MYB A;  2L9J A;  1T6I A;  2R02 A;  4I1O B;  1M2V B;  3UMI A;  3A11 A;  3RKO F;  2QQ3 A;  1BR2 A;  5JP7 A;  3I5P A;  1HY5 A;  256B A;  3FVY A;  3JTL O;  3LUT B;  5T1D B;  2NSF A;  2W45 A;  2XM0 A;  2VH3 A;  3A4M A;  4XQ1 A;  1OXB A;  2EIN C;  3AG4 C;  1JMW A;  1I5N A;  3BRJ A;  1QKR A;  3VF0 A;  2IXN A;  4CJG A;  3PCV A;  1SF8 A;  3U9M A;  2XLE A;  1QSP A;  4CS9 C;  3SEO A;  2EJ5 A;  1LS1 A;  2J0W A;  3DZA A;  1SZI A;  4MQ9 F;  1O3U A;  4OD4 A;  2I15 A;  3V5X A;  5KYU B;  2Y3H A;  3N0T A;  1UIY A;  5KYX B;  4YL0 A;  1EY3 A;  4H54 A;  2LFD A;  3FDU A;  1CPQ A;  4NC3 A;  1LM3 B;  2Q9A A;  3QZC A;  4FWV A;  3PDM P;  1Y6D A;  4PJN A;  3LNR A;  5D92 A;  1YJG A;  4IZB A;  4JVS A;  4E18 A;  4MTF A;  4DBQ A;  2UUH A;  1OKK D;  1WAT A;  2PPY A;  4CDV A;  1Y4C A;  2Q3T A;  1OW7 A;  3C7J A;  4QI2 A;  2WVO A;  1PV3 A;  3LLI A;  2R7Q A;  3HJC A;  3M1C B;  2ETS A;  2WVQ A;  5KYU A;  5A6K A;  2A6H F;  2HFI A;  3DWW A;  4FAP B;  4KNW A;  3AQC A;  5L3Q A;  1J8M F;  4J7Y A;  2J9W A;  5KYX A;  1D1A A;  4IWB A;  5T3W A;  4PK4 A;  1XWJ A;  5E3A A;  5L0I A;  3K1I A;  3R2P A;  3ECS A;  3SXY A;  3GM1 A;  4OG1 A;  3EHM A;  1OXK A;  4RBN A;  3SXM A;  3EGX B;  2EIL C;  2Y3G A;  1YA9 A;  1E84 A;  3MX3 A;  2D5R B;  4OIQ F;  2EPO A;  3R0O A;  3GEI A;  3M79 A;  3P5M A;  2EPM X;  1FR0 A;  2XL6 A;  1OR2 A;  3RVZ A;  4P9T A;  1MMA A;  4HE8 D;  1Q51 A;  4I1M A;  4XPX A;  2GFH A;  2YLI A;  1O5H A;  4C3B A;  3ZQV A;  1AEP A;  4P6I C;  2PNO A;  1OW6 A;  3GEH A;  2J7P A;  3JRM O;  3QK8 A;  1FMW A;  1GQA A;  5JUA A;  4K1O A;  4MND A;  4W8K A;  2LIG A;  2YZS A;  2WB7 A;  3HRX A;  4QIJ A;  1TFO B;  3QMK A;  3R9S A;  5EHH A;  3VAY A;  3MYI A;  1HE9 A;  1Q0G A;  2KJG A;  3B9Q A;  3T6G B;  3EGX A;  3EJN A;  1E85 A;  2C03 A;  4FES A;  2HJ3 A;  3C63 A;  2IYL D;  2FFH A;  3ITF A;  4F4B A;  1E2X A;  2XSE A;  3L34 A;  4Z9I A;  1XZP A;  4WGZ A;  4YL1 A;  3QVZ A;  3EH2 A;  5A6B A;  2XL8 A;  1H7I A;  4A2N B;  1D0Y A;  1WN0 A;  4IZD A;  2A6E F;  3C8G B;  3FAJ A;  1C02 A;  2H8A A;  3AOU A;  2IXO A;  2LP4 A;  3BEH A;  2X0C A;  2A1D D;  3O10 A;  4YWQ A;  3EGD B;  3NMJ A;  1JPN A;  3DE9 A;  4IAQ A;  3POV A;  3H02 A;  3N2Z B;  1U89 A;  3B29 A;  3MBG A;  3U0C A;  1NZE A;  1UFB A;  1PCX A;  4GQH A;  2AVK A;  4QDL A;  5COG A;  4NCQ A;  3AQB A;  1RJN A;  5A6A A;  1U0B B;  3W8I B;  1YZC A;  2VCC A;  4WAB A;  2TMV P;  3QXZ A;  2CNW A;  1YAR O;  1ZHZ A;  2HMZ A;  3TQO A;  4ELX A;  1HE1 A;  1A7V A;  4Q4Z F;  3ASO C;  2YRF A;  3C8G A;  3ZG1 A;  3B0V C;  3SZR A;  4C3D A;  4JYL A;  3TUL A;  4N4W A;  2OJE D;  4PJM A;  5BQI A;  3B0U X;  2LD6 A;  3ZVR A;  3IHU A;  4I3M A;  3V5Z A;  3NMI A;  3S0X A;  1Z63 A;  1QLE C;  4XLN F;  1RMV A;  4DBR A;  3X2Q C;  2BE5 F;  1YYX A;  3DI5 A;  3SWX A;  2QNL A;  4CSA A;  4NTB A;  4LDK A;  3GWN A;  4E7Z A;  2B0J A;  4IAO A;  3M4C A;  4RD9 A;  1QVX A;  4U5D E;  2OQM A;  3IQ5 A;  3SXZ A;  5F5F A;  2WVN A;  1PD0 A;  5JVE A;  3MLG A;  3UR3 C;  1O87 A;  2V26 A;  1H9T A;  2XL4 A;  1YLM A;  1T5O A;  4NEK A;  1S05 A;  3NYM A;  3W2V A;  1ZW3 A;  3W4Y A;  3ABM C;  2OCC C;  4HFF B;  3TK0 A;  3L8J A;  2NUT A;  1Q0D A;  4AE4 B;  1MMN A;  2YL7 A;  4JFC A;  5KYN A;  1LE4 A;  1NU7 D;  3CSK A;  5FCL A;  2KQ9 A;  2Q9C A;  1T9K A;  2J8W A;  4JRZ A;  5FZT A;  2G3K A;  4MVR A;  3NDB B;  4U1A A;  2RD9 A;  4MVU A;  2OEX A;  2VX2 A;  2G3V A;  3U2L A;  3A4N A;  3PHF 2;  2L6F A;  4E7S A;  2GTR A;  5L0J A;  4MVM A;  1Z7Q c;  4D4X A;  5KYY A;  1VTM P;  4N06 A;  3LS1 A;  1GGQ A;  3F46 A;  4MOU A;  3NKE A;  2XLO A;  1Z3I X;  3EG9 B;  2DGJ A;  1VYI A;  3X1O A;  2P63 A;  1ORY A;  1WOL A;  1Q0M A;  2H7O A;  3TJ6 A;  1JOG A;  2BC5 A;  4U5E E;  3O4X E;  3NYJ A;  3WOD F;  2KSF A;  2YL3 A;  3O55 A;  1H6G A;  1NBB A;  4AK9 A;  2P1A A;  2R7T A;  2XLW A;  5TJ5 E;  3K1I C;  5AC4 A;  1MNE A;  3E70 C;  1BBH A;  1V4A A;  3AM1 A;  3H81 A;  4K2N A;  4XEF A;  1H9G A;  4DOZ A;  1YYJ A;  1L7C A;  3LS0 A;  3PMR A;  4M63 A;  2P7V A;  3DJU B;  1Z6A A;  1M57 C;  1ZZP A;  3FDQ A;  2CDQ A;  1A7D A;  2GAQ A;  2H7V C;  2EPN A;  1EA8 A;  2RSE B;  3EG9 A;  3O6X A;  2XLV A;  2QY9 A;  4NY3 A;  2ZXW C;  1S7Z A;  4WJ0 A;  2HV6 A;  3UMH A;  4DJ9 A;  2AWY A;  3M4B A;  1U6H A;  4LAC B;  1QZX A;  1AVO B;  3DXJ F;  2YWA A;  3TRR A;  2QLA A;  4AX2 A;  4U5F E;  3UGO A;  3JZ0 A;  3IQC A;  2Y69 C;  3Q7L A;  1TWC A;  2EPK X;  5CI9 A;  1T01 A;  4ELW A;  4C3E A;  3GM2 A;  3ZC4 A;  4CS8 A;  3KKB A;  3W8H A;  1G5Z A;  1FTS A;  1G4U S;  2LK4 A;  2GA0 A;  4EBJ A;  2W9Y A;  4OD5 A;  4JEB A;  4KC9 A;  5F5H A;  1V74 B;  3KYJ A;  4ELS A;  3K33 A;  2R7X A;  4PFP A;  4D4N A;  4YT4 A;  2IEX A;  2P0N A;  1NZY B;  4EHP A;  1PD1 A;  1K04 A;  1VOM A;  3R7C A;  2HS5 A;  1IZM A;  3B0P A;  2M4E A;  4JCZ A;  3Q0J A;  2L6H A;  3T89 A;  1B68 A;  1Z23 A;  5A69 A;  4K7B A;  3R9T A;  4LDQ A;  4JTA B;  5DQZ A;  4Q5S F;  1BR4 A;  4XPY A;  2L6G A;  3AGT A;  1GM5 A;  3ZTM A;  5B1A C;  4Z9J A;  3US6 A;  4F47 A;  3J06 A;  3UNG C;  5DS4 A;  4BEM J;  4LLC A;  4PJL A;  4YJW A;  2Y3D A;  1OCZ C;  4N6H A;  5C9G A;  3CZ6 A;  3HTK C;  5JBX A;  1NZY A;  3ADB A;  3K1H A;  2R9R B;  2QUP A;  1NSG B;  5COM A;  4BPM A;  4MVQ A;  2CNW D;  1KTM A;  2XLM A;  3HLZ A;  3LLK A;  2HV7 A;  3DKA A;  4BJ5 A;  3TJ5 A;  5COF A;  3EZH A;  3IQ6 A;  3JRT A;  3JYY A;  2LFF A;  3C8G D;  2D4U A;  3QVY A;  1JRA A;  1E83 A;  4ZLD A;  3U8P A;  3Q7G A;  3G4X A;  1WZ8 A;  4KNP A;  2FBM A;  4E0I A;  1T6U A;  3GM3 A;  3LJB A;  3SP1 A;  3C18 A;  1E86 A;  1ZYR F;  3U8V A;  4XEK A;  2YLG A;  4CDA A;  3OWT A;  1MJ3 A;  2XS1 A;  4CBE A;  4EML A;  4MW8 A;  3HNK A;  1C17 M;  4BJ6 A;  4XPW A;  1R5I D;  1D1C A;  3QW0 A;  3S29 A;  3SXK A;  4ONS A;  4U19 A;  4KBL A;  5D91 A;  1WWP A;  3NRH A;  3EFO B;  2DI3 A;  3FAP B;  2IXP A;  2NG1 A;  4DVY P;  3AG1 C;  1CPR A;  4YK5 A;  5CIV A;  4XWJ A;  2ZQQ A;  3DJN B;  3ZTZ A;  1VLT A;  4MI2 A;  4LER A;  4LDR A;  2HKV A;  3S9O A;  2NPU A;  4B6I A;  1DOV A;  2J46 A;  1MND A;  4X0R A;  1MMG A;  5HSW A;  2PBP A;  1F1M A;  3Q1T A;  5A6J A;  1NFN A;  5KYW B;  2R03 A;  3RW0 A; 
#chains in the Genus database with same CATH homology
 1K40 A;  1OW6 A;  1UX5 A;  2JX0 A;  3W8I B;  3L8J A;  3K7D A;  3L8I A;  1V4A A;  3U3F A;  3AM1 A;  4XEF A;  1K05 A;  1Y64 B;  4NQF A;  4XEV A;  4GEH B;  3GM3 A;  1K04 A;  1ZZP A;  2HSB A;  3C18 A;  3C8G A;  2L6H A;  3RQF A;  4XEK A;  3ADD A;  3TUL A;  1OW8 A;  3AJM A;  1OW7 A;  3IRB A;  1PV3 A;  1UX4 A;  4R32 A;  1RJM A;  4NNQ A;  3RQG A;  2KK1 A;  2L6G A;  4EBK A;  3A4N A;  3A4M A;  2L6F A;  3RQE A;  3W8H B;  3A4L A;  1WWP A;  3BRJ A;  2YWA A;  3ADC A;  3JZ0 A;  1KNY A;  3GM1 A;  3C8G B;  2Q00 A;  3O10 A;  1QVX A;  2P63 A;  1WOL A;  3ADB A;  5F28 E;  3GM2 A;  3B71 A;  3S9O A;  1O3U A;  1JOG A;  1KTM A;  2PBE A;  3O4X E;  3MFN A;  2LK4 A;  4EBJ A;  3U0C A;  3JYY A;  1UFB A;  3C8G D;  1WTY A;  2JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...