3AJMA

Crystal structure of programmed cell death 10 in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
201
structure length
201
Chain Sequence
EAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human programmed cell death 10 complexed with inositol-(1,3,4,5)-tetrakisphosphate: a novel adaptor protein involved in human cerebral cavernous malformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 10
total genus 84
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3ajmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3ajmA02
3RQFA 2HSBA 3GM3A 3AJMA 3JYYA 1ZZPA 2L6HA 1WTYA 1OW8A 1JOGA 3L8JA 3W8IB 3O10A 1O3UA 1WWPA 2Q00A 4NQFA 2PBEA 4EBJA 3MFNA 2L6FA 1K04A 5F28E 3RQGA 3U3FA 3K7DA 1QVXA 1KTMA 3S9OA 4R32A 2L6GA 2LK4A 1PV3A 3C8GB 3C18A 3BRJA 3C8GA 1OW7A 3B71A 2YWAA 4GEHB 1KNYA 2JPUA 4XEVA 3W8HB 1K40A 3GM2A 2JX0A 4XEFA 4XEKA 1UFBA 3C8GD 3TULA 3JZ0A 1WOLA 2KK1A 4EBKA 1OW6A 3U0CA 1K05A 3GM1A 3RQEA 3L8IA 1V4AA
chains in the Genus database with same CATH superfamily
1EF8A 4C3DA 3V5YA 2WZLA 4XPXA 3NMIA 1Z3IX 1U0BB 3WHNA 5JLIA 5JVEA 1UX4A 1E83A 2CNWD 3R9SA 3QZCA 3NMKA 1HE1A 2PFDA 1JPNA 4PFOA 2P63A 5JBXA 2LFDA 3RVZA 1WN0A 1KTMA 3T6BA 1HMOA 2OEVA 3C8GB 3MOYA 3GORA 2P0NA 3CAXA 1C02A 4OIOF 3U5SA 2IXOA 1G8XA 2OJQA 2PPYA 1YYJA 4BJTA 5JT4A 4WABA 4LLEA 5D91A 2F22A 2XS1A 2HJMA 2J9BA 2IYLD 3AG2C 3VYWA 1NU7D 1M56C 2J46A 1YDIA 1MMNA 2VREA 1UFBA 2L81A 2XL6A 2XLDA 3IQ6A 5A6BD 4LDRA 1NFOA 3U9JA 4G7ZF 2EPLX 1FMVA 1VK5A 1VLTA 2R7XA 3SXKA 3DZAA 3EGXB 4U5HA 2YLGA 2M4EA 3RQFA 4XWJA 2NSGA 4EUKB 4CIHA 2YLDA 5EK0A 2AVKA 2L9JA 3JYHA 1ORSC 2CNWA 3O10A 4MQ9F 4AE4B 2Q00A 3RKOF 5TJ5E 3JCUQ 1YA9A 4CS8A 3DJUB 2WVNA 4YL0A 1HE9A 2LSEA 2D5RB 1T01A 4JWVA 1LPEA 3DMDA 5KYUB 3C8ZA 1A0BA 3V7OA 4NNQA 2VCCA 2NUPB 3EJNA 4MVZA 1OR2A 2CDQA 1FNTc 4PJNA 5T3WA 4NCQA 3WODF 3J06A 3KQFA 4U1AA 2QQ3A 1YZCA 3PZKA 4CIPA 1NZYA 3DWWA 4JVSA 4EBKA 5K0IA 4P9FA 4PACA 2G3KA 3GM1A 3KMIA 4PJMA 1WZ8A 3FOOA 4O6YA 1VLSA 3M15A 4U9EA 4NC3A 5A6JA 1E86A 3GEEA 4J32B 2H7VC 2EJ5A 3PMRA 2BE5F 2BC5A 2YKZA 4I3MA 2XXAB 4JEBA 3W8IB 2PX0A 1JR8A 4JCHA 4CSAA 3EHNA 4NQFA 1OKKA 3R2PA 4IAOA 4BJ6A 5KYWB 1VYKA 2C04A 2EILC 4IJJA 1VYIA 2L6GA 2OKUA 1MMGA 2Y3GA 2ZPAA 1TWHA 4DBRA 2WVOA 3DE9A 3B71A 5B3SC 1EY3A 2A69F 1OKKD 4G78A 4M63A 2JPUA 2KC3A 4C7OB 1GM5A 1VTMP 1IW7F 2KNHA 1FR0A 1YA7O 1I4ZA 3T4RA 3G50A 3TD7A 5KYXB 3LJBA 1R4TA 2YL1A 1I4YA 1M2VA 4JJGA 1W2WA 4MVRA 3UGOA 4JCSA 3AGTA 5KYWA 4OG1A 5DS5A 5L0GA 1CPRA 2CCYA 2Q9CA 2A6EF 3EH2A 1DOWA 4ULWA 1YLMA 5BUOA 4AK9A 4BG0A 4BEMJ 5FCLA 4I52A 2KGOA 3W8IA 3C7JA 3IPMO 1LM3B 1H7IA 2XM0A 4WCZA 3B0PA 1SZIA 2W45A 1ZW3A 4U5EE 4JYLA 4D4XA 4KNWA 1XWJA 3MX3A 3O55A 3R7CA 4KNVA 3P5MA 2EIJC 5AC5A 1S05A 2IXPA 4JOTA 3OEOA 3VAYA 3HJCA 4LERA 3GEIA 4MTFA 3F46A 2EPMX 3W8HB 1TQGA 2XLHA 3T89A 2G3VA 4XPYA 1YVIA 3SNHA 2QLAA 4EKWA 3I47A 4CDVA 1Z6AA 2GFHA 2OU6A 3AQCA 3EQLF 1WOLA 3JSZA 3NG1A 1ZHWA 3Q6NA 3K1IA 3DD7A 4H4KC 1Y4CA 3FVYA 1Q0FA 3MYIA 2R7WA 5A6BA 3W8HA 3IEEA 4BJ5A 3EHMA 3JYYA 1HZDA 1OW8A 2Z15A 2Y3BA 3L8JA 2EIMC 4IZBA 2OG2A 4IZDA 1O3UA 3KH2A 3KL4A 3NYJA 3OA1A 1LIHA 3ITFA 3ZTZA 5JS5A 4I4ZA 1TWAA 2XSEA 2H7BA 2YZSA 3FAPB 3GWNA 3H65A 4J30B 5KJPA 5F28E 3ADBA 3PCVA 3U8PA 3US6A 3A4NA 4OINF 5EGYA 1FFTC 1PV3A 2MYSA 3BRJA 5JUAA 3IQ5A 2WZGA 3U8VA 2XLOA 4BEJA 1D1BA 1Q0MA 4JE9A 2NG1A 3TK0A 4A4AA 3QW1A 4DOZA 3AOUA 5E33A 2R7OA 3IHUA 3L0IA 3EGDA 3Q6MA 4BJ1A 2HMQA 1EQ1A 1NZYB 4HFKB 1TR2A 2UZFA 2M64A 1JRAA 1M2VB 1T6IA 1TWCA 2ASRA 2CW0F 2EPOA 2IXMA 1IZMA 1RKCA 1LE2A 3GEHA 3MLGA 4NTBA 3RQEA 4Q5SF 5C9GA 1QSPA 1M2OA 4MVUA 4BJ5C 2HSBA 4NTAA 4L6RA 4K1OA 3SYNA 4HFFB 1L3PA 4MW3A 1JOGA 3B9QA 5KYNA 2UUHA 3LEOA 1CGOA 3MYBA 2ICWG 1F1MA 4ONSA 4U5BE 5BQIA 2MWQA 5L0FA 1LE4A 3HTKC 2ZXRA 1APCA 3DM5A 3RF3A 4OIQF 2R9RB 1QVXA 3POVA 3S9OA 1QPUA 4K7BA 3ECSA 3PHF2 4JTDB 3AG1C 4DVZA 2J9WA 3EPVA 1FFHA 2KQ9A 4U9DA 1CGNA 1D0XA 2R7RA 2FW2A 3M4BA 3CQZA 2HS5A 3KYJA 3FAJA 2OEXA 4RDAA 5HV9A 3R0OA 1RCPA 4CBEA 3VF0A 5BQHA 3S0XA 4KBLA 3E70C 3E9VA 4K0DA 1AUEA 4PR9A 3RH3A 2EINC 3C63A 3LEVA 3NRHA 2QUPA 1LVKA 2WL8A 3UMKA 4N6HA 1SMYF 3GM3A 4G7HF 3ADCA 1RXQA 4XTKA 4CDAA 2L6HA 1WTYA 1ZW2A 2R25A 2NUPA 4FZWA 3DI5A 3FHDA 4HEAJ 4N6CA 1OCRC 4Z9JA 4DBQA 1RKEA 3CEXA 3O6XA 2BL2A 4MI2A 3HNKA 1C17M 4AL1A 5JRAA 2AU5A 4Q7CA 1M6TA 3T6JA 2LK4A 4E7SA 3IQTA 1QLEC 1HY5A 1PD1A 5CI9A 2HZ8A 4W8PA 4CS7A 4ER9A 5A69A 3QK8A 2IOQA 4P6IC 3T88A 1K40A 1E2XA 3GM2A 4ULVA 4JCZA 3EG9B 4DRJB 3ZDLA 1D0ZA 3TULA 4QI0A 3CZ6A 1ZHZA 1NSGB 1V54C 4MTOA 1OCOC 1SR2A 3S28A 1EKYA 4QI2A 3TJ6A 1NZEA 2DGJA 2G62A 3FOPA 4MVMA 4IRUA 4W8KA 1TFKB 1Q0GA 4YT5A 2R03A 4CJGA 1D1AA 4GYTA 4E0IA 3Q7GA 1ZHXA 1NFNA 4MVSA 1MNEA 1E84A 4OD4A 3MFNA 5DS4A 2P7VA 3A4MA 4WGYA 1BR2A 3Q0JA 3LLKA 1OXKA 5L0IA 4K2NA 4OIPF 1BZ4A 2LCHA 4J7YA 3X2QC 3S90A 4LDKA 5GPGB 1FTSA 1Q52A 3ZQVA 3DM9B 3K1IC 4U5DE 2HW5A 1CPQA 5L0DA 4DRIB 3V5XA 5KYYB 1UG7A 2YQYA 3JT1A 3LS1A 4G0HA 5A6AA 1G4US 4IWBA 2WVQA 4XEKA 2J8WA 4WGZA 4CSAC 1PD0A 2V3CC 3L1MA 3GWLA 1KU2A 2GDCA 2XM4A 3AG4C 3OC7A 3HKKA 3K1HA 2FGYA 4WJ0A 2VASA 256BA 2Y39A 1U89A 2Q9BA 3ASOC 2OJED 1WWPA 4E18A 3RFYA 2PBEA 3ZQYA 4JEAA 4ZU2A 4JTAB 1MJ3A 4Z9IA 2IM8A 1ST6A 2YL3A 2IEXA 1ZHYA 1NBBA 1DUBA 2W4BA 1LKXA 2D4UA 2Q9AA 3L34A 4IAQA 2QE9A 2J0WA 3RVYA 4K3WA 4F47A 2W9YA 3H81A 2DYRC 4KNPA 3I4UA 4U5CE 5T1DB 4EIYA 2O9XA 3AGUA 1T5OA 4PJJA 3TJ5A 3QW0A 3VM6A 2P61A 5KYYA 2LQGA 2WZFA 1TWGA 4GQHA 2J7PD 3B0VC 4IARA 1H9TA 4KC9A 2J9UA 3W2VA 3TQOA 3N24A 4AL0A 1V74B 5A6KA 1GQAA 3M4CA 5COMA 3G64A 3Q0GA 4C3BA 4YWQA 2VH3A 1BR4A 4LLCA 3V5ZA 3ZWIA 3DKAA 1T9KA 2AWCA 1TKNA 2Y69C 5FZTA 3ZIBA 1HW2A 5DLJA 2KSFA 3SLLA 4YL1A 1YZAA 2F6QA 1DOVA 1QKRA 3KPHA 4IB4A 4NY3A 3UMHA 2VCAA 1Z7Qc 2GWWA 4NEKA 3HINA 2WB7A 3NYMA 2VCBA 2R02A 2XLEA 2ETSA 4I42A 3SZRA 3H2VA 2P6VA 4A2NB 4GEHA 2A6HF 1FMWA 1OR3A 1OW7A 1L7CA 2DUBA 2XL8A 2TMVP 4BPMA 4EBBA 3O39A 3QMKA 4U5GA 1AVOB 3EG9A 4JURI 3S27A 1WASA 1XZQA 2J0XA 4X0RA 1VMAA 2HV7A 2AP3A 5DQTA 4YL3A 2XLMA 2GA0A 4O6MA 2B0HA 2KYHA 1K05A 4HE8D 4CDYA 4C7OA 1LS4A 3L8IA 1AEPA 1V4AA 5E2QA 2HMZA 3EZIA 5L3VA 4OIRF 2H8AA 1RKEB 1ZHTA 1DCIA 1HW1A 1M57C 3ZTMA 1EA8A 3LAYA 3QTHA 4F4BA 4JW1A 2YLIA 1MNDA 3KYIA 2HSQA 1A41A 1EI7A 2OOCA 2UUIA 2ZXPA 2OQMA 2DYSC 2LD6A 3FXHA 4YK5A 4EHPA 1Z63A 3HLZA 4ELSA 2PNOA 1UIYA 4FJWD 2I8BA 3C18A 2XLWA 4E0HA 3EGXA 4AX2A 1Y64B 1JMWA 1RJMA 2HV6A 2IBFA 4Z9HA 4MVOA 1MMDA 2W4MA 4YT4A 3NDBB 1JAFA 3LLIA 3U3BA 2A68F 2KK1A 2P1AA 5B1AC 1Q51A 4DRHB 4I1OB 5CI8A 5L0CA 3EFOA 3K33A 1OXBA 4C3EA 3DE8A 5F5FA 2YVKA 3QVZA 4QDLA 3U9MA 1NLXA 4FZWC 2LFFA 4CS9C 4OLQA 5B3IA 1CGME 3LESA 1B68A 4LACB 5KYUA 2R7QA 4CS9A 1G4WR 3JSEO 4YT8A 3SXZA 5DS6A 2HKVA 3HNIA 3FDQA 3UGPA 3ADDA 2L6FA 3FMSA 2R7UA 2V26A 1J8YF 1RJ9A 2AWYA 1T6QA 3M1CB 1VOMA 1WGWA 3GANA 4YJWA 3U3FA 1ZU4A 4JJFA 3HNJA 1PCXA 1MQVA 4XLPF 2OCCC 2ZXOA 4XPWA 2QNLA 5AGFA 2ZQQA 3AQBA 3DAGA 1T6UA 2KJGA 1J8MF 4KI2A 5E3CA 4PK4A 3T6GB 2LP4A 1YARO 2A1DD 3N0TA 1BDJB 4FESA 3C8GD 2XLVA 3JZ0A 3U0CA 2I15A 3A4LA 3W2WA 5E3AA 2JD3A 2R7TA 4P9TA 3U2MA 1U6HA 2X51A 2XRHA 3IQCA 3LNMB 3RW0A 3A9CA 3LS0A 4FX5A 3M79A 1NG1A 2J45A 1A7VA 3AG3C 5COGA 1ZYRF 4IGGA 4ELWA 3TLFA 3NKEA 4XQ1A 5DVWA 3S29A 3TOLA 5L3QA 3NYLA 3T8AA 3DJNB 2PP4A 3EH1A 2IXNA 3NMJA 3WG7C 4R32A 3MYFA 3SP1A 3B29A 4O79A 1BR1A 1O87A 1JXZA 3FDUA 1KNYA 4JRZA 1R5ID 3UR3C 1H6GA 4MS2A 2YL0A 5AC4A 4AE4A 3OWTA 2JX0A 3K6BA 2FBMA 4N06A 4CX9A 1A7EA 2FFHA 1LI5A 3TRRA 3ASNC 5JP7A 4O7GA 4E7ZA 5L0JA 2YHSA 3Q7LA 1JPJA 4FWVA 1Q0KA 4O6NA 5HSWA 3Q1TA 1ZU5A 2Q4FA 1V55C 1I5NA 3KKBA 5B1BC 1OCZC 2VX2A 3AJMA 1HMDA 2DB4A 1ZZPA 1OCCC 2C03A 2YRFA 4MNDA 2QTVA 5D92A 1NU9C 3C62A 3CSKA 4EBJA 1GGQA 1VB5A 2E87A 2CYDA 2HFIA 2HUJA 2VC9A 4ELXA 4PFPA 4BJ6C 4G7OF 2DI3A 4UDVA 4D4NA 2KW3C 3UMIA 4EWCA 1LI7A 1WATA 3C8GA 2J7PA 4ZLCA 4DJ9A 4E17A 3IRBA 4EMLA 3JRTA 4XEVA 4N4WA 4NTFA 2NPUA 2PF4E 2YL7A 3SEOA 2CGEA 5KYXA 3G4ZA 4JZAA 3DAFA 2VB6A 3I5QA 1S7ZA 1D0YA 2MHRA 4XEFA 5BQGA 2Q3TA 1LS1A 4U19A 3QVYA 3ZSUA 4DXWA 1BBHA 4MOUA 4ANJA 1GS9A 3I5PA 2EPNA 1TFOB 3LUTB 4B6IA 2Y3HA 3ZC4A 3G4XA 5EHHA 4ZLDA 2GTRA 2PX3A 5CIVA 2H7OA 3EGDB 5F5HA 1OQCA 3B0UX 2XXAA 1ORJA 4CS8C 2ZD9A 3HNLA 1FAPB 3T9OA 1H9GA 1K04A 3RQGA 3RSIA 4OD5A 2R05A 1G5ZA 2J9VA 3W4YA 1E85A 2PBPA 4JKVA 4U18A 1UX5A 4XLNF 3JTLO 3N2ZB 4QIJA 3H02A 2XS8A 2X0CA 1QZXA 5DQZA 4DVYP 2A0UA 2RD9A 1MMAA 4QIIA 4FAPB 2ZQRA 2B0JA 1RJ9B 1SF8A 1YYXA 1ORYA 3F47A 3R9TA 3NKDA 4I44A 4RD9A 5JSLA 3U2LA 1C03A 1QQ3A 3K66A 1XZPA 2Y3DA 3BEHA 4RBNA 3TOMA 1EF9A 3H2UA 2LIGA 3DXJF 4JTCB 3ATPA 4MW8A 5T3TA 3AM1A 3QXIA 2EPKX 3GODA 4JC7A 3WAQA 4YN0B 1RMVA 3RIPA 1ZVZA 2HJ3A 5IY5C 4Q4ZF 1Z5ZA 2Q7RA 2NUTA 3VRCA 4CJOA 3EFOB 2YEVA 1Q0DA 3UNGC 3S84A 1YAUO 4LDQA 5L0HA 2GAQA 3K7DA 2R7VA 3HRXA 1SYQA 3O4XE 1RJNA 3ABMC 1Y6DA 1Z23A 1D1CA 3ABKC 1YJGA 3EZHA 2NSFA 1N1CA 3JRMO 2A0BA 2YWAA 4GEHB 3MBGA 2QY9A 4H54A 4JFCA 3A11A 3ZG1A 4YT2A 3PDMP 4PJLA 2FAPB 2L7AA 2EIKC 4JIOA 2XL4A 4I1MA 3ZVRA 4MVQA 2NUTB 3SWXA 2ZXWC 2RSEB 4MTGA 5COFA 3ABLC 3RYLA 2R7SA 3X1OA 1OW6A 3SXMA 1A7DA 4IZCA 3LNRA 5JBWA 3SXYA 4J7TA 1O5HA 3QXZA 4U5FE
chains in the Genus database with same CATH topology
3RQFA 3AM1A 2HSBA 3GM3A 3AJMA 3ADCA 3JYYA 1ZZPA 2L6HA 1WTYA 1OW8A 1JOGA 3L8JA 1UX4A 3W8IB 3O10A 1O3UA 1WWPA 2Q00A 4NQFA 2PBEA 4EBJA 3ADDA 3MFNA 2L6FA 3A4MA 1K04A 5F28E 3RQGA 2P63A 3U3FA 3ADBA 1QVXA 3K7DA 3S9OA 4R32A 3A4NA 2L6GA 3O4XE 2LK4A 1PV3A 3C8GB 1UX5A 3C18A 3BRJA 3C8GA 1OW7A 3B71A 2YWAA 4GEHB 3IRBA 1Y64B 4NNQA 1RJMA 1KNYA 3W8HB 2JPUA 4XEVA 1K40A 1KTMA 3GM2A 2JX0A 4XEFA 4XEKA 1UFBA 3C8GD 3TULA 3JZ0A 1WOLA 2KK1A 4EBKA 3A4LA 1OW6A 3U0CA 1K05A 3GM1A 3RQEA 3L8IA 1V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQF A;  2HSB A;  3GM3 A;  3AJM A;  3JYY A;  1ZZP A;  2L6H A;  1WTY A;  1OW8 A;  1JOG A;  3L8J A;  3W8I B;  3O10 A;  1O3U A;  1WWP A;  2Q00 A;  4NQF A;  2PBE A;  4EBJ A;  3MFN A;  2L6F A;  1K04 A;  5F28 E;  3RQG A;  3U3F A;  3K7D A;  1QVX A;  1KTM A;  3S9O A;  4R32 A;  2L6G A;  2LK4 A;  1PV3 A;  3C8G B;  3C18 A;  3BRJ A;  3C8G A;  1OW7 A;  3B71 A;  2YWA A;  4GEH B;  1KNY A;  2JPU A;  4XEV A;  3W8H B;  1K40 A;  3GM2 A;  2JX0 A;  4XEF A;  4XEK A;  1UFB A;  3C8G D;  3TUL A;  3JZ0 A;  1WOL A;  2KK1 A;  4EBK A;  1OW6 A;  3U0C A;  1K05 A;  3GM1 A;  3RQE A;  3L8I A;  1V4A A; 
#chains in the Genus database with same CATH topology
 1EF8 A;  4C3D A;  3V5Y A;  2WZL A;  4XPX A;  3NMI A;  1Z3I X;  1U0B B;  3WHN A;  5JLI A;  5JVE A;  1UX4 A;  1E83 A;  2CNW D;  3R9S A;  3QZC A;  3NMK A;  1HE1 A;  2PFD A;  1JPN A;  4PFO A;  2P63 A;  5JBX A;  2LFD A;  3RVZ A;  1WN0 A;  1KTM A;  3T6B A;  1HMO A;  2OEV A;  3C8G B;  3MOY A;  3GOR A;  2P0N A;  3CAX A;  1C02 A;  4OIO F;  3U5S A;  2IXO A;  1G8X A;  2OJQ A;  2PPY A;  1YYJ A;  4BJT A;  5JT4 A;  4WAB A;  4LLE A;  5D91 A;  2F22 A;  2XS1 A;  2HJM A;  2J9B A;  2IYL D;  3AG2 C;  3VYW A;  1NU7 D;  1M56 C;  2J46 A;  1YDI A;  1MMN A;  2VRE A;  1UFB A;  2L81 A;  2XL6 A;  2XLD A;  3IQ6 A;  5A6B D;  4LDR A;  1NFO A;  3U9J A;  4G7Z F;  2EPL X;  1FMV A;  1VK5 A;  1VLT A;  2R7X A;  3SXK A;  3DZA A;  3EGX B;  4U5H A;  2YLG A;  2M4E A;  3RQF A;  4XWJ A;  2NSG A;  4EUK B;  4CIH A;  2YLD A;  5EK0 A;  2AVK A;  2L9J A;  3JYH A;  1ORS C;  2CNW A;  3O10 A;  4MQ9 F;  4AE4 B;  2Q00 A;  3RKO F;  5TJ5 E;  3JCU Q;  1YA9 A;  4CS8 A;  3DJU B;  2WVN A;  4YL0 A;  1HE9 A;  2LSE A;  2D5R B;  1T01 A;  4JWV A;  1LPE A;  3DMD A;  5KYU B;  3C8Z A;  1A0B A;  3V7O A;  4NNQ A;  2VCC A;  2NUP B;  3EJN A;  4MVZ A;  1OR2 A;  2CDQ A;  1FNT c;  4PJN A;  5T3W A;  4NCQ A;  3WOD F;  3J06 A;  3KQF A;  4U1A A;  2QQ3 A;  1YZC A;  3PZK A;  4CIP A;  1NZY A;  3DWW A;  4JVS A;  4EBK A;  5K0I A;  4P9F A;  4PAC A;  2G3K A;  3GM1 A;  3KMI A;  4PJM A;  1WZ8 A;  3FOO A;  4O6Y A;  1VLS A;  3M15 A;  4U9E A;  4NC3 A;  5A6J A;  1E86 A;  3GEE A;  4J32 B;  2H7V C;  2EJ5 A;  3PMR A;  2BE5 F;  2BC5 A;  2YKZ A;  4I3M A;  2XXA B;  4JEB A;  3W8I B;  2PX0 A;  1JR8 A;  4JCH A;  4CSA A;  3EHN A;  4NQF A;  1OKK A;  3R2P A;  4IAO A;  4BJ6 A;  5KYW B;  1VYK A;  2C04 A;  2EIL C;  4IJJ A;  1VYI A;  2L6G A;  2OKU A;  1MMG A;  2Y3G A;  2ZPA A;  1TWH A;  4DBR A;  2WVO A;  3DE9 A;  3B71 A;  5B3S C;  1EY3 A;  2A69 F;  1OKK D;  4G78 A;  4M63 A;  2JPU A;  2KC3 A;  4C7O B;  1GM5 A;  1VTM P;  1IW7 F;  2KNH A;  1FR0 A;  1YA7 O;  1I4Z A;  3T4R A;  3G50 A;  3TD7 A;  5KYX B;  3LJB A;  1R4T A;  2YL1 A;  1I4Y A;  1M2V A;  4JJG A;  1W2W A;  4MVR A;  3UGO A;  4JCS A;  3AGT A;  5KYW A;  4OG1 A;  5DS5 A;  5L0G A;  1CPR A;  2CCY A;  2Q9C A;  2A6E F;  3EH2 A;  1DOW A;  4ULW A;  1YLM A;  5BUO A;  4AK9 A;  4BG0 A;  4BEM J;  5FCL A;  4I52 A;  2KGO A;  3W8I A;  3C7J A;  3IPM O;  1LM3 B;  1H7I A;  2XM0 A;  4WCZ A;  3B0P A;  1SZI A;  2W45 A;  1ZW3 A;  4U5E E;  4JYL A;  4D4X A;  4KNW A;  1XWJ A;  3MX3 A;  3O55 A;  3R7C A;  4KNV A;  3P5M A;  2EIJ C;  5AC5 A;  1S05 A;  2IXP A;  4JOT A;  3OEO A;  3VAY A;  3HJC A;  4LER A;  3GEI A;  4MTF A;  3F46 A;  2EPM X;  3W8H B;  1TQG A;  2XLH A;  3T89 A;  2G3V A;  4XPY A;  1YVI A;  3SNH A;  2QLA A;  4EKW A;  3I47 A;  4CDV A;  1Z6A A;  2GFH A;  2OU6 A;  3AQC A;  3EQL F;  1WOL A;  3JSZ A;  3NG1 A;  1ZHW A;  3Q6N A;  3K1I A;  3DD7 A;  4H4K C;  1Y4C A;  3FVY A;  1Q0F A;  3MYI A;  2R7W A;  5A6B A;  3W8H A;  3IEE A;  4BJ5 A;  3EHM A;  3JYY A;  1HZD A;  1OW8 A;  2Z15 A;  2Y3B A;  3L8J A;  2EIM C;  4IZB A;  2OG2 A;  4IZD A;  1O3U A;  3KH2 A;  3KL4 A;  3NYJ A;  3OA1 A;  1LIH A;  3ITF A;  3ZTZ A;  5JS5 A;  4I4Z A;  1TWA A;  2XSE A;  2H7B A;  2YZS A;  3FAP B;  3GWN A;  3H65 A;  4J30 B;  5KJP A;  5F28 E;  3ADB A;  3PCV A;  3U8P A;  3US6 A;  3A4N A;  4OIN F;  5EGY A;  1FFT C;  1PV3 A;  2MYS A;  3BRJ A;  5JUA A;  3IQ5 A;  2WZG A;  3U8V A;  2XLO A;  4BEJ A;  1D1B A;  1Q0M A;  4JE9 A;  2NG1 A;  3TK0 A;  4A4A A;  3QW1 A;  4DOZ A;  3AOU A;  5E33 A;  2R7O A;  3IHU A;  3L0I A;  3EGD A;  3Q6M A;  4BJ1 A;  2HMQ A;  1EQ1 A;  1NZY B;  4HFK B;  1TR2 A;  2UZF A;  2M64 A;  1JRA A;  1M2V B;  1T6I A;  1TWC A;  2ASR A;  2CW0 F;  2EPO A;  2IXM A;  1IZM A;  1RKC A;  1LE2 A;  3GEH A;  3MLG A;  4NTB A;  3RQE A;  4Q5S F;  5C9G A;  1QSP A;  1M2O A;  4MVU A;  4BJ5 C;  2HSB A;  4NTA A;  4L6R A;  4K1O A;  3SYN A;  4HFF B;  1L3P A;  4MW3 A;  1JOG A;  3B9Q A;  5KYN A;  2UUH A;  3LEO A;  1CGO A;  3MYB A;  2ICW G;  1F1M A;  4ONS A;  4U5B E;  5BQI A;  2MWQ A;  5L0F A;  1LE4 A;  3HTK C;  2ZXR A;  1APC A;  3DM5 A;  3RF3 A;  4OIQ F;  2R9R B;  1QVX A;  3POV A;  3S9O A;  1QPU A;  4K7B A;  3ECS A;  3PHF 2;  4JTD B;  3AG1 C;  4DVZ A;  2J9W A;  3EPV A;  1FFH A;  2KQ9 A;  4U9D A;  1CGN A;  1D0X A;  2R7R A;  2FW2 A;  3M4B A;  3CQZ A;  2HS5 A;  3KYJ A;  3FAJ A;  2OEX A;  4RDA A;  5HV9 A;  3R0O A;  1RCP A;  4CBE A;  3VF0 A;  5BQH A;  3S0X A;  4KBL A;  3E70 C;  3E9V A;  4K0D A;  1AUE A;  4PR9 A;  3RH3 A;  2EIN C;  3C63 A;  3LEV A;  3NRH A;  2QUP A;  1LVK A;  2WL8 A;  3UMK A;  4N6H A;  1SMY F;  3GM3 A;  4G7H F;  3ADC A;  1RXQ A;  4XTK A;  4CDA A;  2L6H A;  1WTY A;  1ZW2 A;  2R25 A;  2NUP A;  4FZW A;  3DI5 A;  3FHD A;  4HEA J;  4N6C A;  1OCR C;  4Z9J A;  4DBQ A;  1RKE A;  3CEX A;  3O6X A;  2BL2 A;  4MI2 A;  3HNK A;  1C17 M;  4AL1 A;  5JRA A;  2AU5 A;  4Q7C A;  1M6T A;  3T6J A;  2LK4 A;  4E7S A;  3IQT A;  1QLE C;  1HY5 A;  1PD1 A;  5CI9 A;  2HZ8 A;  4W8P A;  4CS7 A;  4ER9 A;  5A69 A;  3QK8 A;  2IOQ A;  4P6I C;  3T88 A;  1K40 A;  1E2X A;  3GM2 A;  4ULV A;  4JCZ A;  3EG9 B;  4DRJ B;  3ZDL A;  1D0Z A;  3TUL A;  4QI0 A;  3CZ6 A;  1ZHZ A;  1NSG B;  1V54 C;  4MTO A;  1OCO C;  1SR2 A;  3S28 A;  1EKY A;  4QI2 A;  3TJ6 A;  1NZE A;  2DGJ A;  2G62 A;  3FOP A;  4MVM A;  4IRU A;  4W8K A;  1TFK B;  1Q0G A;  4YT5 A;  2R03 A;  4CJG A;  1D1A A;  4GYT A;  4E0I A;  3Q7G A;  1ZHX A;  1NFN A;  4MVS A;  1MNE A;  1E84 A;  4OD4 A;  3MFN A;  5DS4 A;  2P7V A;  3A4M A;  4WGY A;  1BR2 A;  3Q0J A;  3LLK A;  1OXK A;  5L0I A;  4K2N A;  4OIP F;  1BZ4 A;  2LCH A;  4J7Y A;  3X2Q C;  3S90 A;  4LDK A;  5GPG B;  1FTS A;  1Q52 A;  3ZQV A;  3DM9 B;  3K1I C;  4U5D E;  2HW5 A;  1CPQ A;  5L0D A;  4DRI B;  3V5X A;  5KYY B;  1UG7 A;  2YQY A;  3JT1 A;  3LS1 A;  4G0H A;  5A6A A;  1G4U S;  4IWB A;  2WVQ A;  4XEK A;  2J8W A;  4WGZ A;  4CSA C;  1PD0 A;  2V3C C;  3L1M A;  3GWL A;  1KU2 A;  2GDC A;  2XM4 A;  3AG4 C;  3OC7 A;  3HKK A;  3K1H A;  2FGY A;  4WJ0 A;  2VAS A;  256B A;  2Y39 A;  1U89 A;  2Q9B A;  3ASO C;  2OJE D;  1WWP A;  4E18 A;  3RFY A;  2PBE A;  3ZQY A;  4JEA A;  4ZU2 A;  4JTA B;  1MJ3 A;  4Z9I A;  2IM8 A;  1ST6 A;  2YL3 A;  2IEX A;  1ZHY A;  1NBB A;  1DUB A;  2W4B A;  1LKX A;  2D4U A;  2Q9A A;  3L34 A;  4IAQ A;  2QE9 A;  2J0W A;  3RVY A;  4K3W A;  4F47 A;  2W9Y A;  3H81 A;  2DYR C;  4KNP A;  3I4U A;  4U5C E;  5T1D B;  4EIY A;  2O9X A;  3AGU A;  1T5O A;  4PJJ A;  3TJ5 A;  3QW0 A;  3VM6 A;  2P61 A;  5KYY A;  2LQG A;  2WZF A;  1TWG A;  4GQH A;  2J7P D;  3B0V C;  4IAR A;  1H9T A;  4KC9 A;  2J9U A;  3W2V A;  3TQO A;  3N24 A;  4AL0 A;  1V74 B;  5A6K A;  1GQA A;  3M4C A;  5COM A;  3G64 A;  3Q0G A;  4C3B A;  4YWQ A;  2VH3 A;  1BR4 A;  4LLC A;  3V5Z A;  3ZWI A;  3DKA A;  1T9K A;  2AWC A;  1TKN A;  2Y69 C;  5FZT A;  3ZIB A;  1HW2 A;  5DLJ A;  2KSF A;  3SLL A;  4YL1 A;  1YZA A;  2F6Q A;  1DOV A;  1QKR A;  3KPH A;  4IB4 A;  4NY3 A;  3UMH A;  2VCA A;  1Z7Q c;  2GWW A;  4NEK A;  3HIN A;  2WB7 A;  3NYM A;  2VCB A;  2R02 A;  2XLE A;  2ETS A;  4I42 A;  3SZR A;  3H2V A;  2P6V A;  4A2N B;  4GEH A;  2A6H F;  1FMW A;  1OR3 A;  1OW7 A;  1L7C A;  2DUB A;  2XL8 A;  2TMV P;  4BPM A;  4EBB A;  3O39 A;  3QMK A;  4U5G A;  1AVO B;  3EG9 A;  4JUR I;  3S27 A;  1WAS A;  1XZQ A;  2J0X A;  4X0R A;  1VMA A;  2HV7 A;  2AP3 A;  5DQT A;  4YL3 A;  2XLM A;  2GA0 A;  4O6M A;  2B0H A;  2KYH A;  1K05 A;  4HE8 D;  4CDY A;  4C7O A;  1LS4 A;  3L8I A;  1AEP A;  1V4A A;  5E2Q A;  2HMZ A;  3EZI A;  5L3V A;  4OIR F;  2H8A A;  1RKE B;  1ZHT A;  1DCI A;  1HW1 A;  1M57 C;  3ZTM A;  1EA8 A;  3LAY A;  3QTH A;  4F4B A;  4JW1 A;  2YLI A;  1MND A;  3KYI A;  2HSQ A;  1A41 A;  1EI7 A;  2OOC A;  2UUI A;  2ZXP A;  2OQM A;  2DYS C;  2LD6 A;  3FXH A;  4YK5 A;  4EHP A;  1Z63 A;  3HLZ A;  4ELS A;  2PNO A;  1UIY A;  4FJW D;  2I8B A;  3C18 A;  2XLW A;  4E0H A;  3EGX A;  4AX2 A;  1Y64 B;  1JMW A;  1RJM A;  2HV6 A;  2IBF A;  4Z9H A;  4MVO A;  1MMD A;  2W4M A;  4YT4 A;  3NDB B;  1JAF A;  3LLI A;  3U3B A;  2A68 F;  2KK1 A;  2P1A A;  5B1A C;  1Q51 A;  4DRH B;  4I1O B;  5CI8 A;  5L0C A;  3EFO A;  3K33 A;  1OXB A;  4C3E A;  3DE8 A;  5F5F A;  2YVK A;  3QVZ A;  4QDL A;  3U9M A;  1NLX A;  4FZW C;  2LFF A;  4CS9 C;  4OLQ A;  5B3I A;  1CGM E;  3LES A;  1B68 A;  4LAC B;  5KYU A;  2R7Q A;  4CS9 A;  1G4W R;  3JSE O;  4YT8 A;  3SXZ A;  5DS6 A;  2HKV A;  3HNI A;  3FDQ A;  3UGP A;  3ADD A;  2L6F A;  3FMS A;  2R7U A;  2V26 A;  1J8Y F;  1RJ9 A;  2AWY A;  1T6Q A;  3M1C B;  1VOM A;  1WGW A;  3GAN A;  4YJW A;  3U3F A;  1ZU4 A;  4JJF A;  3HNJ A;  1PCX A;  1MQV A;  4XLP F;  2OCC C;  2ZXO A;  4XPW A;  2QNL A;  5AGF A;  2ZQQ A;  3AQB A;  3DAG A;  1T6U A;  2KJG A;  1J8M F;  4KI2 A;  5E3C A;  4PK4 A;  3T6G B;  2LP4 A;  1YAR O;  2A1D D;  3N0T A;  1BDJ B;  4FES A;  3C8G D;  2XLV A;  3JZ0 A;  3U0C A;  2I15 A;  3A4L A;  3W2W A;  5E3A A;  2JD3 A;  2R7T A;  4P9T A;  3U2M A;  1U6H A;  2X51 A;  2XRH A;  3IQC A;  3LNM B;  3RW0 A;  3A9C A;  3LS0 A;  4FX5 A;  3M79 A;  1NG1 A;  2J45 A;  1A7V A;  3AG3 C;  5COG A;  1ZYR F;  4IGG A;  4ELW A;  3TLF A;  3NKE A;  4XQ1 A;  5DVW A;  3S29 A;  3TOL A;  5L3Q A;  3NYL A;  3T8A A;  3DJN B;  2PP4 A;  3EH1 A;  2IXN A;  3NMJ A;  3WG7 C;  4R32 A;  3MYF A;  3SP1 A;  3B29 A;  4O79 A;  1BR1 A;  1O87 A;  1JXZ A;  3FDU A;  1KNY A;  4JRZ A;  1R5I D;  3UR3 C;  1H6G A;  4MS2 A;  2YL0 A;  5AC4 A;  4AE4 A;  3OWT A;  2JX0 A;  3K6B A;  2FBM A;  4N06 A;  4CX9 A;  1A7E A;  2FFH A;  1LI5 A;  3TRR A;  3ASN C;  5JP7 A;  4O7G A;  4E7Z A;  5L0J A;  2YHS A;  3Q7L A;  1JPJ A;  4FWV A;  1Q0K A;  4O6N A;  5HSW A;  3Q1T A;  1ZU5 A;  2Q4F A;  1V55 C;  1I5N A;  3KKB A;  5B1B C;  1OCZ C;  2VX2 A;  3AJM A;  1HMD A;  2DB4 A;  1ZZP A;  1OCC C;  2C03 A;  2YRF A;  4MND A;  2QTV A;  5D92 A;  1NU9 C;  3C62 A;  3CSK A;  4EBJ A;  1GGQ A;  1VB5 A;  2E87 A;  2CYD A;  2HFI A;  2HUJ A;  2VC9 A;  4ELX A;  4PFP A;  4BJ6 C;  4G7O F;  2DI3 A;  4UDV A;  4D4N A;  2KW3 C;  3UMI A;  4EWC A;  1LI7 A;  1WAT A;  3C8G A;  2J7P A;  4ZLC A;  4DJ9 A;  4E17 A;  3IRB A;  4EML A;  3JRT A;  4XEV A;  4N4W A;  4NTF A;  2NPU A;  2PF4 E;  2YL7 A;  3SEO A;  2CGE A;  5KYX A;  3G4Z A;  4JZA A;  3DAF A;  2VB6 A;  3I5Q A;  1S7Z A;  1D0Y A;  2MHR A;  4XEF A;  5BQG A;  2Q3T A;  1LS1 A;  4U19 A;  3QVY A;  3ZSU A;  4DXW A;  1BBH A;  4MOU A;  4ANJ A;  1GS9 A;  3I5P A;  2EPN A;  1TFO B;  3LUT B;  4B6I A;  2Y3H A;  3ZC4 A;  3G4X A;  5EHH A;  4ZLD A;  2GTR A;  2PX3 A;  5CIV A;  2H7O A;  3EGD B;  5F5H A;  1OQC A;  3B0U X;  2XXA A;  1ORJ A;  4CS8 C;  2ZD9 A;  3HNL A;  1FAP B;  3T9O A;  1H9G A;  1K04 A;  3RQG A;  3RSI A;  4OD5 A;  2R05 A;  1G5Z A;  2J9V A;  3W4Y A;  1E85 A;  2PBP A;  4JKV A;  4U18 A;  1UX5 A;  4XLN F;  3JTL O;  3N2Z B;  4QIJ A;  3H02 A;  2XS8 A;  2X0C A;  1QZX A;  5DQZ A;  4DVY P;  2A0U A;  2RD9 A;  1MMA A;  4QII A;  4FAP B;  2ZQR A;  2B0J A;  1RJ9 B;  1SF8 A;  1YYX A;  1ORY A;  3F47 A;  3R9T A;  3NKD A;  4I44 A;  4RD9 A;  5JSL A;  3U2L A;  1C03 A;  1QQ3 A;  3K66 A;  1XZP A;  2Y3D A;  3BEH A;  4RBN A;  3TOM A;  1EF9 A;  3H2U A;  2LIG A;  3DXJ F;  4JTC B;  3ATP A;  4MW8 A;  5T3T A;  3AM1 A;  3QXI A;  2EPK X;  3GOD A;  4JC7 A;  3WAQ A;  4YN0 B;  1RMV A;  3RIP A;  1ZVZ A;  2HJ3 A;  5IY5 C;  4Q4Z F;  1Z5Z A;  2Q7R A;  2NUT A;  3VRC A;  4CJO A;  3EFO B;  2YEV A;  1Q0D A;  3UNG C;  3S84 A;  1YAU O;  4LDQ A;  5L0H A;  2GAQ A;  3K7D A;  2R7V A;  3HRX A;  1SYQ A;  3O4X E;  1RJN A;  3ABM C;  1Y6D A;  1Z23 A;  1D1C A;  3ABK C;  1YJG A;  3EZH A;  2NSF A;  1N1C A;  3JRM O;  2A0B A;  2YWA A;  4GEH B;  3MBG A;  2QY9 A;  4H54 A;  4JFC A;  3A11 A;  3ZG1 A;  4YT2 A;  3PDM P;  4PJL A;  2FAP B;  2L7A A;  2EIK C;  4JIO A;  2XL4 A;  4I1M A;  3ZVR A;  4MVQ A;  2NUT B;  3SWX A;  2ZXW C;  2RSE B;  4MTG A;  5COF A;  3ABL C;  3RYL A;  2R7S A;  3X1O A;  1OW6 A;  3SXM A;  1A7D A;  4IZC A;  3LNR A;  5JBW A;  3SXY A;  4J7T A;  1O5H A;  3QXZ A;  4U5F E; 
#chains in the Genus database with same CATH homology
 3RQF A;  3AM1 A;  2HSB A;  3GM3 A;  3AJM A;  3ADC A;  3JYY A;  1ZZP A;  2L6H A;  1WTY A;  1OW8 A;  1JOG A;  3L8J A;  1UX4 A;  3W8I B;  3O10 A;  1O3U A;  1WWP A;  2Q00 A;  4NQF A;  2PBE A;  4EBJ A;  3ADD A;  3MFN A;  2L6F A;  3A4M A;  1K04 A;  5F28 E;  3RQG A;  2P63 A;  3U3F A;  3ADB A;  1QVX A;  3K7D A;  3S9O A;  4R32 A;  3A4N A;  2L6G A;  3O4X E;  2LK4 A;  1PV3 A;  3C8G B;  1UX5 A;  3C18 A;  3BRJ A;  3C8G A;  1OW7 A;  3B71 A;  2YWA A;  4GEH B;  3IRB A;  1Y64 B;  4NNQ A;  1RJM A;  1KNY A;  3W8H B;  2JPU A;  4XEV A;  1K40 A;  1KTM A;  3GM2 A;  2JX0 A;  4XEF A;  4XEK A;  1UFB A;  3C8G D;  3TUL A;  3JZ0 A;  1WOL A;  2KK1 A;  4EBK A;  3A4L A;  1OW6 A;  3U0C A;  1K05 A;  3GM1 A;  3RQE A;  3L8I A;  1V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...