4GEHB

Crystal structure of mst4 dimerization domain complex with pdcd10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
66
structure length
65
Chain Sequence
b'DLVQTSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 10
publication title Structural mechanism of CCM3 heterodimerization with GCKIII kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 26
structure length 65
sequence length 66
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 4gehB00
3AJMA 3RQGA 3L8IA 3W8HB 3W8IB 3L8JA 3RQFA 4GEHB 3RQEA
chains in the Genus database with same CATH superfamily
3TRRA 4EMLA 4F47A 3T88A 4FZWA 1MJ3A 4QIJA 4OG1A 3G64A 5KJPA 4U1AA 4ELWA 4U19A 4IZDA 3ADBA 3QXIA 1NZYB 2DUBA 4K3WA 1HZDA 3AM1A 3RSIA 3I47A 3P5MA 3W8HB 2PBPA 3OC7A 2VX2A 4GEHB 3R9TA 2GTRA 1UIYA 3R0OA 2VREA 2F6QA 1WZ8A 4ELSA 4JCSA 4OLQA 3RQGA 1RJNA 4MOUA 3T8AA 2ZQQA 3HRXA 1NZYA 4KNPA 2EJ5A 4JOTA 3W8IB 4JYLA 3RQFA 1Y64B 1Q51A 4ZU2A 1EF9A 3HINA 2P63A 3KQFA 3TLFA 5JBWA 2PPYA 2ZQRA 3A4MA 3FDUA 3L8JA 3Q1TA 4MI2A 3A4LA 3Q0GA 2QQ3A 4I42A 4K2NA 4JWVA 4FJWD 4JFCA 4WCZA 2UZFA 1DUBA 3SLLA 3QXZA 3MOYA 4QIIA 3ADDA 3RQEA 1EF8A 3H81A 4U18A 4IZCA 1DCIA 4I52A 3H02A 3O4XE 1RJMA 2FW2A 2HW5A 3MYBA 4NNQA 1EY3A 3SWXA 3ADCA 3AJMA 3L8IA 3T89A 1Q52A 4ELXA 3A4NA 5C9GA 2FBMA 3Q0JA 1JXZA 4FZWC 4I4ZA 2IEXA 1UX4A 5JBXA 4IZBA 3PZKA 3IRBA 1UX5A 4NEKA 3QK8A 3R9SA
chains in the Genus database with same CATH topology
3O4XE 1RJMA 3A4MA 3L8JA 4NNQA 3A4LA 3ADCA 3AJMA 3RQGA 3L8IA 3A4NA 3ADBA 1UX4A 3W8IB 3RQFA 3ADDA 1Y64B 3RQEA 3AM1A 2P63A 3IRBA 1UX5A 3W8HB 4GEHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  3RQG A;  3L8I A;  3W8H B;  3W8I B;  3L8J A;  3RQF A;  4GEH B;  3RQE A; 
#chains in the Genus database with same CATH topology
 3TRR A;  4EML A;  4F47 A;  3T88 A;  4FZW A;  1MJ3 A;  4QIJ A;  4OG1 A;  3G64 A;  5KJP A;  4U1A A;  4ELW A;  4U19 A;  4IZD A;  3ADB A;  3QXI A;  1NZY B;  2DUB A;  4K3W A;  1HZD A;  3AM1 A;  3RSI A;  3I47 A;  3P5M A;  3W8H B;  2PBP A;  3OC7 A;  2VX2 A;  4GEH B;  3R9T A;  2GTR A;  1UIY A;  3R0O A;  2VRE A;  2F6Q A;  1WZ8 A;  4ELS A;  4JCS A;  4OLQ A;  3RQG A;  1RJN A;  4MOU A;  3T8A A;  2ZQQ A;  3HRX A;  1NZY A;  4KNP A;  2EJ5 A;  4JOT A;  3W8I B;  4JYL A;  3RQF A;  1Y64 B;  1Q51 A;  4ZU2 A;  1EF9 A;  3HIN A;  2P63 A;  3KQF A;  3TLF A;  5JBW A;  2PPY A;  2ZQR A;  3A4M A;  3FDU A;  3L8J A;  3Q1T A;  4MI2 A;  3A4L A;  3Q0G A;  2QQ3 A;  4I42 A;  4K2N A;  4JWV A;  4FJW D;  4JFC A;  4WCZ A;  2UZF A;  1DUB A;  3SLL A;  3QXZ A;  3MOY A;  4QII A;  3ADD A;  3RQE A;  1EF8 A;  3H81 A;  4U18 A;  4IZC A;  1DCI A;  4I52 A;  3H02 A;  3O4X E;  1RJM A;  2FW2 A;  2HW5 A;  3MYB A;  4NNQ A;  1EY3 A;  3SWX A;  3ADC A;  3AJM A;  3L8I A;  3T89 A;  1Q52 A;  4ELX A;  3A4N A;  5C9G A;  2FBM A;  3Q0J A;  1JXZ A;  4FZW C;  4I4Z A;  2IEX A;  1UX4 A;  5JBX A;  4IZB A;  3PZK A;  3IRB A;  1UX5 A;  4NEK A;  3QK8 A;  3R9S A; 
#chains in the Genus database with same CATH homology
 3O4X E;  1RJM A;  3A4M A;  3L8J A;  4NNQ A;  3A4L A;  3ADC A;  3AJM A;  3RQG A;  3L8I A;  3A4N A;  3ADB A;  1UX4 A;  3W8I B;  3RQF A;  3ADD A;  1Y64 B;  3RQE A;  3AM1 A;  2P63 A;  3IRB A;  1UX5 A;  3W8H B;  4GEH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...