3AJMA

Crystal structure of programmed cell death 10 in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
201
structure length
201
Chain Sequence
EAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of human programmed cell death 10 complexed with inositol-(1,3,4,5)-tetrakisphosphate: a novel adaptor protein involved in human cerebral cavernous malformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 84
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3ajmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3ajmA02
1K05A 1PV3A 3RQFA 2YWAA 1WWPA 5F28E 4EBKA 3TULA 2L6FA 1OW7A 3GM2A 3RQEA 1V4AA 1UFBA 3C8GD 4XEKA 1KNYA 4XEFA 3GM1A 3L8IA 2LK4A 3JZ0A 3W8IB 3U3FA 4EBJA 1K04A 2L6HA 1JOGA 2JX0A 2KK1A 1K40A 2Q00A 4NQFA 3C8GA 1O3UA 3U0CA 1QVXA 2JPUA 3L8JA 3O10A 3S9OA 3C18A 3C8GB 1OW8A 3W8HB 1WTYA 1WOLA 2PBEA 3RQGA 3BRJA 3K7DA 3MFNA 1OW6A 3JYYA 4GEHB 2L6GA 3GM3A 2HSBA 3B71A 1ZZPA 4XEVA 4R32A 1KTMA 3AJMA
chains in the Genus database with same CATH superfamily
4YWQA 5T1DB 4C3EA 5JVEA 3U8VA 4ZU2A 3AG4C 2MWQA 2YQYA 3M4CA 4YL3A 1YAUO 1PCXA 3AG2C 3K1IA 1QLEC 3DWWA 1NG1A 1J8MF 5CIVA 3CAXA 2YL3A 3ABMC 2AWYA 4CDAA 3MYBA 2A1DD 4JEAA 1C17M 4C7OB 3KMIA 2EJ5A 1IW7F 3JYHA 2Q9AA 2Y69C 1TWGA 2IOQA 3T9OA 2J9UA 3TULA 4NTAA 4RD9A 2Y3BA 3TK0A 4P9FA 3T88A 5BQHA 5AC5A 2QNLA 3W8HB 2D4UA 2W4BA 4YT4A 2VCCA 4MW3A 2R7QA 5DQZA 3FOPA 3B0UX 2OJED 2HMQA 4XEFA 4FWVA 2VC9A 2DI3A 1HY5A 3RFYA 1EI7A 3Q0JA 4DVZA 3SYNA 1SZIA 2Y3GA 1VB5A 1TFKB 3NDBB 1GQAA 3H02A 4BJ6A 3HLZA 1YZAA 1ZYRF 2YRFA 5JS5A 1TQGA 2IXPA 2PX3A 4Q5SF 1WGWA 4NY3A 1JPNA 4D4XA 4JURI 3GORA 2VCBA 3M4BA 1FFTC 2CGEA 2HSQA 3AGTA 2A68F 2BL2A 4CS8A 2XRHA 4W8PA 3U9MA 1H9GA 4N6CA 4I44A 1OR2A 1U89A 2A69F 2P61A 4JZAA 2W4MA 4N06A 3VAYA 4I52A 4MTOA 2QE9A 3FDUA 1Q51A 2MHRA 3G50A 5EK0A 2WZLA 2OEXA 1Z3IX 4K2NA 3GODA 4ELXA 1WASA 2WZFA 3FHDA 1Q0FA 2H8AA 3W2WA 3SXYA 5EHHA 1SR2A 4ANJA 4I42A 2JD3A 2LCHA 4J7YA 1ST6A 4PJMA 3EHNA 4EWCA 3HJCA 3TRRA 3KL4A 4CDVA 4CJGA 2KNHA 4NNQA 5L0IA 4CS9C 3JCUQ 2WB7A 2OCCC 2CCYA 4DXWA 4HFFB 2IEXA 1OW7A 3ABKC 4MS2A 2R9RB 1T01A 1I4ZA 3QZCA 1LI7A 3CZ6A 2XL4A 4FESA 4JIOA 5KYWA 3KQFA 3EH1A 1JR8A 2CYDA 1RMVA 3WAQA 2Q9BA 3V5XA 4NTFA 2FGYA 2R02A 2PX0A 2CW0F 2YL0A 1MNEA 1OW6A 4U19A 4YT5A 1KTMA 1U6HA 1LE4A 1QKRA 1D1AA 1WN0A 3L34A 2PNOA 4JCZA 4MTFA 3AOUA 5KYWB 4O6MA 1G4US 4I4ZA 3NYJA 2ZXRA 4GYTA 2ZXWC 4DVYP 1TWHA 4IWBA 1MNDA 3R9TA 2Y3HA 4MW8A 4JCHA 5KJPA 4LERA 5E3AA 3LJBA 1EKYA 1MMNA 4WJ0A 1FTSA 3TQOA 1YYXA 2XS1A 3DMDA 1O5HA 2J0XA 3RQFA 3JSZA 3VF0A 3ADCA 2VREA 5E3CA 4I3MA 2FW2A 4CS9A 1NFNA 4M63A 1HMDA 2IYLD 1CGME 1A7EA 2AP3A 4K0DA 1T6UA 2VASA 3MYFA 1ZU5A 4JJGA 3OEOA 1FFHA 4D4NA 5L0DA 4H4KC 4AE4B 5B1BC 3Q6MA 2ASRA 3PZKA 1QPUA 4H54A 3P5MA 1Q0DA 2X0CA 2HKVA 1T9KA 3Q7GA 4KNPA 3UMHA 4Q4ZF 3DM5A 2R7RA 4WGZA 4JTAB 1I5NA 4NQFA 1K40A 3K1HA 2FFHA 3F47A 4JJFA 2WVOA 1LI5A 1OXBA 4ONSA 1Z7Qc 4PFOA 1UIYA 2NSFA 3LLKA 4AL1A 5JP7A 5DQTA 4L6RA 1ZHWA 4O6YA 4JRZA 1D1CA 4RBNA 3Q7LA 3RQEA 3ZIBA 4ELWA 3T8AA 1QSPA 2CNWA 1M57C 4Q7CA 2DYRC 2XLDA 3S28A 3R9SA 1D0ZA 3UGOA 1EA8A 3UR3C 1EF9A 4EBJA 1M2VB 4PJLA 2FAPB 4LLEA 1HW1A 1RCPA 1WTYA 3EHMA 2OG2A 2YLDA 3A4NA 4XTKA 4BJTA 1WATA 3V7OA 3T6BA 3U9JA 2KC3A 4KBLA 4K1OA 4ER9A 2YKZA 1G5ZA 2XLOA 2YLIA 3AG3C 3RH3A 3SLLA 1FMWA 3M15A 1FMVA 3G4XA 3J06A 2YL1A 4DRJB 1K05A 1PV3A 2XS8A 4YJWA 1XZQA 1OR3A 5E2QA 4W8KA 4IZCA 1OCZC 3LEVA 4BEMJ 3K6BA 2J0WA 1NSGB 3S90A 3PDMP 1VOMA 4MVMA 1Q0GA 3AQCA 4F47A 2LQGA 5JT4A 2A0BA 2KQ9A 2OKUA 2A6EF 1YARO 4MVSA 3VYWA 1OW8A 4I1OB 1M6TA 4DRHB 2WZGA 3TOLA 4KNVA 1Q0MA 1FAPB 1NZYB 3Q0GA 1O87A 2I15A 3SP1A 5JBWA 5L0FA 4ZLDA 2OU6A 4NCQA 3C62A 2ZPAA 5DLJA 5JRAA 3QXZA 3FXHA 2J9WA 4DBRA 4XPWA 2PP4A 1MJ3A 2GFHA 3QK8A 2RSEB 4LDQA 2EPKX 2G3KA 2YL7A 3KYJA 1DUBA 1CPRA 4XEKA 2UUIA 2GWWA 4FAPB 3U3FA 1D0XA 3M1CB 1O3UA 5BQIA 3EGXA 1OXKA 4GEHA 4BG0A 2IBFA 1NFOA 3B9QA 1NU9C 3U2LA 5BQGA 2IXNA 1CGNA 1MMAA 4Z9IA 1LVKA 5T3TA 4JOTA 4WCZA 3IRBA 2ETSA 2VH3A 5DS6A 2HW5A 2CNWD 3RKOF 3T4RA 1K04A 3L0IA 5A6AA 3GEIA 4XWJA 5DVWA 2DGJA 3ZDLA 5KYYA 1FR0A 4NTBA 2Y39A 1E2XA 2L9JA 3JT1A 2X51A 1VTMP 2AU5A 5C9GA 4MVOA 4E17A 3NYLA 3EGXB 1I4YA 4N6HA 4EKWA 2ZQQA 4KC9A 2VCAA 3FMSA 5CI9A 1NZEA 1TFOB 4JKVA 1XZPA 2C03A 2XM4A 4JWVA 5COGA 2EPLX 4U5DE 2VX2A 2OOCA 3GANA 1G8XA 2P7VA 3GEEA 4UDVA 4B6IA 1ZHXA 1IZMA 1LE2A 4WGYA 1RKEA 3A11A 4CSAC 1GS9A 3S84A 5L0HA 1JOGA 1OCCC 1V55C 1U0BB 2RD9A 4OLQA 3RYLA 4JC7A 3ASNC 4E0IA 1WWPA 3EZHA 3SXMA 1OQCA 1VK5A 2XXAA 3AG1C 1Z23A 4OD5A 3ITFA 1LPEA 4E0HA 4AL0A 4FZWC 4NC3A 1BZ4A 2EPMX 3LS1A 2HS5A 1Z5ZA 4U5GA 3T6JA 3RW0A 1RJMA 4OD4A 2O9XA 5JUAA 2R7XA 3IQTA 1BBHA 2QQ3A 3X1OA 3G64A 5GPGB 3DAFA 1A7VA 2GDCA 2QLAA 3AM1A 3KH2A 3MX3A 2P63A 1RJNA 1NLXA 5DS4A 3DE8A 4PACA 2UUHA 3S0XA 1HE9A 4ZLCA 1YYJA 1HZDA 2OEVA 3Q6NA 3R0OA 1MMDA 3MBGA 3HNIA 4XLNF 3FVYA 3U0CA 5F5FA 3LUTB 3NMIA 3MYIA 4U9EA 3C18A 5L0CA 2PBPA 2R7WA 1MMGA 2V3CC 1T6QA 2LFFA 4OIOF 3MOYA 2OQMA 2L81A 3E70C 3QW0A 4HEAJ 1Q0KA 3JRTA 2R7OA 4C3DA 1A7DA 5E33A 1ZW3A 3S29A 2NSGA 3QW1A 2PF4E 1UX4A 2B0HA 2HZ8A 3UNGC 2AWCA 1TWCA 3EG9A 3Q1TA 3LS0A 1YA7O 5JSLA 4HFKB 3O6XA 1ZW2A 1GM5A 1Q52A 5KYUA 4EBBA 4XPXA 1WZ8A 2XM0A 5T3WA 4MTGA 2YEVA 3SNHA 4CIPA 4J7TA 1F1MA 1OCOC 3R2PA 3N24A 3G4ZA 3H65A 3SWXA 2YWAA 3DI5A 1YZCA 2R05A 4U5BE 3U8PA 3UGPA 3A4LA 3SEOA 3RIPA 1YA9A 2ZD9A 2KGOA 1EF8A 2UZFA 2R7SA 4IB4A 4IZDA 4U5FE 3ADDA 3SXZA 2Y3DA 1R5ID 4QIJA 4YN0B 4MVQA 2A6HF 1FNTc 4MI2A 4AX2A 3A4MA 3WHNA 3L8IA 3KPHA 5KYUB 4LDRA 4C3BA 5COFA 1J8YF 3KKBA 2E87A 4YK5A 2IXOA 3JYYA 3HNJA 4Z9HA 1ORYA 5IY5C 2HJMA 2NUPA 2XLEA 1TWAA 1YDIA 3SZRA 2Q00A 2NPUA 4U5CE 4K3WA 3W4YA 3NMKA 2CDQA 4E7SA 4ULVA 5A6BA 3OC7A 3HKKA 1H6GA 2IXMA 4RDAA 3ABLC 2M64A 3HNLA 1AUEA 4CIHA 3ZQVA 5D91A 3GM3A 2ICWG 4CJOA 2LD6A 4JTDB 3GEHA 2R25A 1ZHZA 4QIIA 2M4EA 3K1IC 1JMWA 3ECSA 1SMYF 1PD1A 2NUPB 3U2MA 1E85A 4PK4A 2EILC 4DBQA 4P9TA 2HV7A 1JXZA 4IAOA 2DYSC 3X2QC 1H7IA 2F6QA 4CS7A 3RF3A 5A6KA 3C63A 3TD7A 2R7UA 4N4WA 1EQ1A 3BRJA 4QI0A 3NRHA 3ZTZA 4YT2A 1W2WA 5B3SC 4EUKB 1ORSC 1R4TA 1D1BA 2H7OA 3F46A 1ZHYA 4MVUA 1HW2A 4O7GA 3C8GA 3T89A 1ZHTA 1WOLA 3HINA 3CQZA 4EHPA 3NG1A 5L3QA 1SF8A 3VM6A 3UMKA 5B3IA 4K7BA 5COMA 3I5QA 2P0NA 3ZQYA 4BJ6C 2ZXOA 3ATPA 3ZC4A 3O55A 3K7DA 2XLWA 2TMVP 3HTKC 3K33A 3LAYA 1E86A 3R7CA 1A41A 1RXQA 2D5RB 3RSIA 3ASOC 3O39A 2R03A 2EIKC 2Q9CA 1CGOA 1PD0A 3FDQA 2AVKA 3SXKA 3L8JA 3C8GB 4CS8C 4LDKA 2IM8A 3NMJA 3IQ5A 4PJJA 4YL0A 2KYHA 1VLTA 2EIJC 3EQLF 4QI2A 3DXJF 3A9CA 1YVIA 4BJ1A 4MVRA 1VLSA 5BUOA 1LM3B 2LFDA 1DOWA 3W8HA 3O10A 5A6BD 4QDLA 2G3VA 3IPMO 3RQGA 1S7ZA 1BR1A 3OA1A 3AJMA 4E18A 4JYLA 3EGDA 3DJUB 4DRIB 3TJ6A 2LIGA 2ZQRA 2L6HA 3EPVA 2Q7RA 2HFIA 256BA 3I4UA 3MLGA 3V5YA 4XEVA 4BJ5C 4PJNA 1BDJB 4EMLA 4A4AA 1G4WR 1T5OA 3QMKA 1ZVZA 4A2NB 2XL6A 3GWNA 1M56C 3TOMA 4OIRF 3EH2A 3V5ZA 4G7HF 1GGQA 2Z15A 3IQ6A 3EGDB 2I8BA 3E9VA 4XPYA 2LK4A 2YLGA 1Y6DA 1C03A 3EJNA 1MQVA 3NKEA 3QVYA 2DB4A 4GEHB 4XQ1A 4MQ9F 3DD7A 2VB6A 4YT8A 4F4BA 5TJ5E 3VRCA 3C8GD 2WVQA 3I5PA 2J9BA 3M79A 2WVNA 2ZXPA 3CSKA 1UG7A 3C7JA 4E7ZA 5KYYB 1OKKA 3AGUA 4MNDA 1N1CA 3RVZA 3US6A 5CI8A 3IQCA 3ZWIA 1QVXA 2KSFA 3L1MA 3ZTMA 4JVSA 3H2UA 1AVOB 4PR9A 2L7AA 3LESA 3N2ZB 3DKAA 2Q3TA 3HRXA 3POVA 4ELSA 2J7PA 3RVYA 4G7OF 2GAQA 3KYIA 1Y4CA 4I1MA 5L0GA 3N0TA 4JW1A 4IGGA 3TLFA 4IJJA 2G62A 3BEHA 2P1AA 2C04A 1LS4A 4P6IC 3DAGA 1RKEB 5JBXA 3S27A 3TJ5A 4MVZA 3WG7C 4NEKA 4BJ5A 2R7TA 2R7VA 1LS1A 2GTRA 1ZU4A 1SYQA 5DS5A 1LKXA 3FAJA 2NUTA 1EY3A 4Z9JA 3ZSUA 1E84A 3JZ0A 2GA0A 3W2VA 2XXAB 5K0IA 1H9TA 4FJWD 3FAPB 2XL8A 4OIQF 3WODF 4GQHA 1YJGA 4R32A 3ZVRA 1HE1A 1APCA 2J9VA 2YVKA 4CDYA 3IHUA 2Q4FA 4OG1A 3LNRA 3QVZA 4U5EE 4AK9A 4JEBA 1Z63A 4J32B 4IRUA 1XWJA 4DJ9A 1RJ9A 1V74B 3JTLO 1B68A 3OWTA 3HNKA 2NUTB 2HMZA 5HV9A 2JX0A 3UMIA 4BPMA 1QQ3A 2J8WA 3ZG1A 4JE9A 4YL1A 2EIMC 4CSAA 4CX9A 2LSEA 1RKCA 4O79A 1L7CA 5AC4A 2YHSA 3T6GB 1JRAA 2HUJA 1RJ9B 1OKKD 2L6GA 5D92A 4AE4A 5AGFA 5JLIA 2KW3C 4OINF 5A6JA 1DCIA 3H2VA 2L6FA 4IZBA 4FZWA 5HSWA 1ORJA 5L0JA 3H81A 3DJNB 4LLCA 1JPJA 1L3PA 3U5SA 1YLMA 1ZZPA 2BE5F 5EGYA 2QTVA 5KYXA 3LNMB 3PMRA 3EG9B 2J7PD 1VYIA 4PFPA 3CEXA 4HE8D 2QY9A 1UFBA 2KJGA 3IEEA 2H7BA 3PCVA 4X0RA 1VYKA 2WL8A 3B0VC 4U5HA 4XLPF 5FZTA 1E83A 5KYNA 4O6NA 1NBBA 4G0HA 3FOOA 5F28E 3QXIA 1KNYA 2A0UA 1OCRC 2QUPA 2J46A 2H7VC 4G7ZF 1D0YA 5KYXB 3GM2A 1UX5A 4IARA 3DZAA 3QTHA 4BEJA 4MOUA 2F22A 3U3BA 4G78A 2MYSA 1V4AA 3DM9B 4DOZA 1QZXA 2XSEA 1M2VA 3NKDA 4J30B 2JPUA 2J45A 1BR2A 1T6IA 1TKNA 2XLHA 4KI2A 2PFDA 4EIYA 1A0BA 3LEOA 2FBMA 3EZIA 1CPQA 4U1AA 2YZSA 1KU2A 3W8IA 1TR2A 3EFOA 3B0PA 5F5HA 1JAFA 1HMOA 1DOVA 4OIPF 2W9YA 3ADBA 2OJQA 2LP4A 1Y64B 3B71A 1VMAA 1C02A 3C8ZA 2EINC 2BC5A 3JSEO 3AQBA 1AEPA 1LIHA 3DE9A 4U18A 2B0JA 5L3VA 2V26A 3B29A 3O4XE 1M2OA 1Z6AA 4KNWA 4EBKA 4U9DA 4CBEA 3K66A 4JTCB 3W8IB 2P6VA 1BR4A 2PPYA 2EPOA 2KK1A 2NG1A 2HV6A 4IAQA 2W45A 3EFOB 2DUBA 2PBEA 2EPNA 4JCSA 4LACB 1NZYA 2XLVA 3NYMA 5FCLA 3PHF2 1S05A 3GM1A 2XLMA 5A69A 3GWLA 4C7OA 3S9OA 3I47A 4WABA 2HJ3A 3MFNA 3LLIA 4FX5A 5B1AC 2HSBA 1NU7D 4ULWA 1V54C 3JRMO 4JFCA
chains in the Genus database with same CATH topology
1K05A 1PV3A 1WWPA 1OW7A 1UFBA 3IRBA 1K04A 2L6HA 2Q00A 3C8GA 1QVXA 1UX4A 1WOLA 3ADBA 1Y64B 3B71A 4XEVA 3RQFA 3ADCA 5F28E 3RQEA 1KNYA 1RJMA 2JX0A 1OW8A 3K7DA 1OW6A 3GM3A 1KTMA 2YWAA 3O4XE 4EBKA 3TULA 3GM2A 1UX5A 3AM1A 3A4LA 2LK4A 3W8IB 4EBJA 2KK1A 2P63A 3L8JA 3C8GB 2PBEA 3W8HB 1WTYA 4GEHB 2L6GA 3A4NA 3ADDA 2L6FA 1V4AA 3C8GD 4XEKA 4XEFA 3A4MA 3GM1A 3L8IA 3JZ0A 3U3FA 1JOGA 4NQFA 1K40A 3U0CA 1O3UA 2JPUA 3O10A 3S9OA 3C18A 3BRJA 4NNQA 3RQGA 3MFNA 3JYYA 2HSBA 1ZZPA 4R32A 3AJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  1PV3 A;  3RQF A;  2YWA A;  1WWP A;  5F28 E;  4EBK A;  3TUL A;  2L6F A;  1OW7 A;  3GM2 A;  3RQE A;  1V4A A;  1UFB A;  3C8G D;  4XEK A;  1KNY A;  4XEF A;  3GM1 A;  3L8I A;  2LK4 A;  3JZ0 A;  3W8I B;  3U3F A;  4EBJ A;  1K04 A;  2L6H A;  1JOG A;  2JX0 A;  2KK1 A;  1K40 A;  2Q00 A;  4NQF A;  3C8G A;  1O3U A;  3U0C A;  1QVX A;  2JPU A;  3L8J A;  3O10 A;  3S9O A;  3C18 A;  3C8G B;  1OW8 A;  3W8H B;  1WTY A;  1WOL A;  2PBE A;  3RQG A;  3BRJ A;  3K7D A;  3MFN A;  1OW6 A;  3JYY A;  4GEH B;  2L6G A;  3GM3 A;  2HSB A;  3B71 A;  1ZZP A;  4XEV A;  4R32 A;  1KTM A;  3AJM A; 
#chains in the Genus database with same CATH topology
 4YWQ A;  5T1D B;  4C3E A;  5JVE A;  3U8V A;  4ZU2 A;  3AG4 C;  2MWQ A;  2YQY A;  3M4C A;  4YL3 A;  1YAU O;  1PCX A;  3AG2 C;  3K1I A;  1QLE C;  3DWW A;  1NG1 A;  1J8M F;  5CIV A;  3CAX A;  2YL3 A;  3ABM C;  2AWY A;  4CDA A;  3MYB A;  2A1D D;  4JEA A;  1C17 M;  4C7O B;  3KMI A;  2EJ5 A;  1IW7 F;  3JYH A;  2Q9A A;  2Y69 C;  1TWG A;  2IOQ A;  3T9O A;  2J9U A;  3TUL A;  4NTA A;  4RD9 A;  2Y3B A;  3TK0 A;  4P9F A;  3T88 A;  5BQH A;  5AC5 A;  2QNL A;  3W8H B;  2D4U A;  2W4B A;  4YT4 A;  2VCC A;  4MW3 A;  2R7Q A;  5DQZ A;  3FOP A;  3B0U X;  2OJE D;  2HMQ A;  4XEF A;  4FWV A;  2VC9 A;  2DI3 A;  1HY5 A;  3RFY A;  1EI7 A;  3Q0J A;  4DVZ A;  3SYN A;  1SZI A;  2Y3G A;  1VB5 A;  1TFK B;  3NDB B;  1GQA A;  3H02 A;  4BJ6 A;  3HLZ A;  1YZA A;  1ZYR F;  2YRF A;  5JS5 A;  1TQG A;  2IXP A;  2PX3 A;  4Q5S F;  1WGW A;  4NY3 A;  1JPN A;  4D4X A;  4JUR I;  3GOR A;  2VCB A;  3M4B A;  1FFT C;  2CGE A;  2HSQ A;  3AGT A;  2A68 F;  2BL2 A;  4CS8 A;  2XRH A;  4W8P A;  3U9M A;  1H9G A;  4N6C A;  4I44 A;  1OR2 A;  1U89 A;  2A69 F;  2P61 A;  4JZA A;  2W4M A;  4N06 A;  3VAY A;  4I52 A;  4MTO A;  2QE9 A;  3FDU A;  1Q51 A;  2MHR A;  3G50 A;  5EK0 A;  2WZL A;  2OEX A;  1Z3I X;  4K2N A;  3GOD A;  4ELX A;  1WAS A;  2WZF A;  3FHD A;  1Q0F A;  2H8A A;  3W2W A;  3SXY A;  5EHH A;  1SR2 A;  4ANJ A;  4I42 A;  2JD3 A;  2LCH A;  4J7Y A;  1ST6 A;  4PJM A;  3EHN A;  4EWC A;  3HJC A;  3TRR A;  3KL4 A;  4CDV A;  4CJG A;  2KNH A;  4NNQ A;  5L0I A;  4CS9 C;  3JCU Q;  2WB7 A;  2OCC C;  2CCY A;  4DXW A;  4HFF B;  2IEX A;  1OW7 A;  3ABK C;  4MS2 A;  2R9R B;  1T01 A;  1I4Z A;  3QZC A;  1LI7 A;  3CZ6 A;  2XL4 A;  4FES A;  4JIO A;  5KYW A;  3KQF A;  3EH1 A;  1JR8 A;  2CYD A;  1RMV A;  3WAQ A;  2Q9B A;  3V5X A;  4NTF A;  2FGY A;  2R02 A;  2PX0 A;  2CW0 F;  2YL0 A;  1MNE A;  1OW6 A;  4U19 A;  4YT5 A;  1KTM A;  1U6H A;  1LE4 A;  1QKR A;  1D1A A;  1WN0 A;  3L34 A;  2PNO A;  4JCZ A;  4MTF A;  3AOU A;  5KYW B;  4O6M A;  1G4U S;  4I4Z A;  3NYJ A;  2ZXR A;  4GYT A;  2ZXW C;  4DVY P;  1TWH A;  4IWB A;  1MND A;  3R9T A;  2Y3H A;  4MW8 A;  4JCH A;  5KJP A;  4LER A;  5E3A A;  3LJB A;  1EKY A;  1MMN A;  4WJ0 A;  1FTS A;  3TQO A;  1YYX A;  2XS1 A;  3DMD A;  1O5H A;  2J0X A;  3RQF A;  3JSZ A;  3VF0 A;  3ADC A;  2VRE A;  5E3C A;  4I3M A;  2FW2 A;  4CS9 A;  1NFN A;  4M63 A;  1HMD A;  2IYL D;  1CGM E;  1A7E A;  2AP3 A;  4K0D A;  1T6U A;  2VAS A;  3MYF A;  1ZU5 A;  4JJG A;  3OEO A;  1FFH A;  4D4N A;  5L0D A;  4H4K C;  4AE4 B;  5B1B C;  3Q6M A;  2ASR A;  3PZK A;  1QPU A;  4H54 A;  3P5M A;  1Q0D A;  2X0C A;  2HKV A;  1T9K A;  3Q7G A;  4KNP A;  3UMH A;  4Q4Z F;  3DM5 A;  2R7R A;  4WGZ A;  4JTA B;  1I5N A;  4NQF A;  1K40 A;  3K1H A;  2FFH A;  3F47 A;  4JJF A;  2WVO A;  1LI5 A;  1OXB A;  4ONS A;  1Z7Q c;  4PFO A;  1UIY A;  2NSF A;  3LLK A;  4AL1 A;  5JP7 A;  5DQT A;  4L6R A;  1ZHW A;  4O6Y A;  4JRZ A;  1D1C A;  4RBN A;  3Q7L A;  3RQE A;  3ZIB A;  4ELW A;  3T8A A;  1QSP A;  2CNW A;  1M57 C;  4Q7C A;  2DYR C;  2XLD A;  3S28 A;  3R9S A;  1D0Z A;  3UGO A;  1EA8 A;  3UR3 C;  1EF9 A;  4EBJ A;  1M2V B;  4PJL A;  2FAP B;  4LLE A;  1HW1 A;  1RCP A;  1WTY A;  3EHM A;  2OG2 A;  2YLD A;  3A4N A;  4XTK A;  4BJT A;  1WAT A;  3V7O A;  3T6B A;  3U9J A;  2KC3 A;  4KBL A;  4K1O A;  4ER9 A;  2YKZ A;  1G5Z A;  2XLO A;  2YLI A;  3AG3 C;  3RH3 A;  3SLL A;  1FMW A;  3M15 A;  1FMV A;  3G4X A;  3J06 A;  2YL1 A;  4DRJ B;  1K05 A;  1PV3 A;  2XS8 A;  4YJW A;  1XZQ A;  1OR3 A;  5E2Q A;  4W8K A;  4IZC A;  1OCZ C;  3LEV A;  4BEM J;  3K6B A;  2J0W A;  1NSG B;  3S90 A;  3PDM P;  1VOM A;  4MVM A;  1Q0G A;  3AQC A;  4F47 A;  2LQG A;  5JT4 A;  2A0B A;  2KQ9 A;  2OKU A;  2A6E F;  1YAR O;  4MVS A;  3VYW A;  1OW8 A;  4I1O B;  1M6T A;  4DRH B;  2WZG A;  3TOL A;  4KNV A;  1Q0M A;  1FAP B;  1NZY B;  3Q0G A;  1O87 A;  2I15 A;  3SP1 A;  5JBW A;  5L0F A;  4ZLD A;  2OU6 A;  4NCQ A;  3C62 A;  2ZPA A;  5DLJ A;  5JRA A;  3QXZ A;  3FXH A;  2J9W A;  4DBR A;  4XPW A;  2PP4 A;  1MJ3 A;  2GFH A;  3QK8 A;  2RSE B;  4LDQ A;  2EPK X;  2G3K A;  2YL7 A;  3KYJ A;  1DUB A;  1CPR A;  4XEK A;  2UUI A;  2GWW A;  4FAP B;  3U3F A;  1D0X A;  3M1C B;  1O3U A;  5BQI A;  3EGX A;  1OXK A;  4GEH A;  4BG0 A;  2IBF A;  1NFO A;  3B9Q A;  1NU9 C;  3U2L A;  5BQG A;  2IXN A;  1CGN A;  1MMA A;  4Z9I A;  1LVK A;  5T3T A;  4JOT A;  4WCZ A;  3IRB A;  2ETS A;  2VH3 A;  5DS6 A;  2HW5 A;  2CNW D;  3RKO F;  3T4R A;  1K04 A;  3L0I A;  5A6A A;  3GEI A;  4XWJ A;  5DVW A;  2DGJ A;  3ZDL A;  5KYY A;  1FR0 A;  4NTB A;  2Y39 A;  1E2X A;  2L9J A;  3JT1 A;  2X51 A;  1VTM P;  2AU5 A;  5C9G A;  4MVO A;  4E17 A;  3NYL A;  3EGX B;  1I4Y A;  4N6H A;  4EKW A;  2ZQQ A;  4KC9 A;  2VCA A;  3FMS A;  5CI9 A;  1NZE A;  1TFO B;  4JKV A;  1XZP A;  2C03 A;  2XM4 A;  4JWV A;  5COG A;  2EPL X;  4U5D E;  2VX2 A;  2OOC A;  3GAN A;  1G8X A;  2P7V A;  3GEE A;  4UDV A;  4B6I A;  1ZHX A;  1IZM A;  1LE2 A;  4WGY A;  1RKE A;  3A11 A;  4CSA C;  1GS9 A;  3S84 A;  5L0H A;  1JOG A;  1OCC C;  1V55 C;  1U0B B;  2RD9 A;  4OLQ A;  3RYL A;  4JC7 A;  3ASN C;  4E0I A;  1WWP A;  3EZH A;  3SXM A;  1OQC A;  1VK5 A;  2XXA A;  3AG1 C;  1Z23 A;  4OD5 A;  3ITF A;  1LPE A;  4E0H A;  4AL0 A;  4FZW C;  4NC3 A;  1BZ4 A;  2EPM X;  3LS1 A;  2HS5 A;  1Z5Z A;  4U5G A;  3T6J A;  3RW0 A;  1RJM A;  4OD4 A;  2O9X A;  5JUA A;  2R7X A;  3IQT A;  1BBH A;  2QQ3 A;  3X1O A;  3G64 A;  5GPG B;  3DAF A;  1A7V A;  2GDC A;  2QLA A;  3AM1 A;  3KH2 A;  3MX3 A;  2P63 A;  1RJN A;  1NLX A;  5DS4 A;  3DE8 A;  4PAC A;  2UUH A;  3S0X A;  1HE9 A;  4ZLC A;  1YYJ A;  1HZD A;  2OEV A;  3Q6N A;  3R0O A;  1MMD A;  3MBG A;  3HNI A;  4XLN F;  3FVY A;  3U0C A;  5F5F A;  3LUT B;  3NMI A;  3MYI A;  4U9E A;  3C18 A;  5L0C A;  2PBP A;  2R7W A;  1MMG A;  2V3C C;  1T6Q A;  2LFF A;  4OIO F;  3MOY A;  2OQM A;  2L81 A;  3E70 C;  3QW0 A;  4HEA J;  1Q0K A;  3JRT A;  2R7O A;  4C3D A;  1A7D A;  5E33 A;  1ZW3 A;  3S29 A;  2NSG A;  3QW1 A;  2PF4 E;  1UX4 A;  2B0H A;  2HZ8 A;  3UNG C;  2AWC A;  1TWC A;  3EG9 A;  3Q1T A;  3LS0 A;  1YA7 O;  5JSL A;  4HFK B;  3O6X A;  1ZW2 A;  1GM5 A;  1Q52 A;  5KYU A;  4EBB A;  4XPX A;  1WZ8 A;  2XM0 A;  5T3W A;  4MTG A;  2YEV A;  3SNH A;  4CIP A;  4J7T A;  1F1M A;  1OCO C;  3R2P A;  3N24 A;  3G4Z A;  3H65 A;  3SWX A;  2YWA A;  3DI5 A;  1YZC A;  2R05 A;  4U5B E;  3U8P A;  3UGP A;  3A4L A;  3SEO A;  3RIP A;  1YA9 A;  2ZD9 A;  2KGO A;  1EF8 A;  2UZF A;  2R7S A;  4IB4 A;  4IZD A;  4U5F E;  3ADD A;  3SXZ A;  2Y3D A;  1R5I D;  4QIJ A;  4YN0 B;  4MVQ A;  2A6H F;  1FNT c;  4MI2 A;  4AX2 A;  3A4M A;  3WHN A;  3L8I A;  3KPH A;  5KYU B;  4LDR A;  4C3B A;  5COF A;  1J8Y F;  3KKB A;  2E87 A;  4YK5 A;  2IXO A;  3JYY A;  3HNJ A;  4Z9H A;  1ORY A;  5IY5 C;  2HJM A;  2NUP A;  2XLE A;  1TWA A;  1YDI A;  3SZR A;  2Q00 A;  2NPU A;  4U5C E;  4K3W A;  3W4Y A;  3NMK A;  2CDQ A;  4E7S A;  4ULV A;  5A6B A;  3OC7 A;  3HKK A;  1H6G A;  2IXM A;  4RDA A;  3ABL C;  2M64 A;  3HNL A;  1AUE A;  4CIH A;  3ZQV A;  5D91 A;  3GM3 A;  2ICW G;  4CJO A;  2LD6 A;  4JTD B;  3GEH A;  2R25 A;  1ZHZ A;  4QII A;  2M4E A;  3K1I C;  1JMW A;  3ECS A;  1SMY F;  1PD1 A;  2NUP B;  3U2M A;  1E85 A;  4PK4 A;  2EIL C;  4DBQ A;  4P9T A;  2HV7 A;  1JXZ A;  4IAO A;  2DYS C;  3X2Q C;  1H7I A;  2F6Q A;  4CS7 A;  3RF3 A;  5A6K A;  3C63 A;  3TD7 A;  2R7U A;  4N4W A;  1EQ1 A;  3BRJ A;  4QI0 A;  3NRH A;  3ZTZ A;  4YT2 A;  1W2W A;  5B3S C;  4EUK B;  1ORS C;  1R4T A;  1D1B A;  2H7O A;  3F46 A;  1ZHY A;  4MVU A;  1HW2 A;  4O7G A;  3C8G A;  3T89 A;  1ZHT A;  1WOL A;  3HIN A;  3CQZ A;  4EHP A;  3NG1 A;  5L3Q A;  1SF8 A;  3VM6 A;  3UMK A;  5B3I A;  4K7B A;  5COM A;  3I5Q A;  2P0N A;  3ZQY A;  4BJ6 C;  2ZXO A;  3ATP A;  3ZC4 A;  3O55 A;  3K7D A;  2XLW A;  2TMV P;  3HTK C;  3K33 A;  3LAY A;  1E86 A;  3R7C A;  1A41 A;  1RXQ A;  2D5R B;  3RSI A;  3ASO C;  3O39 A;  2R03 A;  2EIK C;  2Q9C A;  1CGO A;  1PD0 A;  3FDQ A;  2AVK A;  3SXK A;  3L8J A;  3C8G B;  4CS8 C;  4LDK A;  2IM8 A;  3NMJ A;  3IQ5 A;  4PJJ A;  4YL0 A;  2KYH A;  1VLT A;  2EIJ C;  3EQL F;  4QI2 A;  3DXJ F;  3A9C A;  1YVI A;  4BJ1 A;  4MVR A;  1VLS A;  5BUO A;  1LM3 B;  2LFD A;  1DOW A;  3W8H A;  3O10 A;  5A6B D;  4QDL A;  2G3V A;  3IPM O;  3RQG A;  1S7Z A;  1BR1 A;  3OA1 A;  3AJM A;  4E18 A;  4JYL A;  3EGD A;  3DJU B;  4DRI B;  3TJ6 A;  2LIG A;  2ZQR A;  2L6H A;  3EPV A;  2Q7R A;  2HFI A;  256B A;  3I4U A;  3MLG A;  3V5Y A;  4XEV A;  4BJ5 C;  4PJN A;  1BDJ B;  4EML A;  4A4A A;  1G4W R;  1T5O A;  3QMK A;  1ZVZ A;  4A2N B;  2XL6 A;  3GWN A;  1M56 C;  3TOM A;  4OIR F;  3EH2 A;  3V5Z A;  4G7H F;  1GGQ A;  2Z15 A;  3IQ6 A;  3EGD B;  2I8B A;  3E9V A;  4XPY A;  2LK4 A;  2YLG A;  1Y6D A;  1C03 A;  3EJN A;  1MQV A;  3NKE A;  3QVY A;  2DB4 A;  4GEH B;  4XQ1 A;  4MQ9 F;  3DD7 A;  2VB6 A;  4YT8 A;  4F4B A;  5TJ5 E;  3VRC A;  3C8G D;  2WVQ A;  3I5P A;  2J9B A;  3M79 A;  2WVN A;  2ZXP A;  3CSK A;  1UG7 A;  3C7J A;  4E7Z A;  5KYY B;  1OKK A;  3AGU A;  4MND A;  1N1C A;  3RVZ A;  3US6 A;  5CI8 A;  3IQC A;  3ZWI A;  1QVX A;  2KSF A;  3L1M A;  3ZTM A;  4JVS A;  3H2U A;  1AVO B;  4PR9 A;  2L7A A;  3LES A;  3N2Z B;  3DKA A;  2Q3T A;  3HRX A;  3POV A;  4ELS A;  2J7P A;  3RVY A;  4G7O F;  2GAQ A;  3KYI A;  1Y4C A;  4I1M A;  5L0G A;  3N0T A;  4JW1 A;  4IGG A;  3TLF A;  4IJJ A;  2G62 A;  3BEH A;  2P1A A;  2C04 A;  1LS4 A;  4P6I C;  3DAG A;  1RKE B;  5JBX A;  3S27 A;  3TJ5 A;  4MVZ A;  3WG7 C;  4NEK A;  4BJ5 A;  2R7T A;  2R7V A;  1LS1 A;  2GTR A;  1ZU4 A;  1SYQ A;  5DS5 A;  1LKX A;  3FAJ A;  2NUT A;  1EY3 A;  4Z9J A;  3ZSU A;  1E84 A;  3JZ0 A;  2GA0 A;  3W2V A;  2XXA B;  5K0I A;  1H9T A;  4FJW D;  3FAP B;  2XL8 A;  4OIQ F;  3WOD F;  4GQH A;  1YJG A;  4R32 A;  3ZVR A;  1HE1 A;  1APC A;  2J9V A;  2YVK A;  4CDY A;  3IHU A;  2Q4F A;  4OG1 A;  3LNR A;  3QVZ A;  4U5E E;  4AK9 A;  4JEB A;  1Z63 A;  4J32 B;  4IRU A;  1XWJ A;  4DJ9 A;  1RJ9 A;  1V74 B;  3JTL O;  1B68 A;  3OWT A;  3HNK A;  2NUT B;  2HMZ A;  5HV9 A;  2JX0 A;  3UMI A;  4BPM A;  1QQ3 A;  2J8W A;  3ZG1 A;  4JE9 A;  4YL1 A;  2EIM C;  4CSA A;  4CX9 A;  2LSE A;  1RKC A;  4O79 A;  1L7C A;  5AC4 A;  2YHS A;  3T6G B;  1JRA A;  2HUJ A;  1RJ9 B;  1OKK D;  2L6G A;  5D92 A;  4AE4 A;  5AGF A;  5JLI A;  2KW3 C;  4OIN F;  5A6J A;  1DCI A;  3H2V A;  2L6F A;  4IZB A;  4FZW A;  5HSW A;  1ORJ A;  5L0J A;  3H81 A;  3DJN B;  4LLC A;  1JPJ A;  1L3P A;  3U5S A;  1YLM A;  1ZZP A;  2BE5 F;  5EGY A;  2QTV A;  5KYX A;  3LNM B;  3PMR A;  3EG9 B;  2J7P D;  1VYI A;  4PFP A;  3CEX A;  4HE8 D;  2QY9 A;  1UFB A;  2KJG A;  3IEE A;  2H7B A;  3PCV A;  4X0R A;  1VYK A;  2WL8 A;  3B0V C;  4U5H A;  4XLP F;  5FZT A;  1E83 A;  5KYN A;  4O6N A;  1NBB A;  4G0H A;  3FOO A;  5F28 E;  3QXI A;  1KNY A;  2A0U A;  1OCR C;  2QUP A;  2J46 A;  2H7V C;  4G7Z F;  1D0Y A;  5KYX B;  3GM2 A;  1UX5 A;  4IAR A;  3DZA A;  3QTH A;  4BEJ A;  4MOU A;  2F22 A;  3U3B A;  4G78 A;  2MYS A;  1V4A A;  3DM9 B;  4DOZ A;  1QZX A;  2XSE A;  1M2V A;  3NKD A;  4J30 B;  2JPU A;  2J45 A;  1BR2 A;  1T6I A;  1TKN A;  2XLH A;  4KI2 A;  2PFD A;  4EIY A;  1A0B A;  3LEO A;  2FBM A;  3EZI A;  1CPQ A;  4U1A A;  2YZS A;  1KU2 A;  3W8I A;  1TR2 A;  3EFO A;  3B0P A;  5F5H A;  1JAF A;  1HMO A;  1DOV A;  4OIP F;  2W9Y A;  3ADB A;  2OJQ A;  2LP4 A;  1Y64 B;  3B71 A;  1VMA A;  1C02 A;  3C8Z A;  2EIN C;  2BC5 A;  3JSE O;  3AQB A;  1AEP A;  1LIH A;  3DE9 A;  4U18 A;  2B0J A;  5L3V A;  2V26 A;  3B29 A;  3O4X E;  1M2O A;  1Z6A A;  4KNW A;  4EBK A;  4U9D A;  4CBE A;  3K66 A;  4JTC B;  3W8I B;  2P6V A;  1BR4 A;  2PPY A;  2EPO A;  2KK1 A;  2NG1 A;  2HV6 A;  4IAQ A;  2W45 A;  3EFO B;  2DUB A;  2PBE A;  2EPN A;  4JCS A;  4LAC B;  1NZY A;  2XLV A;  3NYM A;  5FCL A;  3PHF 2;  1S05 A;  3GM1 A;  2XLM A;  5A69 A;  3GWL A;  4C7O A;  3S9O A;  3I47 A;  4WAB A;  2HJ3 A;  3MFN A;  3LLI A;  4FX5 A;  5B1A C;  2HSB A;  1NU7 D;  4ULW A;  1V54 C;  3JRM O;  4JFC A; 
#chains in the Genus database with same CATH homology
 1K05 A;  1PV3 A;  1WWP A;  1OW7 A;  1UFB A;  3IRB A;  1K04 A;  2L6H A;  2Q00 A;  3C8G A;  1QVX A;  1UX4 A;  1WOL A;  3ADB A;  1Y64 B;  3B71 A;  4XEV A;  3RQF A;  3ADC A;  5F28 E;  3RQE A;  1KNY A;  1RJM A;  2JX0 A;  1OW8 A;  3K7D A;  1OW6 A;  3GM3 A;  1KTM A;  2YWA A;  3O4X E;  4EBK A;  3TUL A;  3GM2 A;  1UX5 A;  3AM1 A;  3A4L A;  2LK4 A;  3W8I B;  4EBJ A;  2KK1 A;  2P63 A;  3L8J A;  3C8G B;  2PBE A;  3W8H B;  1WTY A;  4GEH B;  2L6G A;  3A4N A;  3ADD A;  2L6F A;  1V4A A;  3C8G D;  4XEK A;  4XEF A;  3A4M A;  3GM1 A;  3L8I A;  3JZ0 A;  3U3F A;  1JOG A;  4NQF A;  1K40 A;  3U0C A;  1O3U A;  2JPU A;  3O10 A;  3S9O A;  3C18 A;  3BRJ A;  4NNQ A;  3RQG A;  3MFN A;  3JYY A;  2HSB A;  1ZZP A;  4R32 A;  3AJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...