3AJMA

Crystal structure of programmed cell death 10 in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
201
structure length
201
Chain Sequence
b'EAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of human programmed cell death 10 complexed with inositol-(1,3,4,5)-tetrakisphosphate: a novel adaptor protein involved in human cerebral cavernous malformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 84
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3ajmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3ajmA02
1UFBA 1WOLA 2HSBA 4NQFA 4EBJA 1KNYA 3U3FA 2PBEA 1KTMA 1OW6A 2L6HA 3C18A 5F28E 4GEHB 3GM1A 3B71A 3JZ0A 3O10A 2L6GA 3L8IA 3L8JA 1K05A 3RQEA 2L6FA 2YWAA 4XEKA 3C8GB 3BRJA 4XEVA 1V4AA 2Q00A 3S9OA 3K7DA 4EBKA 3W8IB 1ZZPA 1OW8A 3RQGA 1O3UA 1PV3A 2JPUA 1K40A 3GM3A 3JYYA 2KK1A 3C8GA 3GM2A 1WWPA 1JOGA 3MFNA 1OW7A 1WTYA 3TULA 3C8GD 4R32A 2JX0A 1K04A 3U0CA 3AJMA 3RQFA 1QVXA 4XEFA 3W8HB 2LK4A
chains in the Genus database with same CATH superfamily
1JRAA 4CIHA 4FZWA 2LP4A 3O55A 1ZYRF 4BJTA 4N6HA 2A1DD 1PCXA 2AWCA 5TJ5E 2FGYA 4I1MA 5KYUB 3ZSUA 3NYLA 2XL4A 2L6HA 3C62A 4AL0A 1MNEA 3TK0A 2A0UA 2OG2A 3IEEA 4E17A 4KNWA 3FHDA 1LE4A 1A7DA 2RD9A 2XS8A 1OXBA 4YL1A 3U5SA 4BJ6A 2Y3BA 1D0ZA 3N24A 2WZFA 5A6BD 1OKKD 2R7RA 1Y64B 1BR1A 3C18A 4OLQA 3VYWA 4G7OF 2Q3TA 3RQEA 5JBXA 2P61A 2Y39A 4IAOA 4OIRF 4RD9A 1OW7A 2AP3A 3S0XA 4ER9A 4FESA 1Q0KA 1ZHXA 1G4US 1VYIA 3SLLA 5E3CA 3KH2A 4HE8D 2QNLA 1E2XA 3GM3A 4D4XA 2D4UA 5F5FA 2LQGA 2KSFA 2LK4A 2UUIA 3PZKA 1I4YA 1BZ4A 3FMSA 3JTLO 3ZTMA 1NU7D 3M15A 2YL0A 4J30B 3EGXA 4WJ0A 4CS9A 2R7OA 2A6EF 3AG4C 3MX3A 4ULVA 4JE9A 4ONSA 3AM1A 1A41A 3DKAA 1N1CA 3U3BA 4K3WA 1TKNA 4MW3A 4X0RA 2WZLA 3AG2C 1MQVA 4XPXA 1RKEA 1C02A 3J06A 2HSQA 5DS5A 5JBWA 4EBJA 1OCZC 1D1AA 1YJGA 1T01A 2XLMA 1CGNA 2CDQA 2PNOA 5BQGA 4CBEA 1WWPA 3WODF 1K04A 2EPKX 5DS4A 1I4ZA 4XLPF 3MYBA 4I3MA 4MW8A 4E18A 2ZQRA 4JC7A 5DQZA 4A2NB 5JT4A 3RQFA 3L1MA 2G3KA 2G62A 2IYLD 3T4RA 3ABMC 2QY9A 4ULWA 4U19A 3A11A 2QQ3A 4CJGA 3U2LA 4E7ZA 4XLNF 4YT4A 1WATA 1V54C 1W2WA 4MQ9F 1FFTC 2O9XA 2VCAA 1LM3B 4N06A 3DM5A 1NG1A 4OIQF 1VK5A 3EHNA 1HE1A 2A6HF 4Q5SF 2QLAA 4JJFA 3EGDA 3O6XA 2HFIA 4ELXA 4XQ1A 3U2MA 1FMVA 3T8AA 3TJ6A 4JCHA 2OJQA 4Q7CA 2QTVA 2XM0A 2OU6A 3ZQYA 3R0OA 1RJNA 1A7EA 4U5FE 2Y3HA 2YZSA 4UDVA 4NC3A 3I5QA 4E0IA 3F47A 2HKVA 2DB4A 3NKDA 3O4XE 2KJGA 3T9OA 1E84A 4N6CA 3OEOA 5L0HA 2Q7RA 3T6BA 2Q9CA 5L0JA 4XPYA 3HNJA 3T6JA 4YT2A 1NZYB 2YVKA 4EKWA 4NNQA 3US6A 1VB5A 4WGZA 5IY5C 3UGOA 1SR2A 4OD4A 3DMDA 3FAJA 3AGUA 3M4BA 2P7VA 3LEOA 4DVZA 5BQIA 3WHNA 3VF0A 4U5HA 1QVXA 3ZQVA 3DWWA 4CDAA 4CS8C 3K33A 5KYUA 3QTHA 2KQ9A 2J0WA 4L6RA 1ZHYA 3JCUQ 4IGGA 2BL2A 2KC3A 3JYYA 3DD7A 3ADDA 3G64A 1T6UA 2J46A 1TFKB 2C04A 3U9MA 1JXZA 2PFDA 1JAFA 5L0GA 4K1OA 4RDAA 3FOOA 4I42A 3B0PA 3L0IA 1ZW2A 3GM2A 4W8PA 4I44A 1WZ8A 3W8HB 4YN0B 1DOWA 3AGTA 4PJNA 1EF9A 3NRHA 3G4ZA 3CSKA 3HLZA 2ZXPA 3POVA 4CSAC 1RMVA 1G5ZA 1NSGB 2GWWA 3EH2A 1LI7A 3O10A 3L8IA 3L34A 3DJUB 4IRUA 2H7OA 2YLGA 1EA8A 3ABLC 3G4XA 1YA9A 3C8ZA 5KYXB 1FAPB 4ELWA 5L0FA 2ZD9A 3GEEA 1C03A 5KYYA 3R2PA 3C63A 3ASOC 3V7OA 4DBRA 4NEKA 4CDYA 2PBPA 2W45A 4AX2A 1OCRC 3HINA 4DVYP 2ICWG 4QIIA 1GS9A 3PDMP 2M4EA 1JR8A 3S27A 2L81A 4IZBA 1UX4A 2XLDA 3H65A 5A69A 3DM9B 4U5CE 2P1AA 3C8GB 1BR2A 4JTCB 5KJPA 3B9QA 4EMLA 2XLWA 4PK4A 1LPEA 1MMGA 3I5PA 3NG1A 2KW3C 1Z63A 2NSFA 4XTKA 2RSEB 4QI0A 3UR3C 1QPUA 5CI9A 3W4YA 4CX9A 4CIPA 2YHSA 5COFA 3QW0A 1YYJA 2J45A 4JYLA 2JX0A 2ZXOA 1ORYA 4J7TA 2PX0A 4F47A 1Z23A 4LDQA 4E0HA 2LSEA 4AE4B 4IJJA 2LCHA 4QDLA 2EPMX 4QI2A 2Q4FA 3ZIBA 5T3TA 4PFPA 2CW0F 2XLOA 4JCZA 3RFYA 4KC9A 256BA 3JRTA 5HV9A 4G7ZF 2EINC 2YL3A 3IQ6A 1AUEA 3LAYA 2A68F 2EJ5A 4JTAB 3MBGA 2VB6A 3LUTB 1ZHWA 2P63A 4JURI 2VC9A 5CIVA 3CAXA 1U89A 5F28E 2DYSC 2LIGA 3AQBA 3B0VC 3OA1A 4RBNA 1H9GA 2JPUA 4MVRA 1D0XA 4U5BE 1ORJA 2IEXA 1UX5A 3A9CA 3NMIA 1D1CA 3T88A 4ZLCA 4OD5A 3EFOB 5JVEA 1M2VB 1DCIA 4CS7A 3AG3C 2PP4A 1QZXA 5EHHA 1I5NA 1Q51A 3SEOA 3RVZA 1RCPA 1J8MF 1GQAA 1NFNA 2R7WA 2EIMC 4E7SA 2HSBA 3K1IA 4CS8A 4NQFA 4I1OB 4JW1A 3CQZA 4KNVA 2XL8A 2P6VA 2B0JA 3VAYA 1HW1A 4MOUA 2VX2A 2OCCC 3ABKC 2W4MA 1WTYA 3CZ6A 2GFHA 5C9GA 2ETSA 3ADCA 1OXKA 4J7YA 4U1AA 4GEHB 3GM1A 1HE9A 2MHRA 4C3DA 4YJWA 3HKKA 4PJMA 4BJ5C 2ASRA 1Q0GA 4FAPB 5A6KA 1DOVA 3ECSA 3O39A 3DAGA 4M63A 3R7CA 1NZYA 2J0XA 2JD3A 3X1OA 1CGME 2OOCA 1K05A 4HFKB 4IARA 1LS1A 4O6YA 2A0BA 5L3VA 3E70C 4CSAA 1HZDA 2KK1A 2R7QA 2FW2A 3SNHA 4R32A 4C7OB 2OKUA 2KGOA 4IWBA 2L6FA 3RKOF 1MNDA 4DRHB 1B68A 3IHUA 1O5HA 2V26A 3EPVA 4MNDA 4DOZA 5B3IA 2J9WA 4K2NA 5JSLA 4YT8A 4FJWD 2PBEA 4NTAA 3Q7LA 1HMOA 3SP1A 2R03A 4XPWA 5JRAA 2J9VA 4KBLA 3ZWIA 1BR4A 4IB4A 4OIPF 4JOTA 1OR2A 1YZCA 1M6TA 3H2UA 2YQYA 1SF8A 3MLGA 1H9TA 3M79A 1CPQA 4DJ9A 4DBQA 3W8HA 4KI2A 1KTMA 4BPMA 2Y3DA 3H81A 1U6HA 2XLVA 5KYWB 2D5RB 3QVYA 2VH3A 1TWAA 5T1DB 3FDQA 1FTSA 1V74B 1LKXA 5L0DA 1G4WR 4FZWC 1Y4CA 5B1BC 2YLIA 1TR2A 4ELSA 2Y3GA 3RYLA 2L6GA 3Q6MA 1JPJA 2FFHA 3QXZA 2IXPA 1PD1A 3TRRA 2Q00A 2GDCA 1ZW3A 3CEXA 1A0BA 3ADBA 4H54A 3Q0GA 4U5GA 4BG0A 5KYXA 4GQHA 2EIJC 5K0IA 1HW2A 1GM5A 1TQGA 4G0HA 1YAUO 3Q7GA 1IW7F 4U9EA 3AJMA 3IRBA 5FCLA 3NDBB 1WOLA 1TWGA 4B6IA 4BJ1A 4BJ6C 3JZ0A 1QLEC 3FXHA 5BUOA 2WVNA 3N0TA 3LS0A 4IZDA 2IBFA 3I47A 1YARO 4WCZA 4LLCA 1E85A 4JEAA 3JSEO 3EHMA 1CPRA 1AVOB 2HMZA 1F1MA 2NSGA 2R7TA 1LI5A 3NKEA 4Z9HA 4Z9IA 1OCOC 3RSIA 1MJ3A 3I4UA 2LFFA 2M64A 4PACA 4H4KC 2R05A 3V5XA 1ZVZA 3TOLA 3L8JA 2YWAA 2XM4A 1AEPA 4AE4A 4P6IC 3R9SA 3MFNA 2KYHA 3FVYA 3LNMB 3NYMA 1T6IA 3LJBA 3ZVRA 2ZXRA 3DE8A 3DXJF 3JSZA 4U5EE 4LACB 2VCCA 3TJ5A 2W4BA 5GPGB 1VTMP 3U8VA 2X51A 3DE9A 2NUTB 2FBMA 3A4NA 4LLEA 5DQTA 5CI8A 2DUBA 4IAQA 1Q0MA 2J8WA 1EQ1A 5KYNA 4MVOA 2LD6A 4DXWA 5A6AA 3HRXA 4LERA 2VASA 4QIJA 5JLIA 5BQHA 2HW5A 1TWHA 1R4TA 3TD7A 2GA0A 2Q9AA 1QSPA 1ST6A 4XWJA 3W2WA 3F46A 1T6QA 2E87A 3QZCA 3WG7C 2FAPB 2XS1A 5L0CA 1LVKA 1M57C 2HV7A 3EFOA 1M2VA 3EZIA 3SYNA 2QUPA 2Y69C 4MVSA 3QXIA 2I8BA 3MYIA 4MVUA 2B0HA 2R25A 2H7BA 4JEBA 3UMIA 4P9TA 4JCSA 2XXAB 4YT5A 4JZAA 3W2VA 1C17M 1RJ9B 3EQLF 3LESA 1SYQA 5E3AA 3DI5A 4IZCA 1MMAA 2YRFA 3A4MA 1RXQA 2HJMA 4EUKB 3V5YA 4O79A 4GEHA 2CNWA 3IQCA 2J7PA 3JRMO 2OEXA 2OQMA 1CGOA 5HSWA 1Z7Qc 2WZGA 4W8KA 1LIHA 2J9UA 3EZHA 4JVSA 4MTFA 1H7IA 1Q0FA 3KYJA 2ZQQA 4NY3A 4PFOA 3KKBA 2I15A 1M56C 4O7GA 4C7OA 5E2QA 4MI2A 3FDUA 1V4AA 3VRCA 3ATPA 2WVQA 2GTRA 5L0IA 2V3CC 4ZLDA 1Y6DA 4AL1A 1FR0A 2GAQA 1JPNA 1TWCA 3T6GB 3K1HA 5AC5A 3PHF2 3HNKA 2MWQA 2NUPB 1SMYF 2IOQA 4P9FA 3S29A 5FZTA 1BBHA 2NG1A 1OW8A 1EI7A 2CCYA 2F6QA 4XEFA 1OCCC 1T5OA 4C3EA 1ZHTA 2LFDA 2HUJA 2BC5A 4NTFA 3EG9B 3MOYA 2IXOA 5DLJA 3U9JA 2AU5A 5KYWA 3NMJA 2EPNA 4JIOA 1XZQA 2EILC 1Q52A 1RKCA 3Q0JA 1VOMA 5JP7A 3LS1A 5D91A 1HMDA 1BDJB 4BEJA 1NFOA 2OJED 1E83A 3LEVA 3BRJA 3PMRA 2A69F 2EPOA 3U8PA 1O3UA 3KL4A 4ANJA 2WB7A 2AWYA 3RH3A 4LDKA 2IXNA 4EHPA 1H6GA 4CJOA 5B1AC 3Q1TA 3PCVA 4XEKA 3HTKC 3KPHA 3M4CA 4D4NA 3IQ5A 3GORA 3UNGC 4MVQA 5KYYB 3NYJA 3KMIA 2QE9A 3RIPA 3X2QC 4MVMA 3KYIA 1JMWA 3LLIA 3ZTZA 2HV6A 3DZAA 3S9OA 3A4LA 2VREA 4EBKA 3W8IB 2H8AA 4O6MA 4PR9A 3TULA 2WVOA 2MYSA 3ASNC 5DVWA 1WN0A 2HZ8A 3ZC4A 4FX5A 1FMWA 3KQFA 5A6BA 1OKKA 3VM6A 1EY3A 2PPYA 1S7ZA 3T89A 3K6BA 2EPLX 4U18A 2BE5F 3HNLA 3Q6NA 3U0CA 2R7XA 1UFBA 4WGYA 3TOMA 1VLTA 3HNIA 2X0CA 3RW0A 4OINF 4K7BA 1J8YF 1Q0DA 1PV3A 3SXKA 1UIYA 4PJLA 2DYRC 4JWVA 2YL7A 5T3WA 5EGYA 3ZG1A 2XRHA 3OWTA 3UGPA 3EH1A 3UMHA 1ZHZA 2NPUA 1R5ID 1WGWA 2NUTA 3C8GD 2CYDA 1A7VA 3GEIA 1KNYA 1T9KA 3B71A 4K0DA 4FWVA 1ZU5A 3C7JA 1Z5ZA 4HFFB 4OIOF 1VLSA 3GANA 4YL0A 3NMKA 2W9YA 1OW6A 4Q4ZF 4F4BA 3P5MA 2R9RB 4A4AA 1YDIA 5COMA 3QK8A 4EIYA 3LNRA 5EK0A 2C03A 1XZPA 1TFOB 3R9TA 2DGJA 3RF3A 4WABA 4JJGA 2L7AA 3HJCA 5E33A 3IPMO 4MS2A 3FAPB 1NZEA 2TMVP 3U3FA 2HS5A 3S90A 3QVZA 4ZU2A 2XXAA 1Z3IX 2XLHA 1Z6AA 3GWLA 3S28A 3K7DA 2YL1A 3RVYA 1U0BB 3SXMA 3AOUA 1RJ9A 3GEHA 4HEAJ 1L7CA 1D0YA 4U9DA 3AG1C 2HJ3A 4AK9A 3EGXB 1PD0A 4NTBA 3K66A 5D92A 4C3BA 3RQGA 2R7UA 3C8GA 5A6JA 3S84A 1ORSC 5JUAA 5JS5A 2PX3A 2UUHA 4YK5A 4BEMJ 2WL8A 3EJNA 1L3PA 1M2OA 1RKEB 2XL6A 4JFCA 2KNHA 1EKYA 1E86A 3JYHA 4CDVA 3V5ZA 2IXMA 5COGA 4I52A 4DRJB 4N4WA 2EIKC 4MTOA 2R7VA 1V55C 4EBBA 3E9VA 3SXZA 3JT1A 3B0UX 1APCA 3FOPA 3K1IC 1NU9C 2ZPAA 2P0NA 2YKZA 3TQOA 2PF4E 2AVKA 3IQTA 3B29A 3QMKA 2Q9BA 2NUPA 3SWXA 2CNWD 4JRZA 1JOGA 4CS9C 1ZU4A 2L9JA 2OEVA 2J7PD 1IZMA 2IM8A 3UMKA 4MVZA 4OG1A 2H7VC 4G78A 2ZXWC 3EG9A 4NCQA 3DJNB 4YWQA 3ITFA 1MMNA 4I4ZA 4JKVA 4BJ5A 1QQ3A 4Z9JA 1FNTc 2G3VA 5AGFA 4LDRA 4YL3A 1NLXA 2XSEA 5B3SC 3QW1A 2R02A 1FFHA 4XEVA 2HMQA 1G8XA 2DI3A 2UZFA 1ZZPA 5F5HA 1NBBA 5AC4A 3EGDB 1MMDA 2CGEA 3SZRA 5L3QA 3G50A 3MYFA 1S05A 1HY5A 1GGQA 1QKRA 4MTGA 1OR3A 4PJJA 3DAFA 3TLFA 3AQCA 1YZAA 1VMAA 4G7HF 3N2ZB 4JTDB 1WASA 2Z15A 1LS4A 1O87A 1OQCA 2XLEA 3ZDLA 4J32B 2YEVA 1D1BA 3BEHA 1LE2A 5DS6A 3OC7A 3LLKA 2F22A 4GYTA 1KU2A 1DUBA 3H2VA 1EF8A 4DRIB 1K40A 4KNPA 2J9BA 3W8IA 2YLDA 1YLMA 1VYKA 1UG7A 1RJMA 1XWJA 3M1CB 3GODA 1YYXA 4EWCA 2R7SA 4O6NA 3H02A 3SXYA 1YVIA 2VCBA 1SZIA 4U5DE 3WAQA 3GWNA 1YA7O
chains in the Genus database with same CATH topology
3ADDA 1KNYA 5F28E 3B71A 2L6GA 3L8JA 1K05A 2YWAA 3C8GB 4XEVA 2Q00A 3S9OA 3A4LA 4EBKA 3W8IB 1ZZPA 1OW8A 3O4XE 2JPUA 3GM3A 2KK1A 3GM2A 3MFNA 3TULA 3ADBA 1UX5A 4R32A 3RQFA 4XEFA 3W8HB 2LK4A 3A4MA 1OW6A 2L6HA 2L6FA 3A4NA 2JX0A 3U0CA 3AJMA 3IRBA 3AM1A 4NNQA 1UFBA 1WOLA 2HSBA 4NQFA 3U3FA 2PBEA 3JZ0A 3O10A 3L8IA 3BRJA 3K7DA 1O3UA 1PV3A 1K40A 1JOGA 1WTYA 1QVXA 1Y64B 1RJMA 4EBJA 3ADCA 1KTMA 3C18A 4GEHB 3GM1A 3RQEA 4XEKA 1V4AA 3RQGA 3JYYA 3C8GA 1WWPA 1OW7A 3C8GD 1K04A 1UX4A 2P63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  1WOL A;  2HSB A;  4NQF A;  4EBJ A;  1KNY A;  3U3F A;  2PBE A;  1KTM A;  1OW6 A;  2L6H A;  3C18 A;  5F28 E;  4GEH B;  3GM1 A;  3B71 A;  3JZ0 A;  3O10 A;  2L6G A;  3L8I A;  3L8J A;  1K05 A;  3RQE A;  2L6F A;  2YWA A;  4XEK A;  3C8G B;  3BRJ A;  4XEV A;  1V4A A;  2Q00 A;  3S9O A;  3K7D A;  4EBK A;  3W8I B;  1ZZP A;  1OW8 A;  3RQG A;  1O3U A;  1PV3 A;  2JPU A;  1K40 A;  3GM3 A;  3JYY A;  2KK1 A;  3C8G A;  3GM2 A;  1WWP A;  1JOG A;  3MFN A;  1OW7 A;  1WTY A;  3TUL A;  3C8G D;  4R32 A;  2JX0 A;  1K04 A;  3U0C A;  3AJM A;  3RQF A;  1QVX A;  4XEF A;  3W8H B;  2LK4 A; 
#chains in the Genus database with same CATH topology
 1JRA A;  4CIH A;  4FZW A;  2LP4 A;  3O55 A;  1ZYR F;  4BJT A;  4N6H A;  2A1D D;  1PCX A;  2AWC A;  5TJ5 E;  2FGY A;  4I1M A;  5KYU B;  3ZSU A;  3NYL A;  2XL4 A;  2L6H A;  3C62 A;  4AL0 A;  1MNE A;  3TK0 A;  2A0U A;  2OG2 A;  3IEE A;  4E17 A;  4KNW A;  3FHD A;  1LE4 A;  1A7D A;  2RD9 A;  2XS8 A;  1OXB A;  4YL1 A;  3U5S A;  4BJ6 A;  2Y3B A;  1D0Z A;  3N24 A;  2WZF A;  5A6B D;  1OKK D;  2R7R A;  1Y64 B;  1BR1 A;  3C18 A;  4OLQ A;  3VYW A;  4G7O F;  2Q3T A;  3RQE A;  5JBX A;  2P61 A;  2Y39 A;  4IAO A;  4OIR F;  4RD9 A;  1OW7 A;  2AP3 A;  3S0X A;  4ER9 A;  4FES A;  1Q0K A;  1ZHX A;  1G4U S;  1VYI A;  3SLL A;  5E3C A;  3KH2 A;  4HE8 D;  2QNL A;  1E2X A;  3GM3 A;  4D4X A;  2D4U A;  5F5F A;  2LQG A;  2KSF A;  2LK4 A;  2UUI A;  3PZK A;  1I4Y A;  1BZ4 A;  3FMS A;  3JTL O;  3ZTM A;  1NU7 D;  3M15 A;  2YL0 A;  4J30 B;  3EGX A;  4WJ0 A;  4CS9 A;  2R7O A;  2A6E F;  3AG4 C;  3MX3 A;  4ULV A;  4JE9 A;  4ONS A;  3AM1 A;  1A41 A;  3DKA A;  1N1C A;  3U3B A;  4K3W A;  1TKN A;  4MW3 A;  4X0R A;  2WZL A;  3AG2 C;  1MQV A;  4XPX A;  1RKE A;  1C02 A;  3J06 A;  2HSQ A;  5DS5 A;  5JBW A;  4EBJ A;  1OCZ C;  1D1A A;  1YJG A;  1T01 A;  2XLM A;  1CGN A;  2CDQ A;  2PNO A;  5BQG A;  4CBE A;  1WWP A;  3WOD F;  1K04 A;  2EPK X;  5DS4 A;  1I4Z A;  4XLP F;  3MYB A;  4I3M A;  4MW8 A;  4E18 A;  2ZQR A;  4JC7 A;  5DQZ A;  4A2N B;  5JT4 A;  3RQF A;  3L1M A;  2G3K A;  2G62 A;  2IYL D;  3T4R A;  3ABM C;  2QY9 A;  4ULW A;  4U19 A;  3A11 A;  2QQ3 A;  4CJG A;  3U2L A;  4E7Z A;  4XLN F;  4YT4 A;  1WAT A;  1V54 C;  1W2W A;  4MQ9 F;  1FFT C;  2O9X A;  2VCA A;  1LM3 B;  4N06 A;  3DM5 A;  1NG1 A;  4OIQ F;  1VK5 A;  3EHN A;  1HE1 A;  2A6H F;  4Q5S F;  2QLA A;  4JJF A;  3EGD A;  3O6X A;  2HFI A;  4ELX A;  4XQ1 A;  3U2M A;  1FMV A;  3T8A A;  3TJ6 A;  4JCH A;  2OJQ A;  4Q7C A;  2QTV A;  2XM0 A;  2OU6 A;  3ZQY A;  3R0O A;  1RJN A;  1A7E A;  4U5F E;  2Y3H A;  2YZS A;  4UDV A;  4NC3 A;  3I5Q A;  4E0I A;  3F47 A;  2HKV A;  2DB4 A;  3NKD A;  3O4X E;  2KJG A;  3T9O A;  1E84 A;  4N6C A;  3OEO A;  5L0H A;  2Q7R A;  3T6B A;  2Q9C A;  5L0J A;  4XPY A;  3HNJ A;  3T6J A;  4YT2 A;  1NZY B;  2YVK A;  4EKW A;  4NNQ A;  3US6 A;  1VB5 A;  4WGZ A;  5IY5 C;  3UGO A;  1SR2 A;  4OD4 A;  3DMD A;  3FAJ A;  3AGU A;  3M4B A;  2P7V A;  3LEO A;  4DVZ A;  5BQI A;  3WHN A;  3VF0 A;  4U5H A;  1QVX A;  3ZQV A;  3DWW A;  4CDA A;  4CS8 C;  3K33 A;  5KYU A;  3QTH A;  2KQ9 A;  2J0W A;  4L6R A;  1ZHY A;  3JCU Q;  4IGG A;  2BL2 A;  2KC3 A;  3JYY A;  3DD7 A;  3ADD A;  3G64 A;  1T6U A;  2J46 A;  1TFK B;  2C04 A;  3U9M A;  1JXZ A;  2PFD A;  1JAF A;  5L0G A;  4K1O A;  4RDA A;  3FOO A;  4I42 A;  3B0P A;  3L0I A;  1ZW2 A;  3GM2 A;  4W8P A;  4I44 A;  1WZ8 A;  3W8H B;  4YN0 B;  1DOW A;  3AGT A;  4PJN A;  1EF9 A;  3NRH A;  3G4Z A;  3CSK A;  3HLZ A;  2ZXP A;  3POV A;  4CSA C;  1RMV A;  1G5Z A;  1NSG B;  2GWW A;  3EH2 A;  1LI7 A;  3O10 A;  3L8I A;  3L34 A;  3DJU B;  4IRU A;  2H7O A;  2YLG A;  1EA8 A;  3ABL C;  3G4X A;  1YA9 A;  3C8Z A;  5KYX B;  1FAP B;  4ELW A;  5L0F A;  2ZD9 A;  3GEE A;  1C03 A;  5KYY A;  3R2P A;  3C63 A;  3ASO C;  3V7O A;  4DBR A;  4NEK A;  4CDY A;  2PBP A;  2W45 A;  4AX2 A;  1OCR C;  3HIN A;  4DVY P;  2ICW G;  4QII A;  1GS9 A;  3PDM P;  2M4E A;  1JR8 A;  3S27 A;  2L81 A;  4IZB A;  1UX4 A;  2XLD A;  3H65 A;  5A69 A;  3DM9 B;  4U5C E;  2P1A A;  3C8G B;  1BR2 A;  4JTC B;  5KJP A;  3B9Q A;  4EML A;  2XLW A;  4PK4 A;  1LPE A;  1MMG A;  3I5P A;  3NG1 A;  2KW3 C;  1Z63 A;  2NSF A;  4XTK A;  2RSE B;  4QI0 A;  3UR3 C;  1QPU A;  5CI9 A;  3W4Y A;  4CX9 A;  4CIP A;  2YHS A;  5COF A;  3QW0 A;  1YYJ A;  2J45 A;  4JYL A;  2JX0 A;  2ZXO A;  1ORY A;  4J7T A;  2PX0 A;  4F47 A;  1Z23 A;  4LDQ A;  4E0H A;  2LSE A;  4AE4 B;  4IJJ A;  2LCH A;  4QDL A;  2EPM X;  4QI2 A;  2Q4F A;  3ZIB A;  5T3T A;  4PFP A;  2CW0 F;  2XLO A;  4JCZ A;  3RFY A;  4KC9 A;  256B A;  3JRT A;  5HV9 A;  4G7Z F;  2EIN C;  2YL3 A;  3IQ6 A;  1AUE A;  3LAY A;  2A68 F;  2EJ5 A;  4JTA B;  3MBG A;  2VB6 A;  3LUT B;  1ZHW A;  2P63 A;  4JUR I;  2VC9 A;  5CIV A;  3CAX A;  1U89 A;  5F28 E;  2DYS C;  2LIG A;  3AQB A;  3B0V C;  3OA1 A;  4RBN A;  1H9G A;  2JPU A;  4MVR A;  1D0X A;  4U5B E;  1ORJ A;  2IEX A;  1UX5 A;  3A9C A;  3NMI A;  1D1C A;  3T88 A;  4ZLC A;  4OD5 A;  3EFO B;  5JVE A;  1M2V B;  1DCI A;  4CS7 A;  3AG3 C;  2PP4 A;  1QZX A;  5EHH A;  1I5N A;  1Q51 A;  3SEO A;  3RVZ A;  1RCP A;  1J8M F;  1GQA A;  1NFN A;  2R7W A;  2EIM C;  4E7S A;  2HSB A;  3K1I A;  4CS8 A;  4NQF A;  4I1O B;  4JW1 A;  3CQZ A;  4KNV A;  2XL8 A;  2P6V A;  2B0J A;  3VAY A;  1HW1 A;  4MOU A;  2VX2 A;  2OCC C;  3ABK C;  2W4M A;  1WTY A;  3CZ6 A;  2GFH A;  5C9G A;  2ETS A;  3ADC A;  1OXK A;  4J7Y A;  4U1A A;  4GEH B;  3GM1 A;  1HE9 A;  2MHR A;  4C3D A;  4YJW A;  3HKK A;  4PJM A;  4BJ5 C;  2ASR A;  1Q0G A;  4FAP B;  5A6K A;  1DOV A;  3ECS A;  3O39 A;  3DAG A;  4M63 A;  3R7C A;  1NZY A;  2J0X A;  2JD3 A;  3X1O A;  1CGM E;  2OOC A;  1K05 A;  4HFK B;  4IAR A;  1LS1 A;  4O6Y A;  2A0B A;  5L3V A;  3E70 C;  4CSA A;  1HZD A;  2KK1 A;  2R7Q A;  2FW2 A;  3SNH A;  4R32 A;  4C7O B;  2OKU A;  2KGO A;  4IWB A;  2L6F A;  3RKO F;  1MND A;  4DRH B;  1B68 A;  3IHU A;  1O5H A;  2V26 A;  3EPV A;  4MND A;  4DOZ A;  5B3I A;  2J9W A;  4K2N A;  5JSL A;  4YT8 A;  4FJW D;  2PBE A;  4NTA A;  3Q7L A;  1HMO A;  3SP1 A;  2R03 A;  4XPW A;  5JRA A;  2J9V A;  4KBL A;  3ZWI A;  1BR4 A;  4IB4 A;  4OIP F;  4JOT A;  1OR2 A;  1YZC A;  1M6T A;  3H2U A;  2YQY A;  1SF8 A;  3MLG A;  1H9T A;  3M79 A;  1CPQ A;  4DJ9 A;  4DBQ A;  3W8H A;  4KI2 A;  1KTM A;  4BPM A;  2Y3D A;  3H81 A;  1U6H A;  2XLV A;  5KYW B;  2D5R B;  3QVY A;  2VH3 A;  1TWA A;  5T1D B;  3FDQ A;  1FTS A;  1V74 B;  1LKX A;  5L0D A;  1G4W R;  4FZW C;  1Y4C A;  5B1B C;  2YLI A;  1TR2 A;  4ELS A;  2Y3G A;  3RYL A;  2L6G A;  3Q6M A;  1JPJ A;  2FFH A;  3QXZ A;  2IXP A;  1PD1 A;  3TRR A;  2Q00 A;  2GDC A;  1ZW3 A;  3CEX A;  1A0B A;  3ADB A;  4H54 A;  3Q0G A;  4U5G A;  4BG0 A;  5KYX A;  4GQH A;  2EIJ C;  5K0I A;  1HW2 A;  1GM5 A;  1TQG A;  4G0H A;  1YAU O;  3Q7G A;  1IW7 F;  4U9E A;  3AJM A;  3IRB A;  5FCL A;  3NDB B;  1WOL A;  1TWG A;  4B6I A;  4BJ1 A;  4BJ6 C;  3JZ0 A;  1QLE C;  3FXH A;  5BUO A;  2WVN A;  3N0T A;  3LS0 A;  4IZD A;  2IBF A;  3I47 A;  1YAR O;  4WCZ A;  4LLC A;  1E85 A;  4JEA A;  3JSE O;  3EHM A;  1CPR A;  1AVO B;  2HMZ A;  1F1M A;  2NSG A;  2R7T A;  1LI5 A;  3NKE A;  4Z9H A;  4Z9I A;  1OCO C;  3RSI A;  1MJ3 A;  3I4U A;  2LFF A;  2M64 A;  4PAC A;  4H4K C;  2R05 A;  3V5X A;  1ZVZ A;  3TOL A;  3L8J A;  2YWA A;  2XM4 A;  1AEP A;  4AE4 A;  4P6I C;  3R9S A;  3MFN A;  2KYH A;  3FVY A;  3LNM B;  3NYM A;  1T6I A;  3LJB A;  3ZVR A;  2ZXR A;  3DE8 A;  3DXJ F;  3JSZ A;  4U5E E;  4LAC B;  2VCC A;  3TJ5 A;  2W4B A;  5GPG B;  1VTM P;  3U8V A;  2X51 A;  3DE9 A;  2NUT B;  2FBM A;  3A4N A;  4LLE A;  5DQT A;  5CI8 A;  2DUB A;  4IAQ A;  1Q0M A;  2J8W A;  1EQ1 A;  5KYN A;  4MVO A;  2LD6 A;  4DXW A;  5A6A A;  3HRX A;  4LER A;  2VAS A;  4QIJ A;  5JLI A;  5BQH A;  2HW5 A;  1TWH A;  1R4T A;  3TD7 A;  2GA0 A;  2Q9A A;  1QSP A;  1ST6 A;  4XWJ A;  3W2W A;  3F46 A;  1T6Q A;  2E87 A;  3QZC A;  3WG7 C;  2FAP B;  2XS1 A;  5L0C A;  1LVK A;  1M57 C;  2HV7 A;  3EFO A;  1M2V A;  3EZI A;  3SYN A;  2QUP A;  2Y69 C;  4MVS A;  3QXI A;  2I8B A;  3MYI A;  4MVU A;  2B0H A;  2R25 A;  2H7B A;  4JEB A;  3UMI A;  4P9T A;  4JCS A;  2XXA B;  4YT5 A;  4JZA A;  3W2V A;  1C17 M;  1RJ9 B;  3EQL F;  3LES A;  1SYQ A;  5E3A A;  3DI5 A;  4IZC A;  1MMA A;  2YRF A;  3A4M A;  1RXQ A;  2HJM A;  4EUK B;  3V5Y A;  4O79 A;  4GEH A;  2CNW A;  3IQC A;  2J7P A;  3JRM O;  2OEX A;  2OQM A;  1CGO A;  5HSW A;  1Z7Q c;  2WZG A;  4W8K A;  1LIH A;  2J9U A;  3EZH A;  4JVS A;  4MTF A;  1H7I A;  1Q0F A;  3KYJ A;  2ZQQ A;  4NY3 A;  4PFO A;  3KKB A;  2I15 A;  1M56 C;  4O7G A;  4C7O A;  5E2Q A;  4MI2 A;  3FDU A;  1V4A A;  3VRC A;  3ATP A;  2WVQ A;  2GTR A;  5L0I A;  2V3C C;  4ZLD A;  1Y6D A;  4AL1 A;  1FR0 A;  2GAQ A;  1JPN A;  1TWC A;  3T6G B;  3K1H A;  5AC5 A;  3PHF 2;  3HNK A;  2MWQ A;  2NUP B;  1SMY F;  2IOQ A;  4P9F A;  3S29 A;  5FZT A;  1BBH A;  2NG1 A;  1OW8 A;  1EI7 A;  2CCY A;  2F6Q A;  4XEF A;  1OCC C;  1T5O A;  4C3E A;  1ZHT A;  2LFD A;  2HUJ A;  2BC5 A;  4NTF A;  3EG9 B;  3MOY A;  2IXO A;  5DLJ A;  3U9J A;  2AU5 A;  5KYW A;  3NMJ A;  2EPN A;  4JIO A;  1XZQ A;  2EIL C;  1Q52 A;  1RKC A;  3Q0J A;  1VOM A;  5JP7 A;  3LS1 A;  5D91 A;  1HMD A;  1BDJ B;  4BEJ A;  1NFO A;  2OJE D;  1E83 A;  3LEV A;  3BRJ A;  3PMR A;  2A69 F;  2EPO A;  3U8P A;  1O3U A;  3KL4 A;  4ANJ A;  2WB7 A;  2AWY A;  3RH3 A;  4LDK A;  2IXN A;  4EHP A;  1H6G A;  4CJO A;  5B1A C;  3Q1T A;  3PCV A;  4XEK A;  3HTK C;  3KPH A;  3M4C A;  4D4N A;  3IQ5 A;  3GOR A;  3UNG C;  4MVQ A;  5KYY B;  3NYJ A;  3KMI A;  2QE9 A;  3RIP A;  3X2Q C;  4MVM A;  3KYI A;  1JMW A;  3LLI A;  3ZTZ A;  2HV6 A;  3DZA A;  3S9O A;  3A4L A;  2VRE A;  4EBK A;  3W8I B;  2H8A A;  4O6M A;  4PR9 A;  3TUL A;  2WVO A;  2MYS A;  3ASN C;  5DVW A;  1WN0 A;  2HZ8 A;  3ZC4 A;  4FX5 A;  1FMW A;  3KQF A;  5A6B A;  1OKK A;  3VM6 A;  1EY3 A;  2PPY A;  1S7Z A;  3T89 A;  3K6B A;  2EPL X;  4U18 A;  2BE5 F;  3HNL A;  3Q6N A;  3U0C A;  2R7X A;  1UFB A;  4WGY A;  3TOM A;  1VLT A;  3HNI A;  2X0C A;  3RW0 A;  4OIN F;  4K7B A;  1J8Y F;  1Q0D A;  1PV3 A;  3SXK A;  1UIY A;  4PJL A;  2DYR C;  4JWV A;  2YL7 A;  5T3W A;  5EGY A;  3ZG1 A;  2XRH A;  3OWT A;  3UGP A;  3EH1 A;  3UMH A;  1ZHZ A;  2NPU A;  1R5I D;  1WGW A;  2NUT A;  3C8G D;  2CYD A;  1A7V A;  3GEI A;  1KNY A;  1T9K A;  3B71 A;  4K0D A;  4FWV A;  1ZU5 A;  3C7J A;  1Z5Z A;  4HFF B;  4OIO F;  1VLS A;  3GAN A;  4YL0 A;  3NMK A;  2W9Y A;  1OW6 A;  4Q4Z F;  4F4B A;  3P5M A;  2R9R B;  4A4A A;  1YDI A;  5COM A;  3QK8 A;  4EIY A;  3LNR A;  5EK0 A;  2C03 A;  1XZP A;  1TFO B;  3R9T A;  2DGJ A;  3RF3 A;  4WAB A;  4JJG A;  2L7A A;  3HJC A;  5E33 A;  3IPM O;  4MS2 A;  3FAP B;  1NZE A;  2TMV P;  3U3F A;  2HS5 A;  3S90 A;  3QVZ A;  4ZU2 A;  2XXA A;  1Z3I X;  2XLH A;  1Z6A A;  3GWL A;  3S28 A;  3K7D A;  2YL1 A;  3RVY A;  1U0B B;  3SXM A;  3AOU A;  1RJ9 A;  3GEH A;  4HEA J;  1L7C A;  1D0Y A;  4U9D A;  3AG1 C;  2HJ3 A;  4AK9 A;  3EGX B;  1PD0 A;  4NTB A;  3K66 A;  5D92 A;  4C3B A;  3RQG A;  2R7U A;  3C8G A;  5A6J A;  3S84 A;  1ORS C;  5JUA A;  5JS5 A;  2PX3 A;  2UUH A;  4YK5 A;  4BEM J;  2WL8 A;  3EJN A;  1L3P A;  1M2O A;  1RKE B;  2XL6 A;  4JFC A;  2KNH A;  1EKY A;  1E86 A;  3JYH A;  4CDV A;  3V5Z A;  2IXM A;  5COG A;  4I52 A;  4DRJ B;  4N4W A;  2EIK C;  4MTO A;  2R7V A;  1V55 C;  4EBB A;  3E9V A;  3SXZ A;  3JT1 A;  3B0U X;  1APC A;  3FOP A;  3K1I C;  1NU9 C;  2ZPA A;  2P0N A;  2YKZ A;  3TQO A;  2PF4 E;  2AVK A;  3IQT A;  3B29 A;  3QMK A;  2Q9B A;  2NUP A;  3SWX A;  2CNW D;  4JRZ A;  1JOG A;  4CS9 C;  1ZU4 A;  2L9J A;  2OEV A;  2J7P D;  1IZM A;  2IM8 A;  3UMK A;  4MVZ A;  4OG1 A;  2H7V C;  4G78 A;  2ZXW C;  3EG9 A;  4NCQ A;  3DJN B;  4YWQ A;  3ITF A;  1MMN A;  4I4Z A;  4JKV A;  4BJ5 A;  1QQ3 A;  4Z9J A;  1FNT c;  2G3V A;  5AGF A;  4LDR A;  4YL3 A;  1NLX A;  2XSE A;  5B3S C;  3QW1 A;  2R02 A;  1FFH A;  4XEV A;  2HMQ A;  1G8X A;  2DI3 A;  2UZF A;  1ZZP A;  5F5H A;  1NBB A;  5AC4 A;  3EGD B;  1MMD A;  2CGE A;  3SZR A;  5L3Q A;  3G50 A;  3MYF A;  1S05 A;  1HY5 A;  1GGQ A;  1QKR A;  4MTG A;  1OR3 A;  4PJJ A;  3DAF A;  3TLF A;  3AQC A;  1YZA A;  1VMA A;  4G7H F;  3N2Z B;  4JTD B;  1WAS A;  2Z15 A;  1LS4 A;  1O87 A;  1OQC A;  2XLE A;  3ZDL A;  4J32 B;  2YEV A;  1D1B A;  3BEH A;  1LE2 A;  5DS6 A;  3OC7 A;  3LLK A;  2F22 A;  4GYT A;  1KU2 A;  1DUB A;  3H2V A;  1EF8 A;  4DRI B;  1K40 A;  4KNP A;  2J9B A;  3W8I A;  2YLD A;  1YLM A;  1VYK A;  1UG7 A;  1RJM A;  1XWJ A;  3M1C B;  3GOD A;  1YYX A;  4EWC A;  2R7S A;  4O6N A;  3H02 A;  3SXY A;  1YVI A;  2VCB A;  1SZI A;  4U5D E;  3WAQ A;  3GWN A;  1YA7 O; 
#chains in the Genus database with same CATH homology
 3ADD A;  1KNY A;  5F28 E;  3B71 A;  2L6G A;  3L8J A;  1K05 A;  2YWA A;  3C8G B;  4XEV A;  2Q00 A;  3S9O A;  3A4L A;  4EBK A;  3W8I B;  1ZZP A;  1OW8 A;  3O4X E;  2JPU A;  3GM3 A;  2KK1 A;  3GM2 A;  3MFN A;  3TUL A;  3ADB A;  1UX5 A;  4R32 A;  3RQF A;  4XEF A;  3W8H B;  2LK4 A;  3A4M A;  1OW6 A;  2L6H A;  2L6F A;  3A4N A;  2JX0 A;  3U0C A;  3AJM A;  3IRB A;  3AM1 A;  4NNQ A;  1UFB A;  1WOL A;  2HSB A;  4NQF A;  3U3F A;  2PBE A;  3JZ0 A;  3O10 A;  3L8I A;  3BRJ A;  3K7D A;  1O3U A;  1PV3 A;  1K40 A;  1JOG A;  1WTY A;  1QVX A;  1Y64 B;  1RJM A;  4EBJ A;  3ADC A;  1KTM A;  3C18 A;  4GEH B;  3GM1 A;  3RQE A;  4XEK A;  1V4A A;  3RQG A;  3JYY A;  3C8G A;  1WWP A;  1OW7 A;  3C8G D;  1K04 A;  1UX4 A;  2P63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...