4GEHB

Crystal structure of mst4 dimerization domain complex with pdcd10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
66
structure length
65
Chain Sequence
DLVQTSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 10
publication title Structural mechanism of CCM3 heterodimerization with GCKIII kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 26
structure length 65
sequence length 66
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 4gehB00
3L8JA 3RQFA 3RQEA 3W8HB 4GEHB 3W8IB 3AJMA 3RQGA 3L8IA
chains in the Genus database with same CATH superfamily
1MJ3A 2GTRA 3R9TA 2UZFA 4IZDA 3MYBA 4JCSA 4EMLA 3IRBA 4U18A 4I4ZA 3KQFA 3T88A 5JBWA 4NEKA 4FZWA 3Q0GA 3G64A 1DCIA 4K3WA 4MI2A 3RQGA 3L8IA 3OC7A 1UX4A 4U19A 3H81A 3QXIA 4FZWC 4JWVA 2P63A 3H02A 1Y64B 3T8AA 4ELXA 1EY3A 3A4NA 1JXZA 3A4MA 3SWXA 4JYLA 5KJPA 3RQFA 4FJWD 4JFCA 3W8HB 4MOUA 3W8IB 3Q0JA 3P5MA 3HINA 1NZYB 3QK8A 4K2NA 4WCZA 3SLLA 2PBPA 4OG1A 3R0OA 2DUBA 2QQ3A 4I52A 3TRRA 4QIJA 1DUBA 4U1AA 4OLQA 2IEXA 4ZU2A 1EF9A 3ADDA 5JBXA 3TLFA 3RQEA 3A4LA 4NNQA 4GEHB 3HRXA 1Q51A 1HZDA 2EJ5A 4IZCA 2ZQRA 3RSIA 2VX2A 4ELSA 3MOYA 5C9GA 3QXZA 1EF8A 1UIYA 2F6QA 4QIIA 3ADBA 3ADCA 1NZYA 3FDUA 4I42A 2FBMA 1Q52A 3O4XE 2VREA 3Q1TA 3AJMA 1RJMA 4JOTA 3T89A 4F47A 2FW2A 4ELWA 3AM1A 3PZKA 2PPYA 1WZ8A 2ZQQA 3I47A 1UX5A 3L8JA 4IZBA 4KNPA 3R9SA 2HW5A 1RJNA
chains in the Genus database with same CATH topology
2P63A 3ADCA 3ADBA 1Y64B 3A4NA 3A4MA 3IRBA 3RQFA 3W8HB 3O4XE 3ADDA 3W8IB 3AJMA 1RJMA 3RQEA 3A4LA 4NNQA 3AM1A 4GEHB 3RQGA 3L8IA 3L8JA 1UX5A 1UX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8J A;  3RQF A;  3RQE A;  3W8H B;  4GEH B;  3W8I B;  3AJM A;  3RQG A;  3L8I A; 
#chains in the Genus database with same CATH topology
 1MJ3 A;  2GTR A;  3R9T A;  2UZF A;  4IZD A;  3MYB A;  4JCS A;  4EML A;  3IRB A;  4U18 A;  4I4Z A;  3KQF A;  3T88 A;  5JBW A;  4NEK A;  4FZW A;  3Q0G A;  3G64 A;  1DCI A;  4K3W A;  4MI2 A;  3RQG A;  3L8I A;  3OC7 A;  1UX4 A;  4U19 A;  3H81 A;  3QXI A;  4FZW C;  4JWV A;  2P63 A;  3H02 A;  1Y64 B;  3T8A A;  4ELX A;  1EY3 A;  3A4N A;  1JXZ A;  3A4M A;  3SWX A;  4JYL A;  5KJP A;  3RQF A;  4FJW D;  4JFC A;  3W8H B;  4MOU A;  3W8I B;  3Q0J A;  3P5M A;  3HIN A;  1NZY B;  3QK8 A;  4K2N A;  4WCZ A;  3SLL A;  2PBP A;  4OG1 A;  3R0O A;  2DUB A;  2QQ3 A;  4I52 A;  3TRR A;  4QIJ A;  1DUB A;  4U1A A;  4OLQ A;  2IEX A;  4ZU2 A;  1EF9 A;  3ADD A;  5JBX A;  3TLF A;  3RQE A;  3A4L A;  4NNQ A;  4GEH B;  3HRX A;  1Q51 A;  1HZD A;  2EJ5 A;  4IZC A;  2ZQR A;  3RSI A;  2VX2 A;  4ELS A;  3MOY A;  5C9G A;  3QXZ A;  1EF8 A;  1UIY A;  2F6Q A;  4QII A;  3ADB A;  3ADC A;  1NZY A;  3FDU A;  4I42 A;  2FBM A;  1Q52 A;  3O4X E;  2VRE A;  3Q1T A;  3AJM A;  1RJM A;  4JOT A;  3T89 A;  4F47 A;  2FW2 A;  4ELW A;  3AM1 A;  3PZK A;  2PPY A;  1WZ8 A;  2ZQQ A;  3I47 A;  1UX5 A;  3L8J A;  4IZB A;  4KNP A;  3R9S A;  2HW5 A;  1RJN A; 
#chains in the Genus database with same CATH homology
 2P63 A;  3ADC A;  3ADB A;  1Y64 B;  3A4N A;  3A4M A;  3IRB A;  3RQF A;  3W8H B;  3O4X E;  3ADD A;  3W8I B;  3AJM A;  1RJM A;  3RQE A;  3A4L A;  4NNQ A;  3AM1 A;  4GEH B;  3RQG A;  3L8I A;  3L8J A;  1UX5 A;  1UX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...