3RQEA

Cerebral cavernous malformation 3 (ccm3) in complex with paxillin ld1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
190
Chain Sequence
b'TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 73
structure length 190
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3rqeA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3rqeA02
2PBEA 4R32A 3GM2A 3C8GB 3U0CA 1WTYA 2L6HA 1K40A 3L8IA 2JX0A 3W8IB 1OW6A 3W8HB 1OW7A 1QVXA 4EBJA 1K04A 1OW8A 3AJMA 3RQEA 2HSBA 3L8JA 3O10A 3U3FA 3B71A 3TULA 2YWAA 2KK1A 2LK4A 3JZ0A 3GM3A 1KNYA 5F28E 3RQFA 1KTMA 1UFBA 1PV3A 3C8GA 3C8GD 3K7DA 1ZZPA 2JPUA 4NQFA 4EBKA 3MFNA 1O3UA 1WWPA 2Q00A 1K05A 3BRJA 4XEVA 3S9OA 3RQGA 3GM1A 3JYYA 4GEHB 2L6FA 3C18A 4XEFA 4XEKA 1JOGA 1V4AA 1WOLA 2L6GA
chains in the Genus database with same CATH superfamily
5E3AA 4DJ9A 3G50A 3C62A 4DVYP 3HTKC 1OW7A 2BE5F 3AGTA 4BJ6A 2OOCA 2IXMA 2J0XA 1NG1A 2EPNA 3CAXA 4I52A 3IQCA 3S84A 3LEOA 2P61A 1CPQA 2KW3C 3RFYA 3HLZA 1BZ4A 4BEJA 1VK5A 3W8HB 2HSBA 4C3BA 4J32B 4OD5A 1Z23A 5AC5A 1UX4A 1APCA 3SP1A 1A0BA 5A69A 4IGGA 1HE1A 3Q0GA 2VB6A 5KYUA 3RVZA 3EJNA 2JX0A 2ICWG 5BQIA 3AG2C 3A9CA 4XEVA 5DVWA 3A11A 3UR3C 2V3CC 4F47A 2FGYA 2DYSC 4U9DA 1TR2A 4CBEA 3L34A 2EINC 4U5HA 4DXWA 3U8VA 1R5ID 3ZIBA 4U5BE 1E2XA 3H81A 2LQGA 3PDMP 5HSWA 1WOLA 2PBEA 4GQHA 4AL0A 2CNWD 2J9BA 4JTCB 4FX5A 3EGXA 1FR0A 4WCZA 1VOMA 4K0DA 1L3PA 1F1MA 5AC4A 3VF0A 3LLIA 1WZ8A 1E85A 3OWTA 4AL1A 1JPNA 3KH2A 4MTFA 1TQGA 2JD3A 3O6XA 5CI9A 2B0HA 2WZLA 4ELWA 2EPKX 1XZPA 4CS7A 3ABKC 3CZ6A 3UMKA 3RSIA 4IZCA 1AVOB 2Q9AA 1U0BB 3ADCA 1YAUO 3TJ6A 2R7OA 5CIVA 4JIOA 4MVOA 1CGOA 5L3QA 3S9OA 1FMWA 3HNLA 3T89A 1NBBA 3QZCA 2EIMC 3T4RA 2VCBA 2HUJA 1MMDA 1MJ3A 1E86A 3ZG1A 3LNMB 2R25A 1OKKD 2WZGA 4C7OA 3JZ0A 4PJLA 1QKRA 5BQGA 3RYLA 1HE9A 2J0WA 3IQ6A 2HMQA 1ST6A 1DOVA 3SNHA 3ADBA 2XLEA 5A6AA 3VRCA 2GAQA 4NTFA 3H02A 4PJNA 2J9VA 1LE4A 1LE2A 1HW1A 4Q5SF 5B1AC 1OR2A 2XM0A 1QQ3A 3R9SA 3JT1A 4EUKB 3U3BA 3CQZA 3AG1C 4NTAA 4MNDA 2XXAB 2CNWA 1Q51A 4LERA 4WABA 2PX3A 1D0YA 3OC7A 1WTYA 2J8WA 3EFOA 4JCHA 3UMHA 1EF8A 3HRXA 1T9KA 3MYIA 1DCIA 3M79A 3S27A 4QIIA 3RVYA 4QIJA 2HV6A 1M56C 3FHDA 2XLVA 3OEOA 4I42A 1I4YA 3AG3C 4JEBA 3ZC4A 1MMAA 2Q4FA 4M63A 3O55A 1LI7A 4MOUA 3TLFA 3W2VA 2QUPA 4JVSA 3AQBA 1OW8A 3Q7LA 4PFOA 1GS9A 2E87A 2KNHA 2J9UA 4XEFA 5EK0A 1I4ZA 2L6HA 1OKKA 3W8IB 1QVXA 2C04A 4EBJA 3FMSA 2ASRA 1ORYA 5T1DB 2YWAA 5KYWA 3B0UX 3M4BA 3SLLA 1DUBA 1MQVA 4FAPB 3M4CA 3GWNA 5F5HA 1CGME 2XS1A 3IHUA 3U8PA 2VH3A 3V5ZA 1YDIA 3K6BA 4OIQF 2IBFA 4CSAA 2WVNA 3FOPA 4OIOF 3PHF2 4DRIB 4NCQA 1RKEB 1LPEA 2G3KA 5KYXA 3K33A 2G62A 2OCCC 4X0RA 4YT8A 3K1HA 2Y3HA 1DOWA 4N6CA 2XS8A 3Q1TA 2EIJC 4Z9HA 2P0NA 3ZWIA 5JLIA 1BR1A 1EI7A 4MI2A 3SEOA 2OU6A 2ZQQA 2LIGA 4J30B 3ZSUA 4YT2A 1D1BA 5T3WA 1OCRC 1YJGA 3POVA 2GTRA 3SYNA 1Z6AA 4JTDB 4N06A 1RJ9B 1GM5A 4ULVA 4O7GA 3HINA 3IQTA 3TOLA 2IM8A 4HFKB 1CGNA 4IB4A 1HMDA 1EKYA 1V54C 1ZU5A 3QVZA 3QK8A 2VREA 3CEXA 4NC3A 2A1DD 1NLXA 1FTSA 4D4NA 1FAPB 4JKVA 2MYSA 3AGUA 3QVYA 3E9VA 3MYFA 2A6EF 3NKDA 4I4ZA 3ABMC 2FAPB 4P9FA 256BA 2VC9A 1LKXA 3GODA 3U2MA 4G7HF 4IZBA 1AUEA 2D4UA 1PD0A 1XWJA 1JRAA 2A0UA 4U5DE 3J06A 2FFHA 2OEXA 2OEVA 2P63A 1OCCC 3EGDB 3A4NA 1ZU4A 1V4AA 5B3SC 2J46A 1EY3A 1U89A 3QW1A 5L0JA 2VASA 2HJ3A 3L8JA 4AE4A 3JTLO 2YLGA 1E83A 3TJ5A 4EKWA 4CX9A 2EILC 2QY9A 1NSGB 1YA7O 1PCXA 4JC7A 1A41A 2Y3GA 2GDCA 5JT4A 1I5NA 1OW6A 3K1IA 4JRZA 5L0GA 1UIYA 2PP4A 1D0XA 1RKCA 1WWPA 1MNEA 4G78A 3W8HA 4ANJA 3ECSA 3NMIA 5JUAA 1Z5ZA 2XL6A 4YT4A 3FAPB 4JOTA 2LP4A 1FNTc 2XL4A 4E7SA 1LI5A 3Q7GA 2R03A 1QPUA 2UUHA 3K7DA 4YL3A 3DE8A 3UNGC 4EBBA 2P6VA 2Y3BA 1OXBA 4IAQA 2XLMA 3NDBB 2XM4A 3N24A 3H2UA 2A6HF 3VM6A 5EGYA 1Y64B 3TQOA 1VTMP 4FZWC 1K05A 1M57C 1VB5A 2R02A 3C63A 1D1AA 5T3TA 3FVYA 1FFTC 2OJQA 1T6IA 2W9YA 1PD1A 3RF3A 2O9XA 3TULA 3B71A 3UMIA 3EHNA 1WASA 3Q6NA 2A69F 3LAYA 3FOOA 1LVKA 3HNKA 4CSAC 4EHPA 1JMWA 1HW2A 5KYNA 1ZHTA 4PJMA 4E7ZA 2A0BA 2EJ5A 1ORJA 4ZLCA 4E0HA 3S90A 3DAGA 3NYJA 4PFPA 2PX0A 5C9GA 3F46A 3DZAA 3MLGA 2YKZA 4IAOA 4KC9A 4RD9A 3RIPA 2PBPA 3NG1A 3U2LA 5JSLA 3Q6MA 1VLSA 4JEAA 4Q7CA 4AK9A 5DS5A 1QLEC 3ZDLA 4DBQA 1HZDA 4R32A 5K0IA 3T8AA 2YLDA 4E17A 1YZAA 1Q0KA 4MVUA 3EPVA 4RBNA 1Z3IX 1Q0MA 2XLDA 1L7CA 1BR2A 1ZW3A 4JTAB 4OIPF 4KNVA 3DAFA 3L8IA 4BJ5A 2WZFA 4MVMA 3KYJA 3V7OA 4U5FE 1VYKA 3G4ZA 4ELXA 1A7DA 3FXHA 3JSEO 1T6QA 5FZTA 5FCLA 2FBMA 1C02A 1YYJA 2ZD9A 2ZPAA 4XLPF 2L6FA 4CDAA 1BR4A 2ZXRA 4G7ZF 2NUTA 4K7BA 3HNJA 1R4TA 2HW5A 2NUTB 2OQMA 3JSZA 4YL0A 3S29A 2R7TA 2HJMA 2R05A 3LEVA 2BL2A 2IEXA 3FAJA 3KYIA 3IPMO 2BC5A 1TWHA 2P1AA 5A6BD 2XXAA 4RDAA 4HEAJ 1Z7Qc 2HZ8A 2IOQA 3CSKA 3DJUB 2PPYA 4KNWA 3O4XE 1M6TA 4WGZA 2R9RB 2Y3DA 3C7JA 3K1IC 2C03A 3K66A 4BJ6C 4CJOA 2XRHA 4JJFA 4JFCA 2XSEA 3AQCA 1WATA 3NMJA 4QDLA 1LS4A 3ADDA 3T9OA 1H6GA 5L0HA 5B1BC 3U9MA 2W4BA 3Q0JA 2WB7A 4XPWA 2PF4E 3KKBA 4DRJB 1EF9A 3BEHA 5L0IA 5E33A 1XZQA 3A4MA 2IXPA 3QMKA 2L7AA 2YL7A 1SYQA 4EBKA 3QXIA 2HSQA 1NZYB 4HFFB 2NUPB 1OXKA 4I1MA 4DOZA 3AOUA 4JURI 1UFBA 2EPMX 4I44A 2WL8A 2Q9BA 4MS2A 1YLMA 2AWCA 4N4WA 3W8IA 3HJCA 2DUBA 5EHHA 2AWYA 2L9JA 2GA0A 3L1MA 1B68A 4DRHB 1IW7F 3AG4C 5COGA 1ZHWA 2QLAA 5HV9A 1T6UA 2Q3TA 3WHNA 1E84A 3JYHA 3S28A 4MTOA 3C18A 1OR3A 1J8YF 3R7CA 5DS4A 4OIRF 1M2OA 2UZFA 3TK0A 1RKEA 2QQ3A 1RCPA 4W8PA 3G4XA 4XTKA 3E70C 4OLQA 3SWXA 2J9WA 1QSPA 2NPUA 4ER9A 2A68F 4OG1A 1NFNA 2Q7RA 5A6BA 5JP7A 4U18A 4BJTA 3NMKA 3SXYA 1RXQA 1TWCA 3H2VA 2H7VC 2AP3A 3LNRA 4C3DA 4BG0A 1OCOC 4XPYA 4BJ1A 2ETSA 2ZXOA 2ZXWC 5KYYB 1YARO 1KU2A 2H7OA 4YN0B 1SF8A 1RJ9A 1JAFA 3KQFA 1O5HA 3U3FA 1ZHXA 2KSFA 4KNPA 3JRMO 4JW1A 1M2VB 3I47A 3ABLC 3RQGA 2F6QA 5COFA 2RSEB 3EG9A 2R7VA 2M64A 1JXZA 1CPRA 4MVRA 1T01A 3EG9B 4BJ5C 4LDQA 5JBWA 1ZZPA 4EWCA 4GEHB 3WAQA 5COMA 2L6GA 4XLNF 2XLOA 1YYXA 4PJJA 2OJED 3MBGA 4J7YA 5TJ5E 3OA1A 1JPJA 3AJMA 4WJ0A 1SMYF 1O87A 3T6BA 2M4EA 3LJBA 1FFHA 3U5SA 2NSGA 3C8GA 3B0VC 3VAYA 3GM1A 3WG7C 4D4XA 4IZDA 3X1OA 3KPHA 3C8GB 4JYLA 3QXZA 4FJWD 5DS6A 3RQEA 3EGDA 4LLEA 3W2WA 2Z15A 3EZHA 2IYLD 3NKEA 1ZW2A 3FDQA 5L0FA 4U5CE 3GANA 3V5YA 4MTGA 3T6JA 4CJGA 2XL8A 2W4MA 4O79A 4K1OA 3LS1A 2ZQRA 4MVQA 5L3VA 4CIPA 4ONSA 3O39A 1GGQA 1C17M 4F4BA 2G3VA 3NRHA 2EIKC 4IJJA 4Z9JA 1JOGA 3A4LA 3B29A 4NY3A 2I15A 4K2NA 2D5RB 2GWWA 4Q4ZF 2CW0F 5KJPA 3HKKA 3ZTMA 3JYYA 5GPGB 3GWLA 4DBRA 3ZTZA 1ZVZA 2HMZA 2LFFA 1ZYRF 2KGOA 2VCCA 3DMDA 2RD9A 3R2PA 1YA9A 4I3MA 2KYHA 4N6HA 4E0IA 4NQFA 3MFNA 4NTBA 1MMNA 3TRRA 3EH2A 2YRFA 1HY5A 5DQTA 2DI3A 2ZXPA 4LLCA 2HKVA 4ZU2A 4LDRA 3PCVA 3EH1A 4OINF 3N0TA 3S0XA 3L0IA 2CDQA 3US6A 3V5XA 5L0CA 2HS5A 2Y39A 3FDUA 2YZSA 3UGOA 3ZQYA 3NYMA 5KYUB 2PNOA 4WGYA 2L81A 3RQFA 5F5FA 1G5ZA 4YT5A 4QI0A 3KL4A 4CIHA 5JRAA 1VLTA 4XPXA 2OKUA 1BBHA 5AGFA 3MOYA 2QNLA 4FESA 1EQ1A 5E2QA 2NG1A 1YZCA 4CS8A 3ZQVA 4U5EE 4LDKA 4IWBA 5A6JA 2YQYA 2R7WA 2P7VA 4UDVA 1EA8A 4O6NA 3EGXB 3ASOC 3SXZA 4PK4A 3GM2A 2R7UA 4JCSA 4JZAA 2R7RA 2AVKA 3LESA 2Y69C 3B9QA 2W45A 1Q0FA 3PZKA 2AU5A 2H8AA 4KBLA 1Y4CA 3X2QC 4ELSA 1NU9C 1TWAA 3MYBA 4A2NB 4KI2A 4A4AA 1Q0DA 4G0HA 3RKOF 2FW2A 3C8ZA 3GEHA 2JPUA 1A7VA 4AX2A 3AM1A 4G7OF 3KMIA 4IRUA 1VMAA 4JCZA 1TFOB 3PMRA 2MWQA 1K40A 1IZMA 4U9EA 5CI8A 3DE9A 1HMOA 1H9TA 4JWVA 1GQAA 1QZXA 2WVOA 1U6HA 4C7OB 1H7IA 4XWJA 3JCUQ 3T6GB 3HNIA 1OQCA 5D92A 3TD7A 2EPOA 1D0ZA 5D91A 1G4US 1JR8A 4QI2A 4O6MA 1ZHZA 1SR2A 4BPMA 5BUOA 2B0JA 3G64A 2LK4A 4P9TA 1Q52A 1KNYA 4P6IC 4U1AA 4H54A 2IXNA 2J45A 3T88A 3DI5A 1S7ZA 2XLWA 3R0OA 1TFKB 1MMGA 5JS5A 2J7PD 5B3IA 3IQ5A 2QE9A 3EZIA 2KQ9A 3EFOB 2YVKA 3GM3A 1KTMA 1NZYA 3I4UA 2NUPA 4CS9A 4PR9A 1Q0GA 2EPLX 1NU7D 4L6RA 3M15A 4FWVA 2VX2A 4YK5A 4C3EA 2LCHA 4EIYA 1LS1A 4NEKA 4NNQA 1NFOA 4MVZA 3DXJF 3ITFA 3SXMA 4CDYA 2DYRC 2YL1A 3WODF 5L0DA 4W8KA 2H7BA 4JE9A 1AEPA 1FMVA 3C8GD 1RMVA 2CYDA 1N1CA 1G8XA 3DWWA 4HE8D 2HV7A 1MNDA 3R9TA 1LM3B 3DJNB 2QTVA 4Z9IA 1WN0A 4JJGA 5A6KA 1S05A 3IEEA 4YL1A 4LACB 4OD4A 1A7EA 3JRTA 2X51A 4FZWA 4DVZA 3RW0A 2CCYA 2DGJA 1WGWA 5KYWB 3I5QA 3EQLF 3EHMA 4XQ1A 3P5MA 1SZIA 4CS8C 1LIHA 3F47A 4YWQA 3RH3A 2DB4A 4MW8A 3GEEA 4YJWA 4IARA 3SZRA 1BDJB 1ZHYA 5KYYA 2KC3A 4U19A 4BEMJ 4XEKA 1OCZC 3GORA 2GFHA 5IY5C 2MHRA 4MVSA 3IRBA 1RJMA 3M1CB 1TKNA 1M2VA 5KYXB 3U9JA 3GEIA 3B0PA 1PV3A 3MX3A 2NSFA 2CGEA 1O3UA 5E3CA 2YL0A 2LD6A 3TOMA 2J7PA 2LSEA 5JVEA 4B6IA 2XLHA 3QTHA 2PFDA 2R7QA 3O10A 2KK1A 4GEHA 4H4KC 4MW3A 5DLJA 2R7XA 4ULWA 1UX5A 2UUIA 3VYWA 1YVIA 4MQ9F 3ASNC 2YLIA 3SXKA 1T5OA 2WVQA 2LFDA 5BQHA 1RJNA 1UG7A 1J8MF 5F28E 2HFIA 4EMLA 5DQZA 1V55C 2OG2A 1V74B 1VYIA 2X0CA 1D1CA 1TWGA 2R7SA 3BRJA 4O6YA 2V26A 1W2WA 3DKAA 4E18A 3DM5A 3DD7A 3U0CA 2I8BA 2YHSA 3N2ZB 2IXOA 4K3WA 1K04A 1C03A 3I5PA 1G4WR 1H9GA 4J7TA 2KJGA 4GYTA 2TMVP 4I1OB 2Q9CA 2YEVA 2YL3A 3ZVRA 3UGPA 2Q00A 1NZEA 3LLKA 4CDVA 4ZLDA 3LUTB 3LS0A 1Z63A 2F22A 4PACA 3W4YA 3H65A 3ATPA 2VCAA 4U5GA 3QW0A 5JBXA 3DM9B 3NYLA 4AE4B 4CS9C 1ORSC 1Y6DA
chains in the Genus database with same CATH topology
2PBEA 3GM2A 3C8GB 3ADDA 3L8IA 1OW7A 1OW8A 3RQEA 3L8JA 3ADBA 3TULA 3B71A 2LK4A 1KNYA 5F28E 3A4MA 2L6FA 4XEFA 4EBKA 2L6HA 3W8IB 1OW6A 3W8HB 1QVXA 4EBJA 2HSBA 3U3FA 2YWAA 3GM3A 3RQFA 1KTMA 1UFBA 1UX4A 2JPUA 3AM1A 3BRJA 1WWPA 3RQGA 4XEKA 1JOGA 3A4LA 3U0CA 1WTYA 1K40A 2JX0A 3IRBA 1K04A 1RJMA 3ADCA 4NNQA 1PV3A 3K7DA 1ZZPA 1O3UA 2Q00A 3S9OA 4XEVA 3JYYA 4GEHB 3C18A 2L6GA 3C8GD 4R32A 3O4XE 3AJMA 3O10A 2KK1A 3JZ0A 2P63A 3C8GA 4NQFA 1Y64B 3MFNA 1UX5A 3A4NA 1K05A 3GM1A 1V4AA 1WOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBE A;  4R32 A;  3GM2 A;  3C8G B;  3U0C A;  1WTY A;  2L6H A;  1K40 A;  3L8I A;  2JX0 A;  3W8I B;  1OW6 A;  3W8H B;  1OW7 A;  1QVX A;  4EBJ A;  1K04 A;  1OW8 A;  3AJM A;  3RQE A;  2HSB A;  3L8J A;  3O10 A;  3U3F A;  3B71 A;  3TUL A;  2YWA A;  2KK1 A;  2LK4 A;  3JZ0 A;  3GM3 A;  1KNY A;  5F28 E;  3RQF A;  1KTM A;  1UFB A;  1PV3 A;  3C8G A;  3C8G D;  3K7D A;  1ZZP A;  2JPU A;  4NQF A;  4EBK A;  3MFN A;  1O3U A;  1WWP A;  2Q00 A;  1K05 A;  3BRJ A;  4XEV A;  3S9O A;  3RQG A;  3GM1 A;  3JYY A;  4GEH B;  2L6F A;  3C18 A;  4XEF A;  4XEK A;  1JOG A;  1V4A A;  1WOL A;  2L6G A; 
#chains in the Genus database with same CATH topology
 5E3A A;  4DJ9 A;  3G50 A;  3C62 A;  4DVY P;  3HTK C;  1OW7 A;  2BE5 F;  3AGT A;  4BJ6 A;  2OOC A;  2IXM A;  2J0X A;  1NG1 A;  2EPN A;  3CAX A;  4I52 A;  3IQC A;  3S84 A;  3LEO A;  2P61 A;  1CPQ A;  2KW3 C;  3RFY A;  3HLZ A;  1BZ4 A;  4BEJ A;  1VK5 A;  3W8H B;  2HSB A;  4C3B A;  4J32 B;  4OD5 A;  1Z23 A;  5AC5 A;  1UX4 A;  1APC A;  3SP1 A;  1A0B A;  5A69 A;  4IGG A;  1HE1 A;  3Q0G A;  2VB6 A;  5KYU A;  3RVZ A;  3EJN A;  2JX0 A;  2ICW G;  5BQI A;  3AG2 C;  3A9C A;  4XEV A;  5DVW A;  3A11 A;  3UR3 C;  2V3C C;  4F47 A;  2FGY A;  2DYS C;  4U9D A;  1TR2 A;  4CBE A;  3L34 A;  2EIN C;  4U5H A;  4DXW A;  3U8V A;  1R5I D;  3ZIB A;  4U5B E;  1E2X A;  3H81 A;  2LQG A;  3PDM P;  5HSW A;  1WOL A;  2PBE A;  4GQH A;  4AL0 A;  2CNW D;  2J9B A;  4JTC B;  4FX5 A;  3EGX A;  1FR0 A;  4WCZ A;  1VOM A;  4K0D A;  1L3P A;  1F1M A;  5AC4 A;  3VF0 A;  3LLI A;  1WZ8 A;  1E85 A;  3OWT A;  4AL1 A;  1JPN A;  3KH2 A;  4MTF A;  1TQG A;  2JD3 A;  3O6X A;  5CI9 A;  2B0H A;  2WZL A;  4ELW A;  2EPK X;  1XZP A;  4CS7 A;  3ABK C;  3CZ6 A;  3UMK A;  3RSI A;  4IZC A;  1AVO B;  2Q9A A;  1U0B B;  3ADC A;  1YAU O;  3TJ6 A;  2R7O A;  5CIV A;  4JIO A;  4MVO A;  1CGO A;  5L3Q A;  3S9O A;  1FMW A;  3HNL A;  3T89 A;  1NBB A;  3QZC A;  2EIM C;  3T4R A;  2VCB A;  2HUJ A;  1MMD A;  1MJ3 A;  1E86 A;  3ZG1 A;  3LNM B;  2R25 A;  1OKK D;  2WZG A;  4C7O A;  3JZ0 A;  4PJL A;  1QKR A;  5BQG A;  3RYL A;  1HE9 A;  2J0W A;  3IQ6 A;  2HMQ A;  1ST6 A;  1DOV A;  3SNH A;  3ADB A;  2XLE A;  5A6A A;  3VRC A;  2GAQ A;  4NTF A;  3H02 A;  4PJN A;  2J9V A;  1LE4 A;  1LE2 A;  1HW1 A;  4Q5S F;  5B1A C;  1OR2 A;  2XM0 A;  1QQ3 A;  3R9S A;  3JT1 A;  4EUK B;  3U3B A;  3CQZ A;  3AG1 C;  4NTA A;  4MND A;  2XXA B;  2CNW A;  1Q51 A;  4LER A;  4WAB A;  2PX3 A;  1D0Y A;  3OC7 A;  1WTY A;  2J8W A;  3EFO A;  4JCH A;  3UMH A;  1EF8 A;  3HRX A;  1T9K A;  3MYI A;  1DCI A;  3M79 A;  3S27 A;  4QII A;  3RVY A;  4QIJ A;  2HV6 A;  1M56 C;  3FHD A;  2XLV A;  3OEO A;  4I42 A;  1I4Y A;  3AG3 C;  4JEB A;  3ZC4 A;  1MMA A;  2Q4F A;  4M63 A;  3O55 A;  1LI7 A;  4MOU A;  3TLF A;  3W2V A;  2QUP A;  4JVS A;  3AQB A;  1OW8 A;  3Q7L A;  4PFO A;  1GS9 A;  2E87 A;  2KNH A;  2J9U A;  4XEF A;  5EK0 A;  1I4Z A;  2L6H A;  1OKK A;  3W8I B;  1QVX A;  2C04 A;  4EBJ A;  3FMS A;  2ASR A;  1ORY A;  5T1D B;  2YWA A;  5KYW A;  3B0U X;  3M4B A;  3SLL A;  1DUB A;  1MQV A;  4FAP B;  3M4C A;  3GWN A;  5F5H A;  1CGM E;  2XS1 A;  3IHU A;  3U8P A;  2VH3 A;  3V5Z A;  1YDI A;  3K6B A;  4OIQ F;  2IBF A;  4CSA A;  2WVN A;  3FOP A;  4OIO F;  3PHF 2;  4DRI B;  4NCQ A;  1RKE B;  1LPE A;  2G3K A;  5KYX A;  3K33 A;  2G62 A;  2OCC C;  4X0R A;  4YT8 A;  3K1H A;  2Y3H A;  1DOW A;  4N6C A;  2XS8 A;  3Q1T A;  2EIJ C;  4Z9H A;  2P0N A;  3ZWI A;  5JLI A;  1BR1 A;  1EI7 A;  4MI2 A;  3SEO A;  2OU6 A;  2ZQQ A;  2LIG A;  4J30 B;  3ZSU A;  4YT2 A;  1D1B A;  5T3W A;  1OCR C;  1YJG A;  3POV A;  2GTR A;  3SYN A;  1Z6A A;  4JTD B;  4N06 A;  1RJ9 B;  1GM5 A;  4ULV A;  4O7G A;  3HIN A;  3IQT A;  3TOL A;  2IM8 A;  4HFK B;  1CGN A;  4IB4 A;  1HMD A;  1EKY A;  1V54 C;  1ZU5 A;  3QVZ A;  3QK8 A;  2VRE A;  3CEX A;  4NC3 A;  2A1D D;  1NLX A;  1FTS A;  4D4N A;  1FAP B;  4JKV A;  2MYS A;  3AGU A;  3QVY A;  3E9V A;  3MYF A;  2A6E F;  3NKD A;  4I4Z A;  3ABM C;  2FAP B;  4P9F A;  256B A;  2VC9 A;  1LKX A;  3GOD A;  3U2M A;  4G7H F;  4IZB A;  1AUE A;  2D4U A;  1PD0 A;  1XWJ A;  1JRA A;  2A0U A;  4U5D E;  3J06 A;  2FFH A;  2OEX A;  2OEV A;  2P63 A;  1OCC C;  3EGD B;  3A4N A;  1ZU4 A;  1V4A A;  5B3S C;  2J46 A;  1EY3 A;  1U89 A;  3QW1 A;  5L0J A;  2VAS A;  2HJ3 A;  3L8J A;  4AE4 A;  3JTL O;  2YLG A;  1E83 A;  3TJ5 A;  4EKW A;  4CX9 A;  2EIL C;  2QY9 A;  1NSG B;  1YA7 O;  1PCX A;  4JC7 A;  1A41 A;  2Y3G A;  2GDC A;  5JT4 A;  1I5N A;  1OW6 A;  3K1I A;  4JRZ A;  5L0G A;  1UIY A;  2PP4 A;  1D0X A;  1RKC A;  1WWP A;  1MNE A;  4G78 A;  3W8H A;  4ANJ A;  3ECS A;  3NMI A;  5JUA A;  1Z5Z A;  2XL6 A;  4YT4 A;  3FAP B;  4JOT A;  2LP4 A;  1FNT c;  2XL4 A;  4E7S A;  1LI5 A;  3Q7G A;  2R03 A;  1QPU A;  2UUH A;  3K7D A;  4YL3 A;  3DE8 A;  3UNG C;  4EBB A;  2P6V A;  2Y3B A;  1OXB A;  4IAQ A;  2XLM A;  3NDB B;  2XM4 A;  3N24 A;  3H2U A;  2A6H F;  3VM6 A;  5EGY A;  1Y64 B;  3TQO A;  1VTM P;  4FZW C;  1K05 A;  1M57 C;  1VB5 A;  2R02 A;  3C63 A;  1D1A A;  5T3T A;  3FVY A;  1FFT C;  2OJQ A;  1T6I A;  2W9Y A;  1PD1 A;  3RF3 A;  2O9X A;  3TUL A;  3B71 A;  3UMI A;  3EHN A;  1WAS A;  3Q6N A;  2A69 F;  3LAY A;  3FOO A;  1LVK A;  3HNK A;  4CSA C;  4EHP A;  1JMW A;  1HW2 A;  5KYN A;  1ZHT A;  4PJM A;  4E7Z A;  2A0B A;  2EJ5 A;  1ORJ A;  4ZLC A;  4E0H A;  3S90 A;  3DAG A;  3NYJ A;  4PFP A;  2PX0 A;  5C9G A;  3F46 A;  3DZA A;  3MLG A;  2YKZ A;  4IAO A;  4KC9 A;  4RD9 A;  3RIP A;  2PBP A;  3NG1 A;  3U2L A;  5JSL A;  3Q6M A;  1VLS A;  4JEA A;  4Q7C A;  4AK9 A;  5DS5 A;  1QLE C;  3ZDL A;  4DBQ A;  1HZD A;  4R32 A;  5K0I A;  3T8A A;  2YLD A;  4E17 A;  1YZA A;  1Q0K A;  4MVU A;  3EPV A;  4RBN A;  1Z3I X;  1Q0M A;  2XLD A;  1L7C A;  1BR2 A;  1ZW3 A;  4JTA B;  4OIP F;  4KNV A;  3DAF A;  3L8I A;  4BJ5 A;  2WZF A;  4MVM A;  3KYJ A;  3V7O A;  4U5F E;  1VYK A;  3G4Z A;  4ELX A;  1A7D A;  3FXH A;  3JSE O;  1T6Q A;  5FZT A;  5FCL A;  2FBM A;  1C02 A;  1YYJ A;  2ZD9 A;  2ZPA A;  4XLP F;  2L6F A;  4CDA A;  1BR4 A;  2ZXR A;  4G7Z F;  2NUT A;  4K7B A;  3HNJ A;  1R4T A;  2HW5 A;  2NUT B;  2OQM A;  3JSZ A;  4YL0 A;  3S29 A;  2R7T A;  2HJM A;  2R05 A;  3LEV A;  2BL2 A;  2IEX A;  3FAJ A;  3KYI A;  3IPM O;  2BC5 A;  1TWH A;  2P1A A;  5A6B D;  2XXA A;  4RDA A;  4HEA J;  1Z7Q c;  2HZ8 A;  2IOQ A;  3CSK A;  3DJU B;  2PPY A;  4KNW A;  3O4X E;  1M6T A;  4WGZ A;  2R9R B;  2Y3D A;  3C7J A;  3K1I C;  2C03 A;  3K66 A;  4BJ6 C;  4CJO A;  2XRH A;  4JJF A;  4JFC A;  2XSE A;  3AQC A;  1WAT A;  3NMJ A;  4QDL A;  1LS4 A;  3ADD A;  3T9O A;  1H6G A;  5L0H A;  5B1B C;  3U9M A;  2W4B A;  3Q0J A;  2WB7 A;  4XPW A;  2PF4 E;  3KKB A;  4DRJ B;  1EF9 A;  3BEH A;  5L0I A;  5E33 A;  1XZQ A;  3A4M A;  2IXP A;  3QMK A;  2L7A A;  2YL7 A;  1SYQ A;  4EBK A;  3QXI A;  2HSQ A;  1NZY B;  4HFF B;  2NUP B;  1OXK A;  4I1M A;  4DOZ A;  3AOU A;  4JUR I;  1UFB A;  2EPM X;  4I44 A;  2WL8 A;  2Q9B A;  4MS2 A;  1YLM A;  2AWC A;  4N4W A;  3W8I A;  3HJC A;  2DUB A;  5EHH A;  2AWY A;  2L9J A;  2GA0 A;  3L1M A;  1B68 A;  4DRH B;  1IW7 F;  3AG4 C;  5COG A;  1ZHW A;  2QLA A;  5HV9 A;  1T6U A;  2Q3T A;  3WHN A;  1E84 A;  3JYH A;  3S28 A;  4MTO A;  3C18 A;  1OR3 A;  1J8Y F;  3R7C A;  5DS4 A;  4OIR F;  1M2O A;  2UZF A;  3TK0 A;  1RKE A;  2QQ3 A;  1RCP A;  4W8P A;  3G4X A;  4XTK A;  3E70 C;  4OLQ A;  3SWX A;  2J9W A;  1QSP A;  2NPU A;  4ER9 A;  2A68 F;  4OG1 A;  1NFN A;  2Q7R A;  5A6B A;  5JP7 A;  4U18 A;  4BJT A;  3NMK A;  3SXY A;  1RXQ A;  1TWC A;  3H2V A;  2H7V C;  2AP3 A;  3LNR A;  4C3D A;  4BG0 A;  1OCO C;  4XPY A;  4BJ1 A;  2ETS A;  2ZXO A;  2ZXW C;  5KYY B;  1YAR O;  1KU2 A;  2H7O A;  4YN0 B;  1SF8 A;  1RJ9 A;  1JAF A;  3KQF A;  1O5H A;  3U3F A;  1ZHX A;  2KSF A;  4KNP A;  3JRM O;  4JW1 A;  1M2V B;  3I47 A;  3ABL C;  3RQG A;  2F6Q A;  5COF A;  2RSE B;  3EG9 A;  2R7V A;  2M64 A;  1JXZ A;  1CPR A;  4MVR A;  1T01 A;  3EG9 B;  4BJ5 C;  4LDQ A;  5JBW A;  1ZZP A;  4EWC A;  4GEH B;  3WAQ A;  5COM A;  2L6G A;  4XLN F;  2XLO A;  1YYX A;  4PJJ A;  2OJE D;  3MBG A;  4J7Y A;  5TJ5 E;  3OA1 A;  1JPJ A;  3AJM A;  4WJ0 A;  1SMY F;  1O87 A;  3T6B A;  2M4E A;  3LJB A;  1FFH A;  3U5S A;  2NSG A;  3C8G A;  3B0V C;  3VAY A;  3GM1 A;  3WG7 C;  4D4X A;  4IZD A;  3X1O A;  3KPH A;  3C8G B;  4JYL A;  3QXZ A;  4FJW D;  5DS6 A;  3RQE A;  3EGD A;  4LLE A;  3W2W A;  2Z15 A;  3EZH A;  2IYL D;  3NKE A;  1ZW2 A;  3FDQ A;  5L0F A;  4U5C E;  3GAN A;  3V5Y A;  4MTG A;  3T6J A;  4CJG A;  2XL8 A;  2W4M A;  4O79 A;  4K1O A;  3LS1 A;  2ZQR A;  4MVQ A;  5L3V A;  4CIP A;  4ONS A;  3O39 A;  1GGQ A;  1C17 M;  4F4B A;  2G3V A;  3NRH A;  2EIK C;  4IJJ A;  4Z9J A;  1JOG A;  3A4L A;  3B29 A;  4NY3 A;  2I15 A;  4K2N A;  2D5R B;  2GWW A;  4Q4Z F;  2CW0 F;  5KJP A;  3HKK A;  3ZTM A;  3JYY A;  5GPG B;  3GWL A;  4DBR A;  3ZTZ A;  1ZVZ A;  2HMZ A;  2LFF A;  1ZYR F;  2KGO A;  2VCC A;  3DMD A;  2RD9 A;  3R2P A;  1YA9 A;  4I3M A;  2KYH A;  4N6H A;  4E0I A;  4NQF A;  3MFN A;  4NTB A;  1MMN A;  3TRR A;  3EH2 A;  2YRF A;  1HY5 A;  5DQT A;  2DI3 A;  2ZXP A;  4LLC A;  2HKV A;  4ZU2 A;  4LDR A;  3PCV A;  3EH1 A;  4OIN F;  3N0T A;  3S0X A;  3L0I A;  2CDQ A;  3US6 A;  3V5X A;  5L0C A;  2HS5 A;  2Y39 A;  3FDU A;  2YZS A;  3UGO A;  3ZQY A;  3NYM A;  5KYU B;  2PNO A;  4WGY A;  2L81 A;  3RQF A;  5F5F A;  1G5Z A;  4YT5 A;  4QI0 A;  3KL4 A;  4CIH A;  5JRA A;  1VLT A;  4XPX A;  2OKU A;  1BBH A;  5AGF A;  3MOY A;  2QNL A;  4FES A;  1EQ1 A;  5E2Q A;  2NG1 A;  1YZC A;  4CS8 A;  3ZQV A;  4U5E E;  4LDK A;  4IWB A;  5A6J A;  2YQY A;  2R7W A;  2P7V A;  4UDV A;  1EA8 A;  4O6N A;  3EGX B;  3ASO C;  3SXZ A;  4PK4 A;  3GM2 A;  2R7U A;  4JCS A;  4JZA A;  2R7R A;  2AVK A;  3LES A;  2Y69 C;  3B9Q A;  2W45 A;  1Q0F A;  3PZK A;  2AU5 A;  2H8A A;  4KBL A;  1Y4C A;  3X2Q C;  4ELS A;  1NU9 C;  1TWA A;  3MYB A;  4A2N B;  4KI2 A;  4A4A A;  1Q0D A;  4G0H A;  3RKO F;  2FW2 A;  3C8Z A;  3GEH A;  2JPU A;  1A7V A;  4AX2 A;  3AM1 A;  4G7O F;  3KMI A;  4IRU A;  1VMA A;  4JCZ A;  1TFO B;  3PMR A;  2MWQ A;  1K40 A;  1IZM A;  4U9E A;  5CI8 A;  3DE9 A;  1HMO A;  1H9T A;  4JWV A;  1GQA A;  1QZX A;  2WVO A;  1U6H A;  4C7O B;  1H7I A;  4XWJ A;  3JCU Q;  3T6G B;  3HNI A;  1OQC A;  5D92 A;  3TD7 A;  2EPO A;  1D0Z A;  5D91 A;  1G4U S;  1JR8 A;  4QI2 A;  4O6M A;  1ZHZ A;  1SR2 A;  4BPM A;  5BUO A;  2B0J A;  3G64 A;  2LK4 A;  4P9T A;  1Q52 A;  1KNY A;  4P6I C;  4U1A A;  4H54 A;  2IXN A;  2J45 A;  3T88 A;  3DI5 A;  1S7Z A;  2XLW A;  3R0O A;  1TFK B;  1MMG A;  5JS5 A;  2J7P D;  5B3I A;  3IQ5 A;  2QE9 A;  3EZI A;  2KQ9 A;  3EFO B;  2YVK A;  3GM3 A;  1KTM A;  1NZY A;  3I4U A;  2NUP A;  4CS9 A;  4PR9 A;  1Q0G A;  2EPL X;  1NU7 D;  4L6R A;  3M15 A;  4FWV A;  2VX2 A;  4YK5 A;  4C3E A;  2LCH A;  4EIY A;  1LS1 A;  4NEK A;  4NNQ A;  1NFO A;  4MVZ A;  3DXJ F;  3ITF A;  3SXM A;  4CDY A;  2DYR C;  2YL1 A;  3WOD F;  5L0D A;  4W8K A;  2H7B A;  4JE9 A;  1AEP A;  1FMV A;  3C8G D;  1RMV A;  2CYD A;  1N1C A;  1G8X A;  3DWW A;  4HE8 D;  2HV7 A;  1MND A;  3R9T A;  1LM3 B;  3DJN B;  2QTV A;  4Z9I A;  1WN0 A;  4JJG A;  5A6K A;  1S05 A;  3IEE A;  4YL1 A;  4LAC B;  4OD4 A;  1A7E A;  3JRT A;  2X51 A;  4FZW A;  4DVZ A;  3RW0 A;  2CCY A;  2DGJ A;  1WGW A;  5KYW B;  3I5Q A;  3EQL F;  3EHM A;  4XQ1 A;  3P5M A;  1SZI A;  4CS8 C;  1LIH A;  3F47 A;  4YWQ A;  3RH3 A;  2DB4 A;  4MW8 A;  3GEE A;  4YJW A;  4IAR A;  3SZR A;  1BDJ B;  1ZHY A;  5KYY A;  2KC3 A;  4U19 A;  4BEM J;  4XEK A;  1OCZ C;  3GOR A;  2GFH A;  5IY5 C;  2MHR A;  4MVS A;  3IRB A;  1RJM A;  3M1C B;  1TKN A;  1M2V A;  5KYX B;  3U9J A;  3GEI A;  3B0P A;  1PV3 A;  3MX3 A;  2NSF A;  2CGE A;  1O3U A;  5E3C A;  2YL0 A;  2LD6 A;  3TOM A;  2J7P A;  2LSE A;  5JVE A;  4B6I A;  2XLH A;  3QTH A;  2PFD A;  2R7Q A;  3O10 A;  2KK1 A;  4GEH A;  4H4K C;  4MW3 A;  5DLJ A;  2R7X A;  4ULW A;  1UX5 A;  2UUI A;  3VYW A;  1YVI A;  4MQ9 F;  3ASN C;  2YLI A;  3SXK A;  1T5O A;  2WVQ A;  2LFD A;  5BQH A;  1RJN A;  1UG7 A;  1J8M F;  5F28 E;  2HFI A;  4EML A;  5DQZ A;  1V55 C;  2OG2 A;  1V74 B;  1VYI A;  2X0C A;  1D1C A;  1TWG A;  2R7S A;  3BRJ A;  4O6Y A;  2V26 A;  1W2W A;  3DKA A;  4E18 A;  3DM5 A;  3DD7 A;  3U0C A;  2I8B A;  2YHS A;  3N2Z B;  2IXO A;  4K3W A;  1K04 A;  1C03 A;  3I5P A;  1G4W R;  1H9G A;  4J7T A;  2KJG A;  4GYT A;  2TMV P;  4I1O B;  2Q9C A;  2YEV A;  2YL3 A;  3ZVR A;  3UGP A;  2Q00 A;  1NZE A;  3LLK A;  4CDV A;  4ZLD A;  3LUT B;  3LS0 A;  1Z63 A;  2F22 A;  4PAC A;  3W4Y A;  3H65 A;  3ATP A;  2VCA A;  4U5G A;  3QW0 A;  5JBX A;  3DM9 B;  3NYL A;  4AE4 B;  4CS9 C;  1ORS C;  1Y6D A; 
#chains in the Genus database with same CATH homology
 2PBE A;  3GM2 A;  3C8G B;  3ADD A;  3L8I A;  1OW7 A;  1OW8 A;  3RQE A;  3L8J A;  3ADB A;  3TUL A;  3B71 A;  2LK4 A;  1KNY A;  5F28 E;  3A4M A;  2L6F A;  4XEF A;  4EBK A;  2L6H A;  3W8I B;  1OW6 A;  3W8H B;  1QVX A;  4EBJ A;  2HSB A;  3U3F A;  2YWA A;  3GM3 A;  3RQF A;  1KTM A;  1UFB A;  1UX4 A;  2JPU A;  3AM1 A;  3BRJ A;  1WWP A;  3RQG A;  4XEK A;  1JOG A;  3A4L A;  3U0C A;  1WTY A;  1K40 A;  2JX0 A;  3IRB A;  1K04 A;  1RJM A;  3ADC A;  4NNQ A;  1PV3 A;  3K7D A;  1ZZP A;  1O3U A;  2Q00 A;  3S9O A;  4XEV A;  3JYY A;  4GEH B;  3C18 A;  2L6G A;  3C8G D;  4R32 A;  3O4X E;  3AJM A;  3O10 A;  2KK1 A;  3JZ0 A;  2P63 A;  3C8G A;  4NQF A;  1Y64 B;  3MFN A;  1UX5 A;  3A4N A;  1K05 A;  3GM1 A;  1V4A A;  1WOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...