4GEHB

Crystal structure of mst4 dimerization domain complex with pdcd10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
66
structure length
65
Chain Sequence
DLVQTSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural mechanism of CCM3 heterodimerization with GCKIII kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
total genus 26
structure length 65
sequence length 66
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 4gehB00
3W8IB 3RQFA 3L8IA 3W8HB 3RQGA 3AJMA 3RQEA 3L8JA 4GEHB
chains in the Genus database with same CATH superfamily
3ADDA 3T88A 4QIJA 1HZDA 3OC7A 2F6QA 4ELWA 2PBPA 4U1AA 1Y64B 4I52A 5KJPA 4JCSA 1JXZA 1EF8A 3FDUA 4JFCA 2P63A 4K2NA 4QIIA 5JBXA 3R9SA 4FZWC 4NNQA 3TLFA 3AM1A 4K3WA 3A4MA 3R9TA 4F47A 2HW5A 2ZQQA 3Q0JA 3G64A 3QXIA 2DUBA 4I4ZA 3T89A 2VREA 1EF9A 4U18A 1NZYA 3AJMA 4OG1A 1DCIA 3PZKA 1DUBA 2ZQRA 4NEKA 1Q51A 1RJNA 3IRBA 1EY3A 3RQGA 3A4NA 1RJMA 3MYBA 2EJ5A 3ADBA 3ADCA 4I42A 4WCZA 3Q1TA 3W8HB 3HINA 4JYLA 4JOTA 3KQFA 1NZYB 2IEXA 3L8IA 2QQ3A 2GTRA 4ELSA 3W8IB 3TRRA 4FJWD 1UX4A 1WZ8A 4U19A 5JBWA 3RQFA 3R0OA 3RQEA 3L8JA 3H02A 3SWXA 3QXZA 4OLQA 4FZWA 4MI2A 1UX5A 3SLLA 3O4XE 4ELXA 1UIYA 4GEHB 4ZU2A 3Q0GA 3MOYA 2FBMA 4EMLA 1Q52A 3HRXA 2FW2A 2VX2A 3H81A 4IZDA 3RSIA 3QK8A 3T8AA 3A4LA 4JWVA 3P5MA 3I47A 2PPYA 4IZBA 5C9GA 1MJ3A 4MOUA 4IZCA 4KNPA 2UZFA
chains in the Genus database with same CATH topology
4NNQA 3ADDA 3ADBA 3ADCA 3AM1A 3A4NA 3A4MA 3W8HB 3L8IA 1Y64B 3W8IB 1UX4A 3RQFA 3A4LA 3AJMA 3RQEA 3L8JA 2P63A 1UX5A 3IRBA 3O4XE 3RQGA 4GEHB 1RJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8I B;  3RQF A;  3L8I A;  3W8H B;  3RQG A;  3AJM A;  3RQE A;  3L8J A;  4GEH B; 
#chains in the Genus database with same CATH topology
 3ADD A;  3T88 A;  4QIJ A;  1HZD A;  3OC7 A;  2F6Q A;  4ELW A;  2PBP A;  4U1A A;  1Y64 B;  4I52 A;  5KJP A;  4JCS A;  1JXZ A;  1EF8 A;  3FDU A;  4JFC A;  2P63 A;  4K2N A;  4QII A;  5JBX A;  3R9S A;  4FZW C;  4NNQ A;  3TLF A;  3AM1 A;  4K3W A;  3A4M A;  3R9T A;  4F47 A;  2HW5 A;  2ZQQ A;  3Q0J A;  3G64 A;  3QXI A;  2DUB A;  4I4Z A;  3T89 A;  2VRE A;  1EF9 A;  4U18 A;  1NZY A;  3AJM A;  4OG1 A;  1DCI A;  3PZK A;  1DUB A;  2ZQR A;  4NEK A;  1Q51 A;  1RJN A;  3IRB A;  1EY3 A;  3RQG A;  3A4N A;  1RJM A;  3MYB A;  2EJ5 A;  3ADB A;  3ADC A;  4I42 A;  4WCZ A;  3Q1T A;  3W8H B;  3HIN A;  4JYL A;  4JOT A;  3KQF A;  1NZY B;  2IEX A;  3L8I A;  2QQ3 A;  2GTR A;  4ELS A;  3W8I B;  3TRR A;  4FJW D;  1UX4 A;  1WZ8 A;  4U19 A;  5JBW A;  3RQF A;  3R0O A;  3RQE A;  3L8J A;  3H02 A;  3SWX A;  3QXZ A;  4OLQ A;  4FZW A;  4MI2 A;  1UX5 A;  3SLL A;  3O4X E;  4ELX A;  1UIY A;  4GEH B;  4ZU2 A;  3Q0G A;  3MOY A;  2FBM A;  4EML A;  1Q52 A;  3HRX A;  2FW2 A;  2VX2 A;  3H81 A;  4IZD A;  3RSI A;  3QK8 A;  3T8A A;  3A4L A;  4JWV A;  3P5M A;  3I47 A;  2PPY A;  4IZB A;  5C9G A;  1MJ3 A;  4MOU A;  4IZC A;  4KNP A;  2UZF A; 
#chains in the Genus database with same CATH homology
 4NNQ A;  3ADD A;  3ADB A;  3ADC A;  3AM1 A;  3A4N A;  3A4M A;  3W8H B;  3L8I A;  1Y64 B;  3W8I B;  1UX4 A;  3RQF A;  3A4L A;  3AJM A;  3RQE A;  3L8J A;  2P63 A;  1UX5 A;  3IRB A;  3O4X E;  3RQG A;  4GEH B;  1RJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...