3RQEA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
190
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 190
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqeA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqeA02
1WTYA 4XEVA 1ZZPA 2PBEA 3JYYA 3L8JA 3GM3A 3C8GA 3C18A 2YWAA 2LK4A 4GEHB 2JPUA 3B71A 1PV3A 4NQFA 1O3UA 1WOLA 2KK1A 3BRJA 1KNYA 2L6FA 3TULA 3W8HB 3C8GB 1V4AA 1WWPA 3C8GD 1K40A 1K05A 4XEFA 1OW6A 1QVXA 2L6HA 3RQFA 3L8IA 3GM1A 2L6GA 3U3FA 2JX0A 4XEKA 1KTMA 3MFNA 3W8IB 2Q00A 3JZ0A 4EBJA 3S9OA 3U0CA 3GM2A 1OW7A 2HSBA 1K04A 5F28E 1OW8A 1JOGA 3O10A 3AJMA 1UFBA 3RQGA 4R32A 3RQEA 3K7DA 4EBKA
chains in the Genus database with same CATH superfamily
2L7AA 4JFCA 2YL7A 3T88A 1Q0GA 4FZWA 4G7OF 5L0DA 1VOMA 1OW8A 1ZHZA 4MI2A 4N06A 3B71A 2DGJA 1NBBA 1V4AA 1RJMA 1RKEA 2HMZA 2Q7RA 3EH2A 5COFA 2EPLX 2QNLA 2I8BA 3RIPA 1UFBA 2NPUA 1SYQA 4MVMA 2CYDA 2EJ5A 3KH2A 3KL4A 2M64A 5DS4A 3TOMA 1EA8A 1T5OA 2Q3TA 1KU2A 4P6IC 3AG2C 3GEHA 4C7OA 4MS2A 3L0IA 2YLDA 4EMLA 1LE4A 1WWPA 2DYRC 4WGYA 2EPMX 1D1BA 5F28E 1XZPA 4YN0B 3OEOA 5F5HA 3G50A 1EF8A 1MNEA 1M56C 4U5GA 2KYHA 2HS5A 4E17A 1MMAA 5CIVA 3BRJA 2J9BA 1YJGA 2X51A 5KYNA 1WZ8A 2WVOA 2R7QA 2EIMC 1JRAA 3UMHA 1LVKA 1DOVA 1K04A 3EZIA 4RBNA 4R32A 5L0HA 2YQYA 2VCCA 1C02A 4D4XA 1JAFA 3UGOA 4F4BA 3WHNA 1Z6AA 2WZLA 1FTSA 1RXQA 256BA 2KK1A 1I5NA 2NUPA 4PJMA 1V74B 4H54A 4G7HF 1ZU5A 1ZHWA 1MJ3A 3FXHA 1PD0A 3OWTA 1UIYA 3C63A 2J46A 3DM9B 2KSFA 1UG7A 3M4CA 2J8WA 1Q51A 1GS9A 5E3CA 2HMQA 2L6HA 4YL0A 1LS4A 3S27A 2ICWG 4CJOA 4YT2A 4JJFA 2VC9A 4EBJA 1RKEB 3DKAA 1O87A 5L0IA 4W8KA 1JPJA 3H02A 4G78A 2BC5A 2H7VC 3GM3A 4U5EE 2NUTA 3NMKA 5COMA 4OIRF 4K2NA 3K1HA 1Z5ZA 1WGWA 3EQLF 3BEHA 4MW3A 3K33A 4BJ5C 1MMGA 2ASRA 4MTOA 4BJ1A 3LEVA 5B1AC 1V55C 3OC7A 3JYYA 2TMVP 4C7OB 4U1AA 3T9OA 3H2UA 3ZVRA 5TJ5E 2EINC 3UMKA 3ZSUA 3AQBA 3LNRA 3ASOC 2KC3A 3S29A 3PHF2 4CSAA 4NTAA 1PV3A 3O39A 1BDJB 2L6FA 4CDYA 3TJ5A 2O9XA 4C3DA 4CJGA 1NLXA 5E33A 4P9TA 3IQTA 3ZTMA 1CGOA 2EIKC 3HLZA 3C7JA 3MOYA 3FMSA 1DCIA 5D92A 4J30B 1EF9A 4JC7A 3UNGC 4U18A 1LKXA 4G7ZF 5DS5A 1I4ZA 5E2QA 3W2WA 1SMYF 2D4UA 3U8VA 4XPYA 1VYIA 1I4YA 4IARA 2XL8A 2M4EA 2XLWA 3TQOA 2X0CA 3L8JA 1FAPB 4DRHB 3W2VA 1CGME 2R25A 4NCQA 2A68F 2R7OA 2NUPB 1GM5A 4FWVA 3QW1A 3B9QA 2AVKA 2P6VA 4Q7CA 3JSZA 2YRFA 5BUOA 3ZG1A 2XS8A 1WATA 3VYWA 1ZHYA 4Q4ZF 2R03A 1SR2A 3EJNA 3R2PA 2R7RA 3DXJF 4CIPA 2R02A 4PACA 2G3KA 2Y39A 4XLNF 3LJBA 3FOOA 2V3CC 3GANA 3DAGA 3RQGA 3GWNA 4JTDB 4CS8A 3LS1A 4J7TA 1JXZA 3ZQVA 1RJ9A 4BJ6A 4U5FE 2OEVA 2ZXWC 1E84A 2L81A 2NUTB 4PR9A 4RDAA 3S9OA 5B3IA 3I4UA 2IEXA 1YDIA 3JSEO 5F5FA 3Q7LA 2J9UA 3NKDA 1Z63A 5C9GA 3MBGA 4YT4A 1BBHA 5T3WA 3S0XA 1OCCC 3FDQA 4O6MA 2EIJC 2PP4A 1E83A 4PFPA 2RD9A 3PCVA 4YT5A 1NU9C 1D0YA 3POVA 1Q0KA 2A69F 5T3TA 3SP1A 3EZHA 4JYLA 3RVYA 3B0UX 4XEVA 4X0RA 2GTRA 4XWJA 3FAJA 2Y3HA 3HNJA 4Z9HA 1TWCA 2RSEB 3LNMB 1L3PA 3K7DA 3AM1A 5JT4A 4NNQA 5JUAA 3RSIA 5BQGA 4IWBA 2NSFA 2PF4E 5L0CA 4E0IA 2P61A 3HKKA 4Z9JA 1VLSA 2G3VA 1GGQA 4CS9C 4RD9A 4O6NA 4U5BE 2QLAA 2H7OA 1A7DA 2QQ3A 2P63A 4IRUA 2J7PA 2Q00A 4OIQF 5L0JA 4XLPF 3QXZA 1ZU4A 1M6TA 2ZXRA 1MMNA 1TQGA 1D1AA 1T01A 3QZCA 2GAQA 2LQGA 4JURI 3SNHA 3MYBA 4JCZA 3U9JA 1RJ9B 5A69A 3WAQA 3Q6MA 3T89A 4DXWA 2Y3BA 3O4XE 3SWXA 3QTHA 1WTYA 1TWGA 1XWJA 3QVYA 3DJUB 3EG9A 4ZLDA 4KI2A 2H8AA 4G0HA 1LE2A 3K1IC 4JZAA 2UZFA 5L3VA 3MFNA 2FFHA 4EHPA 3A9CA 4YWQA 3C62A 4I3MA 2QY9A 1NZEA 3MLGA 3R7CA 2XLMA 3C8GA 4MNDA 4IZBA 1JMWA 3W8IA 2GA0A 2L9JA 4ULWA 3VM6A 1T9KA 2KNHA 4H4KC 3CAXA 1YYJA 4MVZA 1HE1A 4FX5A 1A0BA 2GFHA 2G62A 3F46A 3SXMA 3IQ5A 3RFYA 3NYMA 1LI5A 1OCRC 4KNVA 2LFDA 2OOCA 4JVSA 3TOLA 4CX9A 2WL8A 4IB4A 3AJMA 2A6EF 1U89A 2NG1A 4GEHA 3Q0GA 3M15A 4QI2A 2UUHA 2ZXOA 3N2ZB 2FGYA 3X2QC 2J0WA 4LACB 2XXAA 5E3AA 4JE9A 3TJ6A 5JRAA 3E70C 3NYJA 3QXIA 4I4ZA 1OW7A 3DE9A 3RF3A 5FZTA 1A7VA 1WASA 4BJ5A 1E2XA 2ETSA 2ZPAA 2MHRA 1YZCA 4K3WA 2WVNA 1FMVA 1SF8A 4NTBA 4IZDA 4LERA 3LESA 4EBKA 2Q9CA 1H9GA 3AOUA 5JS5A 2J9VA 3U8PA 4EKWA 2AP3A 4O79A 2W4MA 1W2WA 1AVOB 2ZQRA 1FNTc 4AL1A 3CZ6A 1Q0MA 2IXPA 2WVQA 4MVRA 4YK5A 3NMIA 1Z23A 2HJMA 1WN0A 3WG7C 2YWAA 1O3UA 4ONSA 3EG9B 1YZAA 4K0DA 4U9EA 5JSLA 1RMVA 3A4LA 2YVKA 2IYLD 2R05A 4FAPB 5L3QA 1E85A 2J0XA 1KNYA 4CIHA 1OCOC 3C8GB 4I1MA 3U2LA 4CBEA 5FCLA 1J8MF 5T1DB 5COGA 2CCYA 2P1AA 3OA1A 2YHSA 2LFFA 3IRBA 3R0OA 4J7YA 5L0FA 3IQCA 4PK4A 1OQCA 4BEMJ 3QMKA 2XRHA 3GM2A 3NKEA 5A6BD 3P5MA 2KJGA 4EUKB 1D1CA 2CNWD 1A41A 3KMIA 1BR4A 3X1OA 4GEHB 3M79A 1F1MA 3K66A 3U9MA 4J32B 2EILC 4EIYA 4E18A 3JT1A 3U0CA 5KYUA 2MYSA 2C03A 3HINA 1D0XA 4WGZA 3RKOF 2R7VA 4ANJA 4K1OA 1BZ4A 3ZDLA 5A6JA 5AC5A 1FR0A 3N0TA 1VMAA 1EI7A 5JVEA 4EWCA 2VX2A 4XPXA 4CDVA 2R7SA 3T6BA 4OIOF 1QLEC 2JX0A 1G4WR 2V26A 1T6QA 1UX5A 4OINF 2BE5F 3ASNC 4BJTA 2WZFA 1TWHA 4DJ9A 3G4ZA 3NMJA 3JRTA 4WCZA 1LS1A 3DMDA 3ATPA 4GQHA 1Z3IX 2OJED 1EQ1A 2XS1A 2B0JA 2KW3C 4C3EA 2OJQA 4CS7A 4I52A 4LDKA 1AEPA 3KYJA 2PPYA 3ABKC 2LCHA 4LDRA 3ADBA 3SXZA 1C03A 3O6XA 1J8YF 1VK5A 4JW1A 4NQFA 1OR2A 1LIHA 3DI5A 3M1CB 3RVZA 5CI9A 1HW1A 4JKVA 4CS9A 4B6IA 5KJPA 3Q1TA 3ZIBA 4JJGA 3G4XA 4D4NA 1OKKD 1JPNA 1ORJA 5KYXA 3TD7A 3TK0A 1BR2A 4IAOA 1YLMA 2HFIA 1HZDA 2QE9A 1Q52A 2OQMA 2A0BA 3ZWIA 4P9FA 4DBQA 3NYLA 5D91A 2IXNA 4JEAA 5KYUB 2XLVA 4U9DA 2Q9AA 5L0GA 5DVWA 4LDQA 3EHNA 4FJWD 3TULA 4NC3A 2YLIA 4GYTA 3DZAA 3I5QA 4JEBA 4CDAA 2XL6A 2HZ8A 4I44A 2XLDA 2Z15A 3K1IA 4PFOA 3GEEA 1ORYA 4YT8A 1ZZPA 3B0PA 4OG1A 1DOWA 3LUTB 2A0UA 3UMIA 3NDBB 1B68A 3ZQYA 4EBBA 5B1BC 1LPEA 1PD1A 1V54C 3W4YA 4UDVA 2PBEA 2EPOA 1UX4A 3O55A 3ADCA 3C8ZA 4MVSA 3LS0A 2HW5A 5A6AA 2L6GA 1VLTA 2IOQA 2YEVA 4OIPF 3F47A 1RCPA 2EPNA 4KC9A 4U5CE 2NSGA 3ECSA 4E7SA 3U3BA 4XTKA 3JRMO 1D0ZA 1AUEA 2VH3A 3FVYA 4JCSA 4JRZA 1NZYA 2HV6A 2R7WA 2P0NA 3AG4C 1ST6A 2LD6A 2Y3GA 1TR2A 2VCAA 1ZHTA 5KYYA 4I1OB 2CGEA 1FMWA 1LI7A 3V5YA 1IZMA 3AGUA 4ZU2A 4C3BA 4DVZA 3T6JA 2AWCA 1QKRA 4U5DE 4L6RA 2B0HA 2PNOA 2DUBA 3GEIA 5JP7A 2MWQA 3I5PA 5BQIA 3GM1A 3UGPA 2AU5A 1QQ3A 1FFHA 3SEOA 1KTMA 4N6HA 1R5ID 2LSEA 3HNIA 2FBMA 4BPMA 1L7CA 1NU7D 4AE4A 2J45A 1RJNA 2GWWA 2YLGA 1HW2A 1M2OA 4XQ1A 2WZGA 3JZ0A 2XLOA 3K6BA 3I47A 4AL0A 4MW8A 3C18A 3B0VC 4ELXA 2F22A 3FDUA 3DD7A 1ORSC 3QW0A 4U19A 2D5RB 1H9TA 4KNPA 1R4TA 2DB4A 1A7EA 2XLHA 5HV9A 3EFOA 1Z7Qc 4QIIA 3CEXA 1Q0FA 1S7ZA 5CI8A 3Q0JA 5DLJA 4ULVA 3B29A 2Q4FA 1ZYRF 2PX0A 2XM4A 4ELSA 3VRCA 2CW0F 3JTLO 2I15A 1O5HA 2Q9BA 2DI3A 3EHMA 3KPHA 3LLKA 3L8IA 3R9SA 4ELWA 4IJJA 3WODF 3DM5A 2WB7A 1NZYB 2Y3DA 1N1CA 1T6UA 2OG2A 2EPKX 4Z9IA 1Y64B 1HMDA 3V7OA 5KYYB 1NFNA 1WOLA 4IZCA 2YZSA 1CGNA 4E0HA 4F47A 1JR8A 1TFKB 3FOPA 3JCUQ 3V5XA 3L34A 1NSGB 2A6HF 3US6A 3RQEA 4BEJA 3NRHA 3QK8A 4FZWC 3H2VA 1H6GA 3IEEA 3AQCA 1FFTC 1YAUO 3FAPB 4HE8D 1K40A 3EH1A 5JBXA 3N24A 4LLCA 2FW2A 4JTCB 2F6QA 2W4BA 4JCHA 2YL3A 3IPMO 2BL2A 4PJLA 3A4MA 5HSWA 4YL3A 3KYIA 4YL1A 4NTFA 4KBLA 1E86A 4OD4A 4AE4B 3R9TA 4NY3A 1QVXA 3M4BA 3W8IB 4U5HA 3U5SA 1TFOB 1G4US 1MNDA 2XLEA 4HFKB 4Q5SF 1QPUA 2XSEA 1MQVA 3SXKA 3EGDA 4BG0A 2P7VA 4HEAJ 3HRXA 3ABLC 3AG1C 2PBPA 1VB5A 2DYSC 2VCBA 2ZD9A 3IQ6A 3DWWA 2Y69C 2JPUA 3ZC4A 4KNWA 3GORA 1M2VA 5K0IA 2VB6A 3EFOB 1APCA 1U6HA 1G5ZA 3HNLA 5DQTA 3U3FA 1YYXA 2VASA 1Q0DA 3MYIA 3KQFA 2XXAB 4MVQA 4MVUA 2W9YA 1YA9A 1ZW2A 2OKUA 2IBFA 2LK4A 3S90A 3AG3C 3T4RA 3VAYA 4HFFB 2ZXPA 5EHHA 3RQFA 4MOUA 3G64A 3Q6NA 3FHDA 4DVYP 2UUIA 1IW7F 3S28A 3LLIA 2KGOA 2HUJA 3QVZA 1HE9A 4XEFA 1OW6A 2AWYA 3RH3A 2PX3A 1RKCA 4E7ZA 1HY5A 3T6GB 2A1DD 4YJWA 1M57C 1YVIA 2R9RB 3A4NA 2HSQA 3ZTZA 4K7BA 2W45A 1CPRA 1OCZC 3ITFA 1U0BB 3IHUA 3V5ZA 3LEOA 4A4AA 5A6BA 1NFOA 2QUPA 2HV7A 4WABA 2CNWA 1TWAA 4QI0A 4ZLCA 1YARO 4W8PA 5IY5C 3EPVA 4AX2A 5AGFA 3GWLA 2HKVA 5KYWA 3JYHA 5A6KA 3UR3C 1C17M 1EKYA 2HSBA 4O7GA 3NG1A 4N6CA 4N4WA 3W8HA 1OR3A 2YKZA 2FAPB 3EGDB 4JWVA 2CDQA 3RYLA 3SYNA 3SLLA 2LP4A 1XZQA 2IXMA 3MX3A 3HNKA 5EK0A 4DBRA 2GDCA 3PMRA 3EGXA 1M2VB 4CSAC 4MTGA 4NEKA 5DQZA 3MYFA 1LM3B 3KKBA 3O10A 2IXOA 4DRIB 3H81A 1H7IA 1K05A 1QZXA 1Y4CA 4OD5A 2VREA 1OXKA 2R7UA 1BR1A 3H65A 2OCCC 2J7PD 5JLIA 1DUBA 2H7BA 1NG1A 3Q7GA 1QSPA 4A2NB 5AC4A 2OEXA 2YL1A 4ER9A 4PJNA 1MMDA 1EY3A 4XEKA 1S05A 3S84A 3RW0A 3J06A 3DJNB 2E87A 4MTFA 1SZIA 3E9VA 3L1MA 1PCXA 3LAYA 2R7XA 5BQHA 4QIJA 4DOZA 4OLQA 2R7TA 1ZVZA 3CSKA 4XPWA 1YA7O 2C04A 4DRJB 5JBWA 1OKKA 4FESA 4QDLA 1JOGA 4JTAB 2ZQQA 2QTVA 1OXBA 3PZKA 5B3SC 1ZW3A 2KQ9A 4PJJA 3VF0A 3C8GD 4CS8C 5KYWB 1G8XA 3HJCA 4BJ6C 2YL0A 4O6YA 2LIGA 2J9WA 2JD3A 4AK9A 5DS6A 3GODA 1HMOA 1T6IA 3W8HB 3DAFA 3A11A 1ZHXA 4M63A 3ABMC 4JIOA 2PFDA 3T8AA 4WJ0A 4IAQA 4I42A 3U2MA 4MVOA 3HTKC 1VTMP 1VYKA 3CQZA 4JOTA 1GQAA 3ADDA 2XM0A 4IGGA 1CPQA 3SZRA 2HJ3A 2XL4A 5GPGB 3DE8A 2IM8A 2OU6A 3SXYA 5KYXB 1TKNA 3TRRA 4MQ9F 3EGXB 3TLFA 3AGTA 4LLEA 5EGYA 3PDMP 1Y6DA
chains in the Genus database with same CATH topology
3L8JA 3GM3A 3C18A 2LK4A 3BRJA 1KNYA 3C8GB 1K40A 3RQFA 2JX0A 1OW7A 1UX5A 1K04A 1OW8A 1JOGA 4R32A 3O4XE 3A4MA 1WTYA 4XEVA 3JYYA 3B71A 3IRBA 3TULA 1V4AA 3C8GD 1RJMA 4XEFA 1OW6A 1QVXA 3MFNA 3W8IB 3GM2A 3A4NA 3O10A 1UFBA 3RQGA 3K7DA 4EBKA 1ZZPA 3AM1A 3C8GA 4GEHB 1PV3A 4NNQA 2KK1A 2L6FA 3W8HB 1K05A 3L8IA 3GM1A 1KTMA 3S9OA 3U0CA 3ADBA 3ADDA 1Y64B 2PBEA 2YWAA 2JPUA 4NQFA 1UX4A 1O3UA 1WOLA 3ADCA 1WWPA 2L6HA 2L6GA 2P63A 3U3FA 4XEKA 2Q00A 3JZ0A 4EBJA 3A4LA 2HSBA 5F28E 3AJMA 3RQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTY A;  4XEV A;  1ZZP A;  2PBE A;  3JYY A;  3L8J A;  3GM3 A;  3C8G A;  3C18 A;  2YWA A;  2LK4 A;  4GEH B;  2JPU A;  3B71 A;  1PV3 A;  4NQF A;  1O3U A;  1WOL A;  2KK1 A;  3BRJ A;  1KNY A;  2L6F A;  3TUL A;  3W8H B;  3C8G B;  1V4A A;  1WWP A;  3C8G D;  1K40 A;  1K05 A;  4XEF A;  1OW6 A;  1QVX A;  2L6H A;  3RQF A;  3L8I A;  3GM1 A;  2L6G A;  3U3F A;  2JX0 A;  4XEK A;  1KTM A;  3MFN A;  3W8I B;  2Q00 A;  3JZ0 A;  4EBJ A;  3S9O A;  3U0C A;  3GM2 A;  1OW7 A;  2HSB A;  1K04 A;  5F28 E;  1OW8 A;  1JOG A;  3O10 A;  3AJM A;  1UFB A;  3RQG A;  4R32 A;  3RQE A;  3K7D A;  4EBK A; 
#chains in the Genus database with same CATH topology
 2L7A A;  4JFC A;  2YL7 A;  3T88 A;  1Q0G A;  4FZW A;  4G7O F;  5L0D A;  1VOM A;  1OW8 A;  1ZHZ A;  4MI2 A;  4N06 A;  3B71 A;  2DGJ A;  1NBB A;  1V4A A;  1RJM A;  1RKE A;  2HMZ A;  2Q7R A;  3EH2 A;  5COF A;  2EPL X;  2QNL A;  2I8B A;  3RIP A;  1UFB A;  2NPU A;  1SYQ A;  4MVM A;  2CYD A;  2EJ5 A;  3KH2 A;  3KL4 A;  2M64 A;  5DS4 A;  3TOM A;  1EA8 A;  1T5O A;  2Q3T A;  1KU2 A;  4P6I C;  3AG2 C;  3GEH A;  4C7O A;  4MS2 A;  3L0I A;  2YLD A;  4EML A;  1LE4 A;  1WWP A;  2DYR C;  4WGY A;  2EPM X;  1D1B A;  5F28 E;  1XZP A;  4YN0 B;  3OEO A;  5F5H A;  3G50 A;  1EF8 A;  1MNE A;  1M56 C;  4U5G A;  2KYH A;  2HS5 A;  4E17 A;  1MMA A;  5CIV A;  3BRJ A;  2J9B A;  1YJG A;  2X51 A;  5KYN A;  1WZ8 A;  2WVO A;  2R7Q A;  2EIM C;  1JRA A;  3UMH A;  1LVK A;  1DOV A;  1K04 A;  3EZI A;  4RBN A;  4R32 A;  5L0H A;  2YQY A;  2VCC A;  1C02 A;  4D4X A;  1JAF A;  3UGO A;  4F4B A;  3WHN A;  1Z6A A;  2WZL A;  1FTS A;  1RXQ A;  256B A;  2KK1 A;  1I5N A;  2NUP A;  4PJM A;  1V74 B;  4H54 A;  4G7H F;  1ZU5 A;  1ZHW A;  1MJ3 A;  3FXH A;  1PD0 A;  3OWT A;  1UIY A;  3C63 A;  2J46 A;  3DM9 B;  2KSF A;  1UG7 A;  3M4C A;  2J8W A;  1Q51 A;  1GS9 A;  5E3C A;  2HMQ A;  2L6H A;  4YL0 A;  1LS4 A;  3S27 A;  2ICW G;  4CJO A;  4YT2 A;  4JJF A;  2VC9 A;  4EBJ A;  1RKE B;  3DKA A;  1O87 A;  5L0I A;  4W8K A;  1JPJ A;  3H02 A;  4G78 A;  2BC5 A;  2H7V C;  3GM3 A;  4U5E E;  2NUT A;  3NMK A;  5COM A;  4OIR F;  4K2N A;  3K1H A;  1Z5Z A;  1WGW A;  3EQL F;  3BEH A;  4MW3 A;  3K33 A;  4BJ5 C;  1MMG A;  2ASR A;  4MTO A;  4BJ1 A;  3LEV A;  5B1A C;  1V55 C;  3OC7 A;  3JYY A;  2TMV P;  4C7O B;  4U1A A;  3T9O A;  3H2U A;  3ZVR A;  5TJ5 E;  2EIN C;  3UMK A;  3ZSU A;  3AQB A;  3LNR A;  3ASO C;  2KC3 A;  3S29 A;  3PHF 2;  4CSA A;  4NTA A;  1PV3 A;  3O39 A;  1BDJ B;  2L6F A;  4CDY A;  3TJ5 A;  2O9X A;  4C3D A;  4CJG A;  1NLX A;  5E33 A;  4P9T A;  3IQT A;  3ZTM A;  1CGO A;  2EIK C;  3HLZ A;  3C7J A;  3MOY A;  3FMS A;  1DCI A;  5D92 A;  4J30 B;  1EF9 A;  4JC7 A;  3UNG C;  4U18 A;  1LKX A;  4G7Z F;  5DS5 A;  1I4Z A;  5E2Q A;  3W2W A;  1SMY F;  2D4U A;  3U8V A;  4XPY A;  1VYI A;  1I4Y A;  4IAR A;  2XL8 A;  2M4E A;  2XLW A;  3TQO A;  2X0C A;  3L8J A;  1FAP B;  4DRH B;  3W2V A;  1CGM E;  2R25 A;  4NCQ A;  2A68 F;  2R7O A;  2NUP B;  1GM5 A;  4FWV A;  3QW1 A;  3B9Q A;  2AVK A;  2P6V A;  4Q7C A;  3JSZ A;  2YRF A;  5BUO A;  3ZG1 A;  2XS8 A;  1WAT A;  3VYW A;  1ZHY A;  4Q4Z F;  2R03 A;  1SR2 A;  3EJN A;  3R2P A;  2R7R A;  3DXJ F;  4CIP A;  2R02 A;  4PAC A;  2G3K A;  2Y39 A;  4XLN F;  3LJB A;  3FOO A;  2V3C C;  3GAN A;  3DAG A;  3RQG A;  3GWN A;  4JTD B;  4CS8 A;  3LS1 A;  4J7T A;  1JXZ A;  3ZQV A;  1RJ9 A;  4BJ6 A;  4U5F E;  2OEV A;  2ZXW C;  1E84 A;  2L81 A;  2NUT B;  4PR9 A;  4RDA A;  3S9O A;  5B3I A;  3I4U A;  2IEX A;  1YDI A;  3JSE O;  5F5F A;  3Q7L A;  2J9U A;  3NKD A;  1Z63 A;  5C9G A;  3MBG A;  4YT4 A;  1BBH A;  5T3W A;  3S0X A;  1OCC C;  3FDQ A;  4O6M A;  2EIJ C;  2PP4 A;  1E83 A;  4PFP A;  2RD9 A;  3PCV A;  4YT5 A;  1NU9 C;  1D0Y A;  3POV A;  1Q0K A;  2A69 F;  5T3T A;  3SP1 A;  3EZH A;  4JYL A;  3RVY A;  3B0U X;  4XEV A;  4X0R A;  2GTR A;  4XWJ A;  3FAJ A;  2Y3H A;  3HNJ A;  4Z9H A;  1TWC A;  2RSE B;  3LNM B;  1L3P A;  3K7D A;  3AM1 A;  5JT4 A;  4NNQ A;  5JUA A;  3RSI A;  5BQG A;  4IWB A;  2NSF A;  2PF4 E;  5L0C A;  4E0I A;  2P61 A;  3HKK A;  4Z9J A;  1VLS A;  2G3V A;  1GGQ A;  4CS9 C;  4RD9 A;  4O6N A;  4U5B E;  2QLA A;  2H7O A;  1A7D A;  2QQ3 A;  2P63 A;  4IRU A;  2J7P A;  2Q00 A;  4OIQ F;  5L0J A;  4XLP F;  3QXZ A;  1ZU4 A;  1M6T A;  2ZXR A;  1MMN A;  1TQG A;  1D1A A;  1T01 A;  3QZC A;  2GAQ A;  2LQG A;  4JUR I;  3SNH A;  3MYB A;  4JCZ A;  3U9J A;  1RJ9 B;  5A69 A;  3WAQ A;  3Q6M A;  3T89 A;  4DXW A;  2Y3B A;  3O4X E;  3SWX A;  3QTH A;  1WTY A;  1TWG A;  1XWJ A;  3QVY A;  3DJU B;  3EG9 A;  4ZLD A;  4KI2 A;  2H8A A;  4G0H A;  1LE2 A;  3K1I C;  4JZA A;  2UZF A;  5L3V A;  3MFN A;  2FFH A;  4EHP A;  3A9C A;  4YWQ A;  3C62 A;  4I3M A;  2QY9 A;  1NZE A;  3MLG A;  3R7C A;  2XLM A;  3C8G A;  4MND A;  4IZB A;  1JMW A;  3W8I A;  2GA0 A;  2L9J A;  4ULW A;  3VM6 A;  1T9K A;  2KNH A;  4H4K C;  3CAX A;  1YYJ A;  4MVZ A;  1HE1 A;  4FX5 A;  1A0B A;  2GFH A;  2G62 A;  3F46 A;  3SXM A;  3IQ5 A;  3RFY A;  3NYM A;  1LI5 A;  1OCR C;  4KNV A;  2LFD A;  2OOC A;  4JVS A;  3TOL A;  4CX9 A;  2WL8 A;  4IB4 A;  3AJM A;  2A6E F;  1U89 A;  2NG1 A;  4GEH A;  3Q0G A;  3M15 A;  4QI2 A;  2UUH A;  2ZXO A;  3N2Z B;  2FGY A;  3X2Q C;  2J0W A;  4LAC B;  2XXA A;  5E3A A;  4JE9 A;  3TJ6 A;  5JRA A;  3E70 C;  3NYJ A;  3QXI A;  4I4Z A;  1OW7 A;  3DE9 A;  3RF3 A;  5FZT A;  1A7V A;  1WAS A;  4BJ5 A;  1E2X A;  2ETS A;  2ZPA A;  2MHR A;  1YZC A;  4K3W A;  2WVN A;  1FMV A;  1SF8 A;  4NTB A;  4IZD A;  4LER A;  3LES A;  4EBK A;  2Q9C A;  1H9G A;  3AOU A;  5JS5 A;  2J9V A;  3U8P A;  4EKW A;  2AP3 A;  4O79 A;  2W4M A;  1W2W A;  1AVO B;  2ZQR A;  1FNT c;  4AL1 A;  3CZ6 A;  1Q0M A;  2IXP A;  2WVQ A;  4MVR A;  4YK5 A;  3NMI A;  1Z23 A;  2HJM A;  1WN0 A;  3WG7 C;  2YWA A;  1O3U A;  4ONS A;  3EG9 B;  1YZA A;  4K0D A;  4U9E A;  5JSL A;  1RMV A;  3A4L A;  2YVK A;  2IYL D;  2R05 A;  4FAP B;  5L3Q A;  1E85 A;  2J0X A;  1KNY A;  4CIH A;  1OCO C;  3C8G B;  4I1M A;  3U2L A;  4CBE A;  5FCL A;  1J8M F;  5T1D B;  5COG A;  2CCY A;  2P1A A;  3OA1 A;  2YHS A;  2LFF A;  3IRB A;  3R0O A;  4J7Y A;  5L0F A;  3IQC A;  4PK4 A;  1OQC A;  4BEM J;  3QMK A;  2XRH A;  3GM2 A;  3NKE A;  5A6B D;  3P5M A;  2KJG A;  4EUK B;  1D1C A;  2CNW D;  1A41 A;  3KMI A;  1BR4 A;  3X1O A;  4GEH B;  3M79 A;  1F1M A;  3K66 A;  3U9M A;  4J32 B;  2EIL C;  4EIY A;  4E18 A;  3JT1 A;  3U0C A;  5KYU A;  2MYS A;  2C03 A;  3HIN A;  1D0X A;  4WGZ A;  3RKO F;  2R7V A;  4ANJ A;  4K1O A;  1BZ4 A;  3ZDL A;  5A6J A;  5AC5 A;  1FR0 A;  3N0T A;  1VMA A;  1EI7 A;  5JVE A;  4EWC A;  2VX2 A;  4XPX A;  4CDV A;  2R7S A;  3T6B A;  4OIO F;  1QLE C;  2JX0 A;  1G4W R;  2V26 A;  1T6Q A;  1UX5 A;  4OIN F;  2BE5 F;  3ASN C;  4BJT A;  2WZF A;  1TWH A;  4DJ9 A;  3G4Z A;  3NMJ A;  3JRT A;  4WCZ A;  1LS1 A;  3DMD A;  3ATP A;  4GQH A;  1Z3I X;  2OJE D;  1EQ1 A;  2XS1 A;  2B0J A;  2KW3 C;  4C3E A;  2OJQ A;  4CS7 A;  4I52 A;  4LDK A;  1AEP A;  3KYJ A;  2PPY A;  3ABK C;  2LCH A;  4LDR A;  3ADB A;  3SXZ A;  1C03 A;  3O6X A;  1J8Y F;  1VK5 A;  4JW1 A;  4NQF A;  1OR2 A;  1LIH A;  3DI5 A;  3M1C B;  3RVZ A;  5CI9 A;  1HW1 A;  4JKV A;  4CS9 A;  4B6I A;  5KJP A;  3Q1T A;  3ZIB A;  4JJG A;  3G4X A;  4D4N A;  1OKK D;  1JPN A;  1ORJ A;  5KYX A;  3TD7 A;  3TK0 A;  1BR2 A;  4IAO A;  1YLM A;  2HFI A;  1HZD A;  2QE9 A;  1Q52 A;  2OQM A;  2A0B A;  3ZWI A;  4P9F A;  4DBQ A;  3NYL A;  5D91 A;  2IXN A;  4JEA A;  5KYU B;  2XLV A;  4U9D A;  2Q9A A;  5L0G A;  5DVW A;  4LDQ A;  3EHN A;  4FJW D;  3TUL A;  4NC3 A;  2YLI A;  4GYT A;  3DZA A;  3I5Q A;  4JEB A;  4CDA A;  2XL6 A;  2HZ8 A;  4I44 A;  2XLD A;  2Z15 A;  3K1I A;  4PFO A;  3GEE A;  1ORY A;  4YT8 A;  1ZZP A;  3B0P A;  4OG1 A;  1DOW A;  3LUT B;  2A0U A;  3UMI A;  3NDB B;  1B68 A;  3ZQY A;  4EBB A;  5B1B C;  1LPE A;  1PD1 A;  1V54 C;  3W4Y A;  4UDV A;  2PBE A;  2EPO A;  1UX4 A;  3O55 A;  3ADC A;  3C8Z A;  4MVS A;  3LS0 A;  2HW5 A;  5A6A A;  2L6G A;  1VLT A;  2IOQ A;  2YEV A;  4OIP F;  3F47 A;  1RCP A;  2EPN A;  4KC9 A;  4U5C E;  2NSG A;  3ECS A;  4E7S A;  3U3B A;  4XTK A;  3JRM O;  1D0Z A;  1AUE A;  2VH3 A;  3FVY A;  4JCS A;  4JRZ A;  1NZY A;  2HV6 A;  2R7W A;  2P0N A;  3AG4 C;  1ST6 A;  2LD6 A;  2Y3G A;  1TR2 A;  2VCA A;  1ZHT A;  5KYY A;  4I1O B;  2CGE A;  1FMW A;  1LI7 A;  3V5Y A;  1IZM A;  3AGU A;  4ZU2 A;  4C3B A;  4DVZ A;  3T6J A;  2AWC A;  1QKR A;  4U5D E;  4L6R A;  2B0H A;  2PNO A;  2DUB A;  3GEI A;  5JP7 A;  2MWQ A;  3I5P A;  5BQI A;  3GM1 A;  3UGP A;  2AU5 A;  1QQ3 A;  1FFH A;  3SEO A;  1KTM A;  4N6H A;  1R5I D;  2LSE A;  3HNI A;  2FBM A;  4BPM A;  1L7C A;  1NU7 D;  4AE4 A;  2J45 A;  1RJN A;  2GWW A;  2YLG A;  1HW2 A;  1M2O A;  4XQ1 A;  2WZG A;  3JZ0 A;  2XLO A;  3K6B A;  3I47 A;  4AL0 A;  4MW8 A;  3C18 A;  3B0V C;  4ELX A;  2F22 A;  3FDU A;  3DD7 A;  1ORS C;  3QW0 A;  4U19 A;  2D5R B;  1H9T A;  4KNP A;  1R4T A;  2DB4 A;  1A7E A;  2XLH A;  5HV9 A;  3EFO A;  1Z7Q c;  4QII A;  3CEX A;  1Q0F A;  1S7Z A;  5CI8 A;  3Q0J A;  5DLJ A;  4ULV A;  3B29 A;  2Q4F A;  1ZYR F;  2PX0 A;  2XM4 A;  4ELS A;  3VRC A;  2CW0 F;  3JTL O;  2I15 A;  1O5H A;  2Q9B A;  2DI3 A;  3EHM A;  3KPH A;  3LLK A;  3L8I A;  3R9S A;  4ELW A;  4IJJ A;  3WOD F;  3DM5 A;  2WB7 A;  1NZY B;  2Y3D A;  1N1C A;  1T6U A;  2OG2 A;  2EPK X;  4Z9I A;  1Y64 B;  1HMD A;  3V7O A;  5KYY B;  1NFN A;  1WOL A;  4IZC A;  2YZS A;  1CGN A;  4E0H A;  4F47 A;  1JR8 A;  1TFK B;  3FOP A;  3JCU Q;  3V5X A;  3L34 A;  1NSG B;  2A6H F;  3US6 A;  3RQE A;  4BEJ A;  3NRH A;  3QK8 A;  4FZW C;  3H2V A;  1H6G A;  3IEE A;  3AQC A;  1FFT C;  1YAU O;  3FAP B;  4HE8 D;  1K40 A;  3EH1 A;  5JBX A;  3N24 A;  4LLC A;  2FW2 A;  4JTC B;  2F6Q A;  2W4B A;  4JCH A;  2YL3 A;  3IPM O;  2BL2 A;  4PJL A;  3A4M A;  5HSW A;  4YL3 A;  3KYI A;  4YL1 A;  4NTF A;  4KBL A;  1E86 A;  4OD4 A;  4AE4 B;  3R9T A;  4NY3 A;  1QVX A;  3M4B A;  3W8I B;  4U5H A;  3U5S A;  1TFO B;  1G4U S;  1MND A;  2XLE A;  4HFK B;  4Q5S F;  1QPU A;  2XSE A;  1MQV A;  3SXK A;  3EGD A;  4BG0 A;  2P7V A;  4HEA J;  3HRX A;  3ABL C;  3AG1 C;  2PBP A;  1VB5 A;  2DYS C;  2VCB A;  2ZD9 A;  3IQ6 A;  3DWW A;  2Y69 C;  2JPU A;  3ZC4 A;  4KNW A;  3GOR A;  1M2V A;  5K0I A;  2VB6 A;  3EFO B;  1APC A;  1U6H A;  1G5Z A;  3HNL A;  5DQT A;  3U3F A;  1YYX A;  2VAS A;  1Q0D A;  3MYI A;  3KQF A;  2XXA B;  4MVQ A;  4MVU A;  2W9Y A;  1YA9 A;  1ZW2 A;  2OKU A;  2IBF A;  2LK4 A;  3S90 A;  3AG3 C;  3T4R A;  3VAY A;  4HFF B;  2ZXP A;  5EHH A;  3RQF A;  4MOU A;  3G64 A;  3Q6N A;  3FHD A;  4DVY P;  2UUI A;  1IW7 F;  3S28 A;  3LLI A;  2KGO A;  2HUJ A;  3QVZ A;  1HE9 A;  4XEF A;  1OW6 A;  2AWY A;  3RH3 A;  2PX3 A;  1RKC A;  4E7Z A;  1HY5 A;  3T6G B;  2A1D D;  4YJW A;  1M57 C;  1YVI A;  2R9R B;  3A4N A;  2HSQ A;  3ZTZ A;  4K7B A;  2W45 A;  1CPR A;  1OCZ C;  3ITF A;  1U0B B;  3IHU A;  3V5Z A;  3LEO A;  4A4A A;  5A6B A;  1NFO A;  2QUP A;  2HV7 A;  4WAB A;  2CNW A;  1TWA A;  4QI0 A;  4ZLC A;  1YAR O;  4W8P A;  5IY5 C;  3EPV A;  4AX2 A;  5AGF A;  3GWL A;  2HKV A;  5KYW A;  3JYH A;  5A6K A;  3UR3 C;  1C17 M;  1EKY A;  2HSB A;  4O7G A;  3NG1 A;  4N6C A;  4N4W A;  3W8H A;  1OR3 A;  2YKZ A;  2FAP B;  3EGD B;  4JWV A;  2CDQ A;  3RYL A;  3SYN A;  3SLL A;  2LP4 A;  1XZQ A;  2IXM A;  3MX3 A;  3HNK A;  5EK0 A;  4DBR A;  2GDC A;  3PMR A;  3EGX A;  1M2V B;  4CSA C;  4MTG A;  4NEK A;  5DQZ A;  3MYF A;  1LM3 B;  3KKB A;  3O10 A;  2IXO A;  4DRI B;  3H81 A;  1H7I A;  1K05 A;  1QZX A;  1Y4C A;  4OD5 A;  2VRE A;  1OXK A;  2R7U A;  1BR1 A;  3H65 A;  2OCC C;  2J7P D;  5JLI A;  1DUB A;  2H7B A;  1NG1 A;  3Q7G A;  1QSP A;  4A2N B;  5AC4 A;  2OEX A;  2YL1 A;  4ER9 A;  4PJN A;  1MMD A;  1EY3 A;  4XEK A;  1S05 A;  3S84 A;  3RW0 A;  3J06 A;  3DJN B;  2E87 A;  4MTF A;  1SZI A;  3E9V A;  3L1M A;  1PCX A;  3LAY A;  2R7X A;  5BQH A;  4QIJ A;  4DOZ A;  4OLQ A;  2R7T A;  1ZVZ A;  3CSK A;  4XPW A;  1YA7 O;  2C04 A;  4DRJ B;  5JBW A;  1OKK A;  4FES A;  4QDL A;  1JOG A;  4JTA B;  2ZQQ A;  2QTV A;  1OXB A;  3PZK A;  5B3S C;  1ZW3 A;  2KQ9 A;  4PJJ A;  3VF0 A;  3C8G D;  4CS8 C;  5KYW B;  1G8X A;  3HJC A;  4BJ6 C;  2YL0 A;  4O6Y A;  2LIG A;  2J9W A;  2JD3 A;  4AK9 A;  5DS6 A;  3GOD A;  1HMO A;  1T6I A;  3W8H B;  3DAF A;  3A11 A;  1ZHX A;  4M63 A;  3ABM C;  4JIO A;  2PFD A;  3T8A A;  4WJ0 A;  4IAQ A;  4I42 A;  3U2M A;  4MVO A;  3HTK C;  1VTM P;  1VYK A;  3CQZ A;  4JOT A;  1GQA A;  3ADD A;  2XM0 A;  4IGG A;  1CPQ A;  3SZR A;  2HJ3 A;  2XL4 A;  5GPG B;  3DE8 A;  2IM8 A;  2OU6 A;  3SXY A;  5KYX B;  1TKN A;  3TRR A;  4MQ9 F;  3EGX B;  3TLF A;  3AGT A;  4LLE A;  5EGY A;  3PDM P;  1Y6D A; 
#chains in the Genus database with same CATH homology
 3L8J A;  3GM3 A;  3C18 A;  2LK4 A;  3BRJ A;  1KNY A;  3C8G B;  1K40 A;  3RQF A;  2JX0 A;  1OW7 A;  1UX5 A;  1K04 A;  1OW8 A;  1JOG A;  4R32 A;  3O4X E;  3A4M A;  1WTY A;  4XEV A;  3JYY A;  3B71 A;  3IRB A;  3TUL A;  1V4A A;  3C8G D;  1RJM A;  4XEF A;  1OW6 A;  1QVX A;  3MFN A;  3W8I B;  3GM2 A;  3A4N A;  3O10 A;  1UFB A;  3RQG A;  3K7D A;  4EBK A;  1ZZP A;  3AM1 A;  3C8G A;  4GEH B;  1PV3 A;  4NNQ A;  2KK1 A;  2L6F A;  3W8H B;  1K05 A;  3L8I A;  3GM1 A;  1KTM A;  3S9O A;  3U0C A;  3ADB A;  3ADD A;  1Y64 B;  2PBE A;  2YWA A;  2JPU A;  4NQF A;  1UX4 A;  1O3U A;  1WOL A;  3ADC A;  1WWP A;  2L6H A;  2L6G A;  2P63 A;  3U3F A;  4XEK A;  2Q00 A;  3JZ0 A;  4EBJ A;  3A4L A;  2HSB A;  5F28 E;  3AJM A;  3RQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...