3RQEA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
190
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 73
structure length 190
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqeA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqeA02
1K05A 1WTYA 1KNYA 3TULA 1JOGA 3S9OA 2KK1A 2PBEA 1O3UA 3W8IB 1OW7A 2JX0A 1OW6A 3C18A 3K7DA 2L6HA 1KTMA 4XEVA 4XEFA 2L6GA 3O10A 3B71A 1V4AA 3C8GB 2YWAA 3JYYA 3GM2A 4R32A 3U0CA 3RQFA 4GEHB 1WOLA 2JPUA 4EBJA 4NQFA 3RQGA 3C8GD 4XEKA 4EBKA 3U3FA 1PV3A 1QVXA 2Q00A 1UFBA 3GM1A 3MFNA 2LK4A 2L6FA 3JZ0A 3AJMA 3L8IA 3BRJA 3GM3A 5F28E 1OW8A 3W8HB 2HSBA 3C8GA 1K40A 1WWPA 3L8JA 3RQEA 1ZZPA 1K04A
chains in the Genus database with same CATH superfamily
1S7ZA 2L9JA 3LS1A 3LLKA 2CDQA 3M1CB 3R9SA 2OKUA 3LNRA 4U9EA 4E7SA 4GEHA 4J30B 4NTFA 4CDAA 4G78A 3O55A 3LAYA 3DE8A 1RKCA 3V5XA 4M63A 2R05A 4LERA 4QI0A 4OIQF 1LI7A 1NZYA 3A11A 1YZCA 3SNHA 2HMZA 1E85A 2NUTB 5K0IA 5JUAA 1HZDA 1FFHA 3RYLA 3S84A 3DJUB 2VH3A 4DXWA 1FAPB 4U19A 3QW1A 1A0BA 2Q3TA 5F28E 4EHPA 1RMVA 2Q9BA 4XPWA 3C8GA 1Z23A 3AQBA 1C02A 5L3QA 1ZU5A 2VREA 3H2VA 1ZZPA 1K05A 1TFKB 1BR4A 4FAPB 4MQ9F 1B68A 3HNJA 5KYUA 3EFOB 3R7CA 2AWCA 1HMDA 3IQ6A 1HE1A 4MVRA 3QZCA 3GWNA 2H7VC 3GEHA 3N24A 1QZXA 3UMIA 3VRCA 3A4MA 1A7DA 3B29A 3SXKA 2LCHA 2FBMA 4PJNA 2LQGA 1M56C 2ZQQA 1LS4A 4CS9C 1QQ3A 1T6UA 5KYXB 1Q0KA 4IZDA 2OEXA 2P61A 4U5EE 2R7XA 4Q4ZF 3W8IA 4IZBA 2GDCA 2CGEA 4RDAA 1KU2A 3HNLA 1I4ZA 2VCCA 4U5DE 2HW5A 1OW8A 3US6A 1BDJB 3KKBA 1NZYB 3AG4C 4A2NB 4QIIA 2EJ5A 3Q1TA 4JTDB 2XLOA 2NUPA 3AGTA 4A4AA 1M57C 4BJ6C 1TQGA 1H9GA 5JT4A 3EJNA 2XS1A 5BQGA 5DS4A 3PZKA 3FOPA 5C9GA 3EGXA 4C3DA 1Y64B 1TFOB 2DGJA 3OWTA 2YKZA 3AG1C 1YZAA 2Q9CA 5T3WA 2IXMA 3R2PA 1VK5A 2J0WA 2ZXRA 4U5BE 1LIHA 1NU7D 4JEBA 4U5FE 3PCVA 3Q6NA 4QDLA 4XQ1A 4XEKA 3ZWIA 2Z15A 3ASOC 3C7JA 2P0NA 3EHNA 5L0JA 1XZPA 3NYLA 3RVYA 2R9RB 2ICWG 2BE5F 3U2MA 1YVIA 3U8PA 4FZWC 2Q4FA 3UMHA 4ZU2A 3ZQVA 1JPNA 3CAXA 3BRJA 3GODA 1NFNA 4AL0A 2MHRA 4E7ZA 4BG0A 4J32B 2OJQA 4EIYA 2NSGA 3E70C 3Q0JA 2BL2A 3RIPA 3GM3A 1AUEA 1TKNA 1ZHYA 2H7OA 3FAJA 3SEOA 1QLEC 3DKAA 3GANA 4OIRF 3JSZA 4JURI 3MYBA 2PPYA 4NTBA 2EPMX 3LS0A 3EQLF 3GORA 1QPUA 4HFKB 4E17A 3S0XA 4P9FA 3DM9B 1M2OA 1GS9A 2WVNA 2E87A 3B71A 4N06A 3UNGC 3JYYA 4AX2A 2W9YA 4E18A 4NCQA 4JKVA 4BJ5A 2EIMC 3G50A 2L81A 4GYTA 4KBLA 3M15A 1QVXA 2PX0A 3LEOA 2R7TA 3WAQA 2AP3A 2P1AA 3Q7GA 1NBBA 2OJED 2WZGA 5DS6A 3L8IA 3O4XE 2A69F 3FHDA 3K1HA 4ULVA 1FMVA 2NUPB 1RCPA 3T88A 2R02A 2F6QA 2P63A 3FXHA 3JRTA 3QW0A 1ZHWA 2IYLD 2J8WA 4KNWA 3C63A 1EY3A 3L8JA 4R32A 3U2LA 4BEMJ 1E84A 4YWQA 4CBEA 3H81A 4U9DA 3VAYA 1LE4A 3V5ZA 2RSEB 3Q7LA 4AE4B 2PBEA 1A7EA 2LSEA 3H65A 4YN0B 4O6YA 1RKEB 3W8IB 5B1BC 3F47A 1T9KA 1Z7Qc 4MVMA 4JJGA 1OCRC 4CJGA 3I5PA 4I42A 3SP1A 4EMLA 1G8XA 3O10A 2MYSA 4N6CA 5A69A 2XXAB 2YWAA 3B0PA 1N1CA 1WZ8A 4JTCB 1DCIA 4MI2A 1WOLA 2CYDA 2D4UA 3IHUA 5JVEA 1V74B 2J7PD 5T1DB 1JXZA 1ORYA 2YQYA 4YL0A 3G64A 2HKVA 2YEVA 1APCA 4C7OA 3V7OA 4JOTA 1Z6AA 4U5HA 4BJTA 1NLXA 1EF9A 3DZAA 4XPYA 2OEVA 4WCZA 2ASRA 3W4YA 2IXOA 2XL6A 1VB5A 2IOQA 2LD6A 1M2VA 1T6QA 1D0XA 3RSIA 4JWVA 4MVSA 4MW3A 5JS5A 1D1CA 1AEPA 2EPKX 2OU6A 2VCAA 4YT4A 3EH2A 3U3BA 256BA 1UIYA 2LFDA 4YL3A 2XLMA 3X2QC 1WASA 5BQHA 4J7YA 3ATPA 1OW7A 4JE9A 1FMWA 1OQCA 3MLGA 3ZDLA 5DQZA 1TWGA 3ECSA 3FMSA 4E0HA 2Q9AA 3C8ZA 4ELWA 2VB6A 4IARA 3AM1A 3W2WA 1XWJA 4MW8A 5COGA 3EHMA 3NDBB 1Y4CA 1SYQA 4CS7A 4EBJA 4I52A 1Q0MA 1E2XA 1TWAA 4AE4A 4ANJA 2EPOA 2J9BA 3LLIA 3LJBA 4OD4A 5FCLA 4FZWA 5HV9A 2B0JA 2MWQA 3QXZA 1T6IA 3NYJA 4LLCA 4AL1A 5B3IA 1YYXA 2XLEA 4PFPA 1G4US 4Z9JA 4XLNF 3OA1A 1J8YF 4YT8A 2R03A 2VX2A 4DVZA 5BQIA 1EKYA 3IPMO 1WWPA 3NG1A 4BEJA 3EFOA 3S28A 5L3VA 2O9XA 3QK8A 1WTYA 4WGZA 1T01A 3FAPB 4PK4A 4U5GA 1I4YA 3UMKA 2XLWA 1GQAA 1Y6DA 3FOOA 2KYHA 1YLMA 3G4ZA 3UGOA 3ITFA 3LESA 4MOUA 4PJLA 1Q0GA 3K6BA 1FR0A 3TLFA 3DM5A 1OR3A 3MBGA 4OINF 2CCYA 3M4BA 4IGGA 3AOUA 3RQFA 2AVKA 1TR2A 1UX4A 2HZ8A 2ZD9A 4DOZA 2Y69C 1CPRA 4JVSA 2WB7A 5A6BD 2QLAA 2WVOA 3HNKA 2GTRA 4IJJA 4LLEA 4PFOA 3U9JA 4D4NA 3A9CA 4W8PA 2PP4A 2H8AA 2AU5A 2L6FA 3K66A 4F47A 1VLTA 3IQTA 4LDKA 5KYYA 1FNTc 3AGUA 5D91A 3QXIA 4AK9A 3JSEO 1A7VA 2KQ9A 5DLJA 5CIVA 3UR3C 4IB4A 1L7CA 3T6BA 2RD9A 1JOGA 5T3TA 3SXMA 1H9TA 1HW2A 1YARO 3E9VA 5E33A 3LNMB 1SZIA 4K2NA 1EI7A 1E86A 1ZHZA 5KYWA 3ABMC 4CJOA 3TRRA 4XEFA 2W45A 2PF4E 2PBPA 1Q0DA 3C8GB 4H54A 4G7HF 4DRIB 4MNDA 4KNPA 3O6XA 1SF8A 1H7IA 3DJNB 4Z9HA 5AC5A 1OKKD 1PV3A 2HV6A 3AG2C 2Q00A 3R9TA 4K3WA 5JSLA 1CGOA 2YLDA 2A6EF 2VC9A 5L0HA 2NPUA 2WVQA 5CI9A 3SWXA 4ER9A 4ELSA 3LEVA 3ZVRA 5A6KA 5GPGB 3OC7A 4N4WA 3HLZA 5BUOA 2W4BA 2CNWA 2GFHA 1YAUO 1L3PA 4XLPF 3KYIA 1J8MF 2R7SA 3T6GB 2UUHA 3SXYA 1HW1A 3WODF 5KYXA 1QSPA 4P6IC 5B1AC 3G4XA 4LACB 3FVYA 2XRHA 1YJGA 4MVUA 5B3SC 2UUIA 5HSWA 4IAOA 2IEXA 4WJ0A 5TJ5E 2AWYA 1RJ9B 4Q7CA 2Y39A 2GA0A 3ZIBA 1I5NA 4IAQA 1V55C 2OG2A 2ZXOA 3RQGA 2XL8A 2P7VA 1NSGB 2J9UA 4MVOA 4RBNA 5AGFA 3JTLO 4EBKA 3ASNC 1OXBA 3UGPA 2HS5A 4IZCA 2IM8A 4C7OB 3CEXA 3GM1A 4K0DA 1Q0FA 1OCZC 2Y3HA 3F46A 4G0HA 4YT5A 1RJNA 1JMWA 4FWVA 3ZTMA 4NEKA 1SR2A 2EILC 4XTKA 3W8HB 3RFYA 2KNHA 2WZLA 3TJ6A 1M6TA 2J46A 4WABA 2HJ3A 4WGYA 2YL3A 5KJPA 2R7QA 3ADBA 4JTAB 3RKOF 4BJ1A 4DRJB 2VASA 2Y3BA 3MX3A 4GQHA 2R7WA 1OW6A 4ELXA 1WN0A 2YL7A 3K7DA 4I1OB 4D4XA 1RJMA 2A0BA 4EKWA 1GM5A 1OR2A 4YT2A 2EIKC 3M79A 3ZG1A 4EBBA 3U0CA 2LFFA 4YK5A 2JPUA 3RW0A 1Q52A 1G4WR 4JCSA 3TJ5A 2Q7RA 1EA8A 1C17M 1VTMP 2J0XA 2TMVP 4QI2A 3T89A 3CSKA 3EPVA 1OXKA 5EK0A 3U9MA 2R7OA 3IRBA 2J9VA 2F22A 2ZPAA 1DOVA 1CGME 4KI2A 1JAFA 1RJ9A 3SXZA 3VYWA 3HTKC 3EZHA 1WGWA 2HSQA 3RQEA 2W4MA 2M4EA 2XL4A 4DRHB 2I15A 3TOLA 1JPJA 2XM4A 3AG3C 3L1MA 3EG9A 4CSAC 2KK1A 4I4ZA 2YRFA 5E3CA 2H7BA 1WATA 4X0RA 2DI3A 2XSEA 4BPMA 3JRMO 4YL1A 1HE9A 1U6HA 2YL0A 2DUBA 1JRAA 4KC9A 3PMRA 2G62A 2WZFA 3CZ6A 1ORJA 4E0IA 2NG1A 2M64A 3DWWA 5DS5A 4JRZA 3IQ5A 4NQFA 2XS8A 4DJ9A 5D92A 4ZLCA 2HUJA 3MYFA 4C3BA 3FDUA 2WL8A 3QVZA 4BJ5C 2KSFA 3S90A 2V3CC 3Q0GA 2Y3GA 3B0UX 1FTSA 4I44A 2HSBA 2J7PA 1PD0A 1DOWA 1K40A 4YJWA 4MTFA 2R7VA 2V26A 3T4RA 3JT1A 2KC3A 3I5QA 4Z9IA 3R0OA 1MMNA 1VYKA 1TWHA 2OCCC 3L0IA 4OIPF 1IW7F 2ZQRA 1VYIA 2FFHA 2HMQA 2I8BA 3JCUQ 4O7GA 4OLQA 1VOMA 1ZU4A 4OD5A 4FJWD 1NZEA 1Q51A 3KH2A 4K1OA 4P9TA 4NC3A 1KTMA 3H2UA 2JD3A 2PX3A 5EHHA 3GEEA 1V4AA 4NY3A 1U0BB 4G7OF 1MMAA 3H02A 3SYNA 1RKEA 2A1DD 2HJMA 3O39A 3KQFA 2DYRC 4FX5A 4HFFB 2Y3DA 3RH3A 1G5ZA 4FESA 3KPHA 3NMJA 2YVKA 3ABKC 4MVQA 1UFBA 4DVYP 5JLIA 3POVA 2XLVA 2PFDA 4CSAA 3NMKA 4JFCA 4JCZA 1PCXA 3KYJA 1LS1A 1UG7A 2EIJC 3S29A 3MYIA 3B9QA 1BR1A 3EH1A 4JIOA 2R7UA 5JBWA 2ZXPA 5FZTA 2KGOA 3GWLA 2ZXWC 2QQ3A 2A0UA 2FW2A 4PR9A 1K04A 3TULA 2QNLA 4JC7A 1F1MA 4RD9A 4BJ6A 1D0YA 3QTHA 1LVKA 3TK0A 2XLDA 4JJFA 3B0VC 2HV7A 1C03A 3LUTB 4NTAA 2DB4A 3GEIA 1R5ID 3DAGA 3A4NA 2FAPB 1ZW2A 4ZLDA 1ZYRF 2L6GA 3U5SA 3HJCA 3GM2A 2KJGA 1ZHTA 1Z63A 1CPQA 1VLSA 2UZFA 2NSFA 2PNOA 4J7TA 3ZC4A 5L0DA 3J06A 4MTGA 4CS9A 4F4BA 3U3FA 4N6HA 5KYNA 1OKKA 1LKXA 2IXNA 4PJMA 4L6RA 2NUTA 4QIJA 2LIGA 2G3KA 1R4TA 5A6AA 5F5HA 2J45A 2X51A 2KW3C 3Q6MA 4HE8D 3CQZA 4IRUA 3VM6A 2B0HA 1FFTC 4MVZA 1NG1A 4U18A 5L0FA 4NNQA 3ZSUA 1UX5A 2A68F 2GWWA 2YZSA 3EG9B 5A6JA 1AVOB 1LPEA 4EUKB 3DXJF 4JCHA 2VCBA 5KYUB 1O3UA 2JX0A 2OQMA 1Z5ZA 2QY9A 4U5CE 2P6VA 4CS8C 5KYWB 3U8VA 2L7AA 1OCCC 1RXQA 2IBFA 3EGXB 4XEVA 3OEOA 2J9WA 3IEEA 3M4CA 3PHF2 1MQVA 1YYJA 5AC4A 1VMAA 1XZQA 4I1MA 4G7ZF 2OOCA 4HEAJ 2D5RB 2IXPA 1A41A 3QVYA 2YHSA 5DVWA 1D0ZA 4CDYA 1O87A 3DAFA 5JP7A 5JBXA 2DYSC 3RVZA 4DBQA 1LE2A 2C03A 3EZIA 1MJ3A 1U89A 2ETSA 3HKKA 3X1OA 3QMKA 3ZQYA 5E3AA 1LM3B 3PDMP 3N2ZB 1HY5A 5E2QA 1CGNA 3NYMA 5IY5C 2XXAA 3DD7A 3BEHA 4CIPA 1EF8A 3HINA 1D1BA 2YLIA 5JRAA 5CI8A 3I4UA 3TOMA 1KNYA 4W8KA 2LP4A 1D1AA 2A6HF 3SLLA 3S9OA 3WHNA 5F5FA 1H6GA 3DE9A 5L0GA 3C18A 4CX9A 3ADDA 3TQOA 3WG7C 4LDRA 4O79A 4O6MA 4K7BA 4XPXA 3W8HA 2C04A 3V5YA 3T9OA 3VF0A 1M2VB 4OG1A 1BR2A 2YLGA 4JW1A 5L0CA 4B6IA 4UDVA 2X0CA 4ULWA 3IQCA 3C8GD 1EQ1A 2R7RA 4OIOF 4H4KC 3HNIA 3HRXA 4XWJA 2QTVA 2CW0F 2EINC 2XLHA 1OCOC 1V54C 3EGDB 3T6JA 4CIHA 3DMDA 3N0TA 3MFNA 1LI5A 1ORSC 3P5MA 1S05A 2LK4A 3JZ0A 3L34A 3NKDA 4IWBA 5DQTA 5EGYA 1ST6A 1PD1A 2EPLX 3C62A 3JYHA 4MS2A 3ZTZA 4ONSA 1DUBA 2GAQA 3RF3A 3AQCA 1T5OA 4O6NA 4Q5SF 2BC5A 2QE9A 4MTOA 1YDIA 5KYYB 1TWCA 3K33A 1BZ4A 4LDQA 3ABLC 3DI5A 1MMGA 1O5HA 3KMIA 4PACA 3T8AA 1YA7O 3A4LA 3W2VA 4CDVA 1NFOA 4I3MA 3SZRA 2L6HA 2QUPA 1ZW3A 2XM0A 1E83A 3I47A 4JYLA 5COFA 5L0IA 4KNVA 2EPNA 2FGYA 2CNWD 4GEHB 1W2WA 1MNEA 1MMDA 1NU9C 4U1AA 1IZMA 1ZHXA 1Z3IX 1ZVZA 2G3VA 3ADCA 3KL4A 2HFIA 4JZAA 1MNDA 5A6BA 1BBHA 1HMOA 5COMA 2R25A 3EGDA 4DBRA 3NKEA 3NMIA 1GGQA 3K1IA 3AJMA 1QKRA 1JR8A 3TD7A 1YA9A 3MOYA 3S27A 1SMYF 4CS8A 4PJJA 4JEAA 3NRHA 2YL1A 3K1IC 4C3EA 4EWCA 3FDQA
chains in the Genus database with same CATH topology
4NNQA 1K05A 1UX5A 1KNYA 3ADBA 1JOGA 1WTYA 3TULA 3S9OA 2KK1A 2PBEA 1O3UA 3W8IB 1OW7A 2JX0A 3ADDA 1OW6A 3C18A 3K7DA 3A4LA 1RJMA 3A4NA 2L6HA 1KTMA 4XEVA 1Y64B 4XEFA 2L6GA 3O10A 3B71A 3AM1A 3A4MA 1V4AA 2YWAA 3C8GB 3GM2A 3JYYA 4R32A 4GEHB 3RQFA 1WOLA 1UX4A 2JPUA 4EBJA 4NQFA 3RQGA 3C8GD 3ADCA 4XEKA 4EBKA 3U3FA 1PV3A 1QVXA 2Q00A 1UFBA 3GM1A 3U0CA 3MFNA 2LK4A 2L6FA 3JZ0A 3L8IA 3O4XE 3AJMA 3BRJA 3GM3A 3IRBA 5F28E 1OW8A 3W8HB 2HSBA 3C8GA 2P63A 1K40A 1WWPA 3L8JA 3RQEA 1ZZPA 1K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  1WTY A;  1KNY A;  3TUL A;  1JOG A;  3S9O A;  2KK1 A;  2PBE A;  1O3U A;  3W8I B;  1OW7 A;  2JX0 A;  1OW6 A;  3C18 A;  3K7D A;  2L6H A;  1KTM A;  4XEV A;  4XEF A;  2L6G A;  3O10 A;  3B71 A;  1V4A A;  3C8G B;  2YWA A;  3JYY A;  3GM2 A;  4R32 A;  3U0C A;  3RQF A;  4GEH B;  1WOL A;  2JPU A;  4EBJ A;  4NQF A;  3RQG A;  3C8G D;  4XEK A;  4EBK A;  3U3F A;  1PV3 A;  1QVX A;  2Q00 A;  1UFB A;  3GM1 A;  3MFN A;  2LK4 A;  2L6F A;  3JZ0 A;  3AJM A;  3L8I A;  3BRJ A;  3GM3 A;  5F28 E;  1OW8 A;  3W8H B;  2HSB A;  3C8G A;  1K40 A;  1WWP A;  3L8J A;  3RQE A;  1ZZP A;  1K04 A; 
#chains in the Genus database with same CATH topology
 1S7Z A;  2L9J A;  3LS1 A;  3LLK A;  2CDQ A;  3M1C B;  3R9S A;  2OKU A;  3LNR A;  4U9E A;  4E7S A;  4GEH A;  4J30 B;  4NTF A;  4CDA A;  4G78 A;  3O55 A;  3LAY A;  3DE8 A;  1RKC A;  3V5X A;  4M63 A;  2R05 A;  4LER A;  4QI0 A;  4OIQ F;  1LI7 A;  1NZY A;  3A11 A;  1YZC A;  3SNH A;  2HMZ A;  1E85 A;  2NUT B;  5K0I A;  5JUA A;  1HZD A;  1FFH A;  3RYL A;  3S84 A;  3DJU B;  2VH3 A;  4DXW A;  1FAP B;  4U19 A;  3QW1 A;  1A0B A;  2Q3T A;  5F28 E;  4EHP A;  1RMV A;  2Q9B A;  4XPW A;  3C8G A;  1Z23 A;  3AQB A;  1C02 A;  5L3Q A;  1ZU5 A;  2VRE A;  3H2V A;  1ZZP A;  1K05 A;  1TFK B;  1BR4 A;  4FAP B;  4MQ9 F;  1B68 A;  3HNJ A;  5KYU A;  3EFO B;  3R7C A;  2AWC A;  1HMD A;  3IQ6 A;  1HE1 A;  4MVR A;  3QZC A;  3GWN A;  2H7V C;  3GEH A;  3N24 A;  1QZX A;  3UMI A;  3VRC A;  3A4M A;  1A7D A;  3B29 A;  3SXK A;  2LCH A;  2FBM A;  4PJN A;  2LQG A;  1M56 C;  2ZQQ A;  1LS4 A;  4CS9 C;  1QQ3 A;  1T6U A;  5KYX B;  1Q0K A;  4IZD A;  2OEX A;  2P61 A;  4U5E E;  2R7X A;  4Q4Z F;  3W8I A;  4IZB A;  2GDC A;  2CGE A;  4RDA A;  1KU2 A;  3HNL A;  1I4Z A;  2VCC A;  4U5D E;  2HW5 A;  1OW8 A;  3US6 A;  1BDJ B;  3KKB A;  1NZY B;  3AG4 C;  4A2N B;  4QII A;  2EJ5 A;  3Q1T A;  4JTD B;  2XLO A;  2NUP A;  3AGT A;  4A4A A;  1M57 C;  4BJ6 C;  1TQG A;  1H9G A;  5JT4 A;  3EJN A;  2XS1 A;  5BQG A;  5DS4 A;  3PZK A;  3FOP A;  5C9G A;  3EGX A;  4C3D A;  1Y64 B;  1TFO B;  2DGJ A;  3OWT A;  2YKZ A;  3AG1 C;  1YZA A;  2Q9C A;  5T3W A;  2IXM A;  3R2P A;  1VK5 A;  2J0W A;  2ZXR A;  4U5B E;  1LIH A;  1NU7 D;  4JEB A;  4U5F E;  3PCV A;  3Q6N A;  4QDL A;  4XQ1 A;  4XEK A;  3ZWI A;  2Z15 A;  3ASO C;  3C7J A;  2P0N A;  3EHN A;  5L0J A;  1XZP A;  3NYL A;  3RVY A;  2R9R B;  2ICW G;  2BE5 F;  3U2M A;  1YVI A;  3U8P A;  4FZW C;  2Q4F A;  3UMH A;  4ZU2 A;  3ZQV A;  1JPN A;  3CAX A;  3BRJ A;  3GOD A;  1NFN A;  4AL0 A;  2MHR A;  4E7Z A;  4BG0 A;  4J32 B;  2OJQ A;  4EIY A;  2NSG A;  3E70 C;  3Q0J A;  2BL2 A;  3RIP A;  3GM3 A;  1AUE A;  1TKN A;  1ZHY A;  2H7O A;  3FAJ A;  3SEO A;  1QLE C;  3DKA A;  3GAN A;  4OIR F;  3JSZ A;  4JUR I;  3MYB A;  2PPY A;  4NTB A;  2EPM X;  3LS0 A;  3EQL F;  3GOR A;  1QPU A;  4HFK B;  4E17 A;  3S0X A;  4P9F A;  3DM9 B;  1M2O A;  1GS9 A;  2WVN A;  2E87 A;  3B71 A;  4N06 A;  3UNG C;  3JYY A;  4AX2 A;  2W9Y A;  4E18 A;  4NCQ A;  4JKV A;  4BJ5 A;  2EIM C;  3G50 A;  2L81 A;  4GYT A;  4KBL A;  3M15 A;  1QVX A;  2PX0 A;  3LEO A;  2R7T A;  3WAQ A;  2AP3 A;  2P1A A;  3Q7G A;  1NBB A;  2OJE D;  2WZG A;  5DS6 A;  3L8I A;  3O4X E;  2A69 F;  3FHD A;  3K1H A;  4ULV A;  1FMV A;  2NUP B;  1RCP A;  3T88 A;  2R02 A;  2F6Q A;  2P63 A;  3FXH A;  3JRT A;  3QW0 A;  1ZHW A;  2IYL D;  2J8W A;  4KNW A;  3C63 A;  1EY3 A;  3L8J A;  4R32 A;  3U2L A;  4BEM J;  1E84 A;  4YWQ A;  4CBE A;  3H81 A;  4U9D A;  3VAY A;  1LE4 A;  3V5Z A;  2RSE B;  3Q7L A;  4AE4 B;  2PBE A;  1A7E A;  2LSE A;  3H65 A;  4YN0 B;  4O6Y A;  1RKE B;  3W8I B;  5B1B C;  3F47 A;  1T9K A;  1Z7Q c;  4MVM A;  4JJG A;  1OCR C;  4CJG A;  3I5P A;  4I42 A;  3SP1 A;  4EML A;  1G8X A;  3O10 A;  2MYS A;  4N6C A;  5A69 A;  2XXA B;  2YWA A;  3B0P A;  1N1C A;  1WZ8 A;  4JTC B;  1DCI A;  4MI2 A;  1WOL A;  2CYD A;  2D4U A;  3IHU A;  5JVE A;  1V74 B;  2J7P D;  5T1D B;  1JXZ A;  1ORY A;  2YQY A;  4YL0 A;  3G64 A;  2HKV A;  2YEV A;  1APC A;  4C7O A;  3V7O A;  4JOT A;  1Z6A A;  4U5H A;  4BJT A;  1NLX A;  1EF9 A;  3DZA A;  4XPY A;  2OEV A;  4WCZ A;  2ASR A;  3W4Y A;  2IXO A;  2XL6 A;  1VB5 A;  2IOQ A;  2LD6 A;  1M2V A;  1T6Q A;  1D0X A;  3RSI A;  4JWV A;  4MVS A;  4MW3 A;  5JS5 A;  1D1C A;  1AEP A;  2EPK X;  2OU6 A;  2VCA A;  4YT4 A;  3EH2 A;  3U3B A;  256B A;  1UIY A;  2LFD A;  4YL3 A;  2XLM A;  3X2Q C;  1WAS A;  5BQH A;  4J7Y A;  3ATP A;  1OW7 A;  4JE9 A;  1FMW A;  1OQC A;  3MLG A;  3ZDL A;  5DQZ A;  1TWG A;  3ECS A;  3FMS A;  4E0H A;  2Q9A A;  3C8Z A;  4ELW A;  2VB6 A;  4IAR A;  3AM1 A;  3W2W A;  1XWJ A;  4MW8 A;  5COG A;  3EHM A;  3NDB B;  1Y4C A;  1SYQ A;  4CS7 A;  4EBJ A;  4I52 A;  1Q0M A;  1E2X A;  1TWA A;  4AE4 A;  4ANJ A;  2EPO A;  2J9B A;  3LLI A;  3LJB A;  4OD4 A;  5FCL A;  4FZW A;  5HV9 A;  2B0J A;  2MWQ A;  3QXZ A;  1T6I A;  3NYJ A;  4LLC A;  4AL1 A;  5B3I A;  1YYX A;  2XLE A;  4PFP A;  1G4U S;  4Z9J A;  4XLN F;  3OA1 A;  1J8Y F;  4YT8 A;  2R03 A;  2VX2 A;  4DVZ A;  5BQI A;  1EKY A;  3IPM O;  1WWP A;  3NG1 A;  4BEJ A;  3EFO A;  3S28 A;  5L3V A;  2O9X A;  3QK8 A;  1WTY A;  4WGZ A;  1T01 A;  3FAP B;  4PK4 A;  4U5G A;  1I4Y A;  3UMK A;  2XLW A;  1GQA A;  1Y6D A;  3FOO A;  2KYH A;  1YLM A;  3G4Z A;  3UGO A;  3ITF A;  3LES A;  4MOU A;  4PJL A;  1Q0G A;  3K6B A;  1FR0 A;  3TLF A;  3DM5 A;  1OR3 A;  3MBG A;  4OIN F;  2CCY A;  3M4B A;  4IGG A;  3AOU A;  3RQF A;  2AVK A;  1TR2 A;  1UX4 A;  2HZ8 A;  2ZD9 A;  4DOZ A;  2Y69 C;  1CPR A;  4JVS A;  2WB7 A;  5A6B D;  2QLA A;  2WVO A;  3HNK A;  2GTR A;  4IJJ A;  4LLE A;  4PFO A;  3U9J A;  4D4N A;  3A9C A;  4W8P A;  2PP4 A;  2H8A A;  2AU5 A;  2L6F A;  3K66 A;  4F47 A;  1VLT A;  3IQT A;  4LDK A;  5KYY A;  1FNT c;  3AGU A;  5D91 A;  3QXI A;  4AK9 A;  3JSE O;  1A7V A;  2KQ9 A;  5DLJ A;  5CIV A;  3UR3 C;  4IB4 A;  1L7C A;  3T6B A;  2RD9 A;  1JOG A;  5T3T A;  3SXM A;  1H9T A;  1HW2 A;  1YAR O;  3E9V A;  5E33 A;  3LNM B;  1SZI A;  4K2N A;  1EI7 A;  1E86 A;  1ZHZ A;  5KYW A;  3ABM C;  4CJO A;  3TRR A;  4XEF A;  2W45 A;  2PF4 E;  2PBP A;  1Q0D A;  3C8G B;  4H54 A;  4G7H F;  4DRI B;  4MND A;  4KNP A;  3O6X A;  1SF8 A;  1H7I A;  3DJN B;  4Z9H A;  5AC5 A;  1OKK D;  1PV3 A;  2HV6 A;  3AG2 C;  2Q00 A;  3R9T A;  4K3W A;  5JSL A;  1CGO A;  2YLD A;  2A6E F;  2VC9 A;  5L0H A;  2NPU A;  2WVQ A;  5CI9 A;  3SWX A;  4ER9 A;  4ELS A;  3LEV A;  3ZVR A;  5A6K A;  5GPG B;  3OC7 A;  4N4W A;  3HLZ A;  5BUO A;  2W4B A;  2CNW A;  2GFH A;  1YAU O;  1L3P A;  4XLP F;  3KYI A;  1J8M F;  2R7S A;  3T6G B;  2UUH A;  3SXY A;  1HW1 A;  3WOD F;  5KYX A;  1QSP A;  4P6I C;  5B1A C;  3G4X A;  4LAC B;  3FVY A;  2XRH A;  1YJG A;  4MVU A;  5B3S C;  2UUI A;  5HSW A;  4IAO A;  2IEX A;  4WJ0 A;  5TJ5 E;  2AWY A;  1RJ9 B;  4Q7C A;  2Y39 A;  2GA0 A;  3ZIB A;  1I5N A;  4IAQ A;  1V55 C;  2OG2 A;  2ZXO A;  3RQG A;  2XL8 A;  2P7V A;  1NSG B;  2J9U A;  4MVO A;  4RBN A;  5AGF A;  3JTL O;  4EBK A;  3ASN C;  1OXB A;  3UGP A;  2HS5 A;  4IZC A;  2IM8 A;  4C7O B;  3CEX A;  3GM1 A;  4K0D A;  1Q0F A;  1OCZ C;  2Y3H A;  3F46 A;  4G0H A;  4YT5 A;  1RJN A;  1JMW A;  4FWV A;  3ZTM A;  4NEK A;  1SR2 A;  2EIL C;  4XTK A;  3W8H B;  3RFY A;  2KNH A;  2WZL A;  3TJ6 A;  1M6T A;  2J46 A;  4WAB A;  2HJ3 A;  4WGY A;  2YL3 A;  5KJP A;  2R7Q A;  3ADB A;  4JTA B;  3RKO F;  4BJ1 A;  4DRJ B;  2VAS A;  2Y3B A;  3MX3 A;  4GQH A;  2R7W A;  1OW6 A;  4ELX A;  1WN0 A;  2YL7 A;  3K7D A;  4I1O B;  4D4X A;  1RJM A;  2A0B A;  4EKW A;  1GM5 A;  1OR2 A;  4YT2 A;  2EIK C;  3M79 A;  3ZG1 A;  4EBB A;  3U0C A;  2LFF A;  4YK5 A;  2JPU A;  3RW0 A;  1Q52 A;  1G4W R;  4JCS A;  3TJ5 A;  2Q7R A;  1EA8 A;  1C17 M;  1VTM P;  2J0X A;  2TMV P;  4QI2 A;  3T89 A;  3CSK A;  3EPV A;  1OXK A;  5EK0 A;  3U9M A;  2R7O A;  3IRB A;  2J9V A;  2F22 A;  2ZPA A;  1DOV A;  1CGM E;  4KI2 A;  1JAF A;  1RJ9 A;  3SXZ A;  3VYW A;  3HTK C;  3EZH A;  1WGW A;  2HSQ A;  3RQE A;  2W4M A;  2M4E A;  2XL4 A;  4DRH B;  2I15 A;  3TOL A;  1JPJ A;  2XM4 A;  3AG3 C;  3L1M A;  3EG9 A;  4CSA C;  2KK1 A;  4I4Z A;  2YRF A;  5E3C A;  2H7B A;  1WAT A;  4X0R A;  2DI3 A;  2XSE A;  4BPM A;  3JRM O;  4YL1 A;  1HE9 A;  1U6H A;  2YL0 A;  2DUB A;  1JRA A;  4KC9 A;  3PMR A;  2G62 A;  2WZF A;  3CZ6 A;  1ORJ A;  4E0I A;  2NG1 A;  2M64 A;  3DWW A;  5DS5 A;  4JRZ A;  3IQ5 A;  4NQF A;  2XS8 A;  4DJ9 A;  5D92 A;  4ZLC A;  2HUJ A;  3MYF A;  4C3B A;  3FDU A;  2WL8 A;  3QVZ A;  4BJ5 C;  2KSF A;  3S90 A;  2V3C C;  3Q0G A;  2Y3G A;  3B0U X;  1FTS A;  4I44 A;  2HSB A;  2J7P A;  1PD0 A;  1DOW A;  1K40 A;  4YJW A;  4MTF A;  2R7V A;  2V26 A;  3T4R A;  3JT1 A;  2KC3 A;  3I5Q A;  4Z9I A;  3R0O A;  1MMN A;  1VYK A;  1TWH A;  2OCC C;  3L0I A;  4OIP F;  1IW7 F;  2ZQR A;  1VYI A;  2FFH A;  2HMQ A;  2I8B A;  3JCU Q;  4O7G A;  4OLQ A;  1VOM A;  1ZU4 A;  4OD5 A;  4FJW D;  1NZE A;  1Q51 A;  3KH2 A;  4K1O A;  4P9T A;  4NC3 A;  1KTM A;  3H2U A;  2JD3 A;  2PX3 A;  5EHH A;  3GEE A;  1V4A A;  4NY3 A;  1U0B B;  4G7O F;  1MMA A;  3H02 A;  3SYN A;  1RKE A;  2A1D D;  2HJM A;  3O39 A;  3KQF A;  2DYR C;  4FX5 A;  4HFF B;  2Y3D A;  3RH3 A;  1G5Z A;  4FES A;  3KPH A;  3NMJ A;  2YVK A;  3ABK C;  4MVQ A;  1UFB A;  4DVY P;  5JLI A;  3POV A;  2XLV A;  2PFD A;  4CSA A;  3NMK A;  4JFC A;  4JCZ A;  1PCX A;  3KYJ A;  1LS1 A;  1UG7 A;  2EIJ C;  3S29 A;  3MYI A;  3B9Q A;  1BR1 A;  3EH1 A;  4JIO A;  2R7U A;  5JBW A;  2ZXP A;  5FZT A;  2KGO A;  3GWL A;  2ZXW C;  2QQ3 A;  2A0U A;  2FW2 A;  4PR9 A;  1K04 A;  3TUL A;  2QNL A;  4JC7 A;  1F1M A;  4RD9 A;  4BJ6 A;  1D0Y A;  3QTH A;  1LVK A;  3TK0 A;  2XLD A;  4JJF A;  3B0V C;  2HV7 A;  1C03 A;  3LUT B;  4NTA A;  2DB4 A;  3GEI A;  1R5I D;  3DAG A;  3A4N A;  2FAP B;  1ZW2 A;  4ZLD A;  1ZYR F;  2L6G A;  3U5S A;  3HJC A;  3GM2 A;  2KJG A;  1ZHT A;  1Z63 A;  1CPQ A;  1VLS A;  2UZF A;  2NSF A;  2PNO A;  4J7T A;  3ZC4 A;  5L0D A;  3J06 A;  4MTG A;  4CS9 A;  4F4B A;  3U3F A;  4N6H A;  5KYN A;  1OKK A;  1LKX A;  2IXN A;  4PJM A;  4L6R A;  2NUT A;  4QIJ A;  2LIG A;  2G3K A;  1R4T A;  5A6A A;  5F5H A;  2J45 A;  2X51 A;  2KW3 C;  3Q6M A;  4HE8 D;  3CQZ A;  4IRU A;  3VM6 A;  2B0H A;  1FFT C;  4MVZ A;  1NG1 A;  4U18 A;  5L0F A;  4NNQ A;  3ZSU A;  1UX5 A;  2A68 F;  2GWW A;  2YZS A;  3EG9 B;  5A6J A;  1AVO B;  1LPE A;  4EUK B;  3DXJ F;  4JCH A;  2VCB A;  5KYU B;  1O3U A;  2JX0 A;  2OQM A;  1Z5Z A;  2QY9 A;  4U5C E;  2P6V A;  4CS8 C;  5KYW B;  3U8V A;  2L7A A;  1OCC C;  1RXQ A;  2IBF A;  3EGX B;  4XEV A;  3OEO A;  2J9W A;  3IEE A;  3M4C A;  3PHF 2;  1MQV A;  1YYJ A;  5AC4 A;  1VMA A;  1XZQ A;  4I1M A;  4G7Z F;  2OOC A;  4HEA J;  2D5R B;  2IXP A;  1A41 A;  3QVY A;  2YHS A;  5DVW A;  1D0Z A;  4CDY A;  1O87 A;  3DAF A;  5JP7 A;  5JBX A;  2DYS C;  3RVZ A;  4DBQ A;  1LE2 A;  2C03 A;  3EZI A;  1MJ3 A;  1U89 A;  2ETS A;  3HKK A;  3X1O A;  3QMK A;  3ZQY A;  5E3A A;  1LM3 B;  3PDM P;  3N2Z B;  1HY5 A;  5E2Q A;  1CGN A;  3NYM A;  5IY5 C;  2XXA A;  3DD7 A;  3BEH A;  4CIP A;  1EF8 A;  3HIN A;  1D1B A;  2YLI A;  5JRA A;  5CI8 A;  3I4U A;  3TOM A;  1KNY A;  4W8K A;  2LP4 A;  1D1A A;  2A6H F;  3SLL A;  3S9O A;  3WHN A;  5F5F A;  1H6G A;  3DE9 A;  5L0G A;  3C18 A;  4CX9 A;  3ADD A;  3TQO A;  3WG7 C;  4LDR A;  4O79 A;  4O6M A;  4K7B A;  4XPX A;  3W8H A;  2C04 A;  3V5Y A;  3T9O A;  3VF0 A;  1M2V B;  4OG1 A;  1BR2 A;  2YLG A;  4JW1 A;  5L0C A;  4B6I A;  4UDV A;  2X0C A;  4ULW A;  3IQC A;  3C8G D;  1EQ1 A;  2R7R A;  4OIO F;  4H4K C;  3HNI A;  3HRX A;  4XWJ A;  2QTV A;  2CW0 F;  2EIN C;  2XLH A;  1OCO C;  1V54 C;  3EGD B;  3T6J A;  4CIH A;  3DMD A;  3N0T A;  3MFN A;  1LI5 A;  1ORS C;  3P5M A;  1S05 A;  2LK4 A;  3JZ0 A;  3L34 A;  3NKD A;  4IWB A;  5DQT A;  5EGY A;  1ST6 A;  1PD1 A;  2EPL X;  3C62 A;  3JYH A;  4MS2 A;  3ZTZ A;  4ONS A;  1DUB A;  2GAQ A;  3RF3 A;  3AQC A;  1T5O A;  4O6N A;  4Q5S F;  2BC5 A;  2QE9 A;  4MTO A;  1YDI A;  5KYY B;  1TWC A;  3K33 A;  1BZ4 A;  4LDQ A;  3ABL C;  3DI5 A;  1MMG A;  1O5H A;  3KMI A;  4PAC A;  3T8A A;  1YA7 O;  3A4L A;  3W2V A;  4CDV A;  1NFO A;  4I3M A;  3SZR A;  2L6H A;  2QUP A;  1ZW3 A;  2XM0 A;  1E83 A;  3I47 A;  4JYL A;  5COF A;  5L0I A;  4KNV A;  2EPN A;  2FGY A;  2CNW D;  4GEH B;  1W2W A;  1MNE A;  1MMD A;  1NU9 C;  4U1A A;  1IZM A;  1ZHX A;  1Z3I X;  1ZVZ A;  2G3V A;  3ADC A;  3KL4 A;  2HFI A;  4JZA A;  1MND A;  5A6B A;  1BBH A;  1HMO A;  5COM A;  2R25 A;  3EGD A;  4DBR A;  3NKE A;  3NMI A;  1GGQ A;  3K1I A;  3AJM A;  1QKR A;  1JR8 A;  3TD7 A;  1YA9 A;  3MOY A;  3S27 A;  1SMY F;  4CS8 A;  4PJJ A;  4JEA A;  3NRH A;  2YL1 A;  3K1I C;  4C3E A;  4EWC A;  3FDQ A; 
#chains in the Genus database with same CATH homology
 4NNQ A;  1K05 A;  1UX5 A;  1KNY A;  3ADB A;  1JOG A;  1WTY A;  3TUL A;  3S9O A;  2KK1 A;  2PBE A;  1O3U A;  3W8I B;  1OW7 A;  2JX0 A;  3ADD A;  1OW6 A;  3C18 A;  3K7D A;  3A4L A;  1RJM A;  3A4N A;  2L6H A;  1KTM A;  4XEV A;  1Y64 B;  4XEF A;  2L6G A;  3O10 A;  3B71 A;  3AM1 A;  3A4M A;  1V4A A;  2YWA A;  3C8G B;  3GM2 A;  3JYY A;  4R32 A;  4GEH B;  3RQF A;  1WOL A;  1UX4 A;  2JPU A;  4EBJ A;  4NQF A;  3RQG A;  3C8G D;  3ADC A;  4XEK A;  4EBK A;  3U3F A;  1PV3 A;  1QVX A;  2Q00 A;  1UFB A;  3GM1 A;  3U0C A;  3MFN A;  2LK4 A;  2L6F A;  3JZ0 A;  3L8I A;  3O4X E;  3AJM A;  3BRJ A;  3GM3 A;  3IRB A;  5F28 E;  1OW8 A;  3W8H B;  2HSB A;  3C8G A;  2P63 A;  1K40 A;  1WWP A;  3L8J A;  3RQE A;  1ZZP A;  1K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...