3AJMA

Crystal structure of programmed cell death 10 in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
201
structure length
201
Chain Sequence
EAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 10
publication title Crystal structure of human programmed cell death 10 complexed with inositol-(1,3,4,5)-tetrakisphosphate: a novel adaptor protein involved in human cerebral cavernous malformation.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3ajmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3ajmA02
3C8GD 1V4AA 2Q00A 5F28E 2L6FA 3K7DA 3S9OA 3U3FA 4NQFA 3L8IA 2JX0A 1QVXA 2L6GA 1WOLA 1WWPA 2YWAA 1K04A 1UFBA 3W8IB 4XEFA 1JOGA 2HSBA 4XEKA 3AJMA 3GM2A 4XEVA 4GEHB 1ZZPA 3B71A 1WTYA 2PBEA 3GM3A 3JZ0A 4EBJA 3RQEA 2JPUA 1OW6A 1KTMA 1K05A 2KK1A 3C8GA 3MFNA 3L8JA 1OW8A 2LK4A 3JYYA 3RQGA 1O3UA 3GM1A 4R32A 3C8GB 3RQFA 3C18A 1KNYA 3O10A 1K40A 1PV3A 1OW7A 2L6HA 3BRJA 3TULA 3U0CA 4EBKA 3W8HB
chains in the Genus database with same CATH superfamily
1CGNA 4N06A 2PNOA 5BUOA 2LQGA 2Z15A 3SNHA 2R9RB 2W9YA 2QQ3A 3AJMA 2YEVA 3A9CA 2PP4A 3AGTA 3H2UA 4WGZA 3L34A 1PD0A 2ZXPA 3T8AA 3R7CA 3L8IA 1MMNA 3GANA 2FW2A 2KQ9A 2ICWG 1UX4A 3NKDA 4U19A 2NSFA 4Q7CA 2A69F 3L0IA 1JXZA 1VLTA 1M6TA 1A7EA 1JRAA 4EIYA 3G64A 4AX2A 1AUEA 1ORYA 2YL3A 1YJGA 4J30B 3EHNA 3FOOA 1TKNA 1MNDA 4G7OF 1OW8A 1TR2A 4PJMA 5KYYA 1JPNA 2PX3A 2ASRA 1OR2A 3MYBA 5JRAA 4KNWA 2XS1A 4ONSA 3F46A 2VCAA 1NFNA 1PV3A 2A68F 4ZU2A 4X0RA 5D91A 3U3FA 1DCIA 3ZG1A 1WWPA 1GM5A 1LE4A 4OLQA 4OG1A 3GM2A 4LACB 3G4ZA 1YDIA 3V7OA 4DVZA 4K0DA 2PBPA 4LLEA 3H65A 4OD4A 3OWTA 4JZAA 5JBXA 5COFA 3A4MA 3AG2C 3EGXB 2DUBA 4MW3A 3QW1A 2YZSA 3IEEA 4WJ0A 2LFDA 1EF8A 2GFHA 4IWBA 4KNPA 2XL8A 3EJNA 2L6GA 1FR0A 3RW0A 4YT2A 4U9EA 5E2QA 3Q6MA 4GEHB 2FFHA 4YJWA 3GEEA 2RSEB 1RCPA 4U1AA 3RF3A 1PD1A 2R7UA 4C7OB 2DB4A 1NSGB 2X51A 1GGQA 4BJ1A 3A4LA 1MQVA 5GPGB 3IQCA 2YVKA 1LVKA 4JCHA 3NYLA 1DOWA 2H7VC 2HFIA 4JOTA 5C9GA 2Q9BA 2IXPA 3EFOB 2FAPB 1A41A 1G4US 2ZXRA 3PHF2 2PBEA 3IQTA 2MWQA 4RBNA 4IAOA 2PFDA 2VCBA 5B1AC 3M1CB 3PDMP 3PMRA 4I42A 3SLLA 4JTCB 2YQYA 3S9OA 1SF8A 2O9XA 2R03A 3QMKA 4O6YA 4EUKB 4K7BA 2MHRA 3M15A 2XXAA 1L7CA 3C62A 1NG1A 2A1DD 3QW0A 2ZXWC 3G4XA 1Z6AA 2NUTA 5B1BC 3R9TA 2VASA 2DI3A 3S0XA 3B71A 4P9FA 2OCCC 4NTAA 2P0NA 2XS8A 5JVEA 1Q0MA 4QIIA 1LS1A 2RD9A 3WODF 3IPMO 3KL4A 1LE2A 3DJUB 2EIMC 4JCZA 5CI9A 4FX5A 2AU5A 5B3IA 4E7ZA 4LDRA 2VREA 4BJ6A 3L8JA 3DAGA 1NU9C 2L9JA 4G7ZF 3NYMA 4MVZA 5KYYB 1Z63A 4JRZA 2ZD9A 4NQFA 4CSAC 2UUHA 5AGFA 1XWJA 4ELXA 3O6XA 2HW5A 1ZHZA 4XLNF 5EHHA 1RKEA 1BR2A 4CDYA 4MVUA 3RFYA 3JSZA 3CSKA 2R7OA 3ITFA 1HZDA 2A6EF 1XZPA 1WATA 3UGPA 1A7VA 2IYLD 1GS9A 3U0CA 3UNGC 4G7HF 2VH3A 1HW1A 1UG7A 5KJPA 3G50A 5KYUA 4BPMA 2HMZA 1OCCC 3KYIA 5L3VA 3F47A 4NY3A 2KSFA 1UIYA 2EPNA 1OCRC 1D0ZA 2GAQA 2F22A 1YA9A 4FZWA 4Q5SF 3C63A 3TJ6A 3HTKC 4I44A 1AVOB 4LERA 2BC5A 4IRUA 3R0OA 2J7PA 1WZ8A 1BR4A 1OXKA 3FXHA 1Z7Qc 1NU7D 1YZCA 3ECSA 4C3DA 3ZDLA 4H4KC 3GM3A 1WTYA 1EKYA 1APCA 4BJ5C 3MX3A 2YLDA 4L6RA 1NFOA 2AP3A 4MTFA 3BEHA 5L0DA 1ZW3A 2OJED 1VOMA 4HFKB 2J8WA 1QLEC 4JCSA 1E85A 2LIGA 1FFHA 2YL1A 4HFFB 3WG7C 2NG1A 4JTDB 2OKUA 3N2ZB 2C03A 1W2WA 3FAPB 3NMIA 3ASOC 3RH3A 3HNIA 2XXAB 1QSPA 3DE9A 2Q4FA 2EPLX 1MMGA 4XPYA 3QK8A 4C3EA 2KW3C 4XWJA 3DMDA 2NUTB 3EG9A 1FTSA 1K04A 2VB6A 3CQZA 4IZCA 2NPUA 2VX2A 4U18A 3SYNA 4W8PA 3SXMA 3U2MA 2OEXA 1OQCA 2UZFA 2D5RB 3LESA 2XLVA 3KKBA 3KPHA 3NYJA 5D92A 2ETSA 1V55C 2GWWA 5E3CA 3K1IA 2R7WA 4ER9A 3JZ0A 3I4UA 4XPXA 5FZTA 2W4MA 2XL4A 3U9JA 3QVZA 1R4TA 2XLEA 1Y64B 1LKXA 4OIPF 3W4YA 5L0IA 1XZQA 4DOZA 2P6VA 3EQLF 4BJTA 2OOCA 2ZXOA 1H7IA 4DJ9A 1JOGA 3A4NA 4NNQA 2YKZA 4MVMA 1Z3IX 4E17A 4U5BE 4WGYA 1Z5ZA 2FGYA 1RKEB 1TFOB 1L3PA 4BG0A 3DKAA 3P5MA 4CS9A 1T6IA 4MI2A 2WL8A 4OINF 3RVYA 2OU6A 3GEIA 3MFNA 4EBBA 5DS6A 4KC9A 5IY5C 3GWNA 1S05A 5CIVA 4NEKA 3ZVRA 1RJ9A 5BQHA 2KK1A 3O55A 3HRXA 3SWXA 2B0JA 4D4XA 5KYUB 4NCQA 2J9WA 4MS2A 1V4AA 5DVWA 4DVYP 1FAPB 3HINA 2CDQA 3PZKA 4M63A 4PK4A 4WCZA 1U0BB 4JE9A 2G3VA 4U5EE 3R2PA 3S90A 2W45A 3ADDA 3JTLO 1HMDA 2DYRC 4ULWA 5B3SC 2XLDA 2WZGA 4YT8A 4YWQA 4MTGA 4CDVA 4W8KA 2H8AA 1IZMA 4JEAA 2WVNA 2Q00A 2HJ3A 2P61A 3L1MA 3EH2A 3NMKA 4JEBA 3EZIA 1BDJB 1WGWA 1D1AA 2IBFA 2R02A 4YN0B 2L6HA 1VYKA 5CI8A 3TOMA 1HE1A 3I47A 4JJGA 2EIKC 2M64A 4Q4ZF 2GA0A 1G4WR 1R5ID 1JAFA 1NLXA 5HV9A 1ZHWA 2H7BA 1T6QA 1YYXA 2B0HA 5KYXA 3OA1A 3EG9B 4U5CE 2LSEA 1NBBA 3DM9B 1Q0DA 1OXBA 1LI5A 3C18A 5BQIA 3FMSA 1YARO 3T89A 4FESA 3LAYA 4DXWA 3U9MA 3UMHA 4N6CA 5JLIA 1VK5A 3SEOA 1O87A 5JP7A 2YLIA 1V74B 1LIHA 1K40A 4PR9A 3T6GB 4OIOF 1PCXA 2R7VA 3S27A 3LEVA 1RXQA 3KQFA 2GTRA 4E0HA 3ZC4A 3X2QC 1Z23A 4PFOA 3SXZA 4AL1A 2CYDA 3AM1A 1FMVA 1ZU5A 2EPMX 4AL0A 3N24A 4JW1A 3ABKC 2EPKX 2J46A 3LNRA 3HNJA 1Q0KA 2R7RA 4DBQA 5DLJA 5L0CA 3IQ5A 4IGGA 2W4BA 3EZHA 4U5HA 2Y3DA 1ZHTA 1TWCA 1S7ZA 3RYLA 3K1HA 3FHDA 1RJ9B 4E0IA 4OD5A 1VYIA 2JD3A 4R32A 3ATPA 2EILC 4JYLA 3RKOF 3MOYA 2OG2A 2Q9CA 3EH1A 3NG1A 5E3AA 3ADBA 2CCYA 256BA 4PJNA 3K66A 2HSBA 1V54C 1ZVZA 2ZPAA 3DZAA 4CJGA 1D0XA 4QI0A 3S28A 4EHPA 3V5YA 2E87A 4PACA 3POVA 2A0BA 5L0GA 1TWHA 1O5HA 2HJMA 4O79A 3V5XA 3WAQA 4BJ6C 3EPVA 3S84A 3CZ6A 4Z9IA 4CS8C 2KGOA 3RQEA 3K33A 1BR1A 4B6IA 2YL7A 1SZIA 5L0JA 2H7OA 3R9SA 2WVQA 3S29A 2ZQQA 2PF4E 2XRHA 3C8ZA 3TOLA 2LCHA 2R7TA 1H9TA 2L7AA 1U89A 2QTVA 2CGEA 3RQGA 3QVYA 3LUTB 3EHMA 1MJ3A 4MW8A 1QKRA 3UR3C 3VRCA 2PX0A 1OR3A 3Q0JA 4AE4A 1B68A 3ZQVA 3GODA 2LP4A 4HE8D 3CEXA 4F47A 3RQFA 3FOPA 4ZLDA 2OQMA 1ORJA 5FCLA 4U5DE 1QVXA 5KYXB 3TJ5A 1OCOC 1RKCA 2HV7A 4IB4A 1T01A 3H81A 2VC9A 5A6AA 4NC3A 1T6UA 4FZWC 2EPOA 4K1OA 2KC3A 3J06A 3U8PA 3AG1C 1H9GA 4A2NB 1TQGA 4JJFA 2P7VA 4KNVA 3VM6A 1Q0FA 2J7PD 2J9VA 1SR2A 3GM1A 3W8HA 2J9BA 3TULA 3FVYA 5F28E 1LI7A 4O6MA 3Q0GA 2HMQA 4YT5A 1DOVA 2LFFA 4DRHB 5JT4A 1OKKA 4YK5A 4EKWA 1E84A 3FAJA 3H02A 1C03A 4K3WA 4DRIB 2QLAA 2Y69C 3W2WA 3NKEA 3LNMB 4PFPA 2WB7A 3GORA 3KH2A 3TLFA 3QXZA 1IW7F 1NZYA 2KYHA 4G78A 3ZTZA 5A6KA 3BRJA 1FMWA 1U6HA 3SXYA 4CS7A 2HUJA 2XSEA 3HLZA 3AG4C 4CBEA 3DI5A 4JVSA 1YYJA 3MBGA 3DWWA 4MVOA 4EWCA 2ZQRA 4YL1A 3CAXA 3H2VA 3JYYA 3B9QA 5DQTA 1RJNA 4CDAA 2YLGA 1ZHYA 4O6NA 4MQ9F 3LLKA 1CPRA 3VF0A 2IXOA 4LDQA 4OIRF 2AVKA 2XM4A 3RSIA 2YWAA 3K1IC 1EY3A 2XL6A 4P6IC 3JCUQ 4Z9HA 1HMOA 2NUPA 2Y3GA 2R05A 2OJQA 5A69A 3JT1A 4JFCA 5K0IA 4KI2A 3LS1A 2Y3HA 4XTKA 3QZCA 3OC7A 1F1MA 3W2VA 4YL0A 1Q52A 3OEOA 4I3MA 1N1CA 3M4BA 5JS5A 2F6QA 4ELWA 2BL2A 4ULVA 3Q7GA 1SMYF 3V5ZA 4IAQA 5A6JA 2D4UA 1J8MF 4U5FE 5T3TA 1C17M 3O4XE 5F5FA 3SXKA 3DD7A 3T9OA 4CS9C 2Y3BA 1CGME 1H6GA 4RDAA 3GWLA 5HSWA 1CPQA 4AE4B 2V3CC 4AK9A 1EI7A 1HE9A 1LM3B 1E86A 3NMJA 3NRHA 1VB5A 2GDCA 2IOQA 5KYWA 4H54A 2DYSC 4GYTA 3LEOA 4O7GA 1RJMA 4CIPA 3JYHA 2JPUA 2IXMA 2XLOA 1YLMA 4J7TA 1O3UA 3GEHA 3N0TA 2EJ5A 4E18A 3B0PA 3ASNC 2YL0A 4PJLA 4IJJA 1EF9A 4FAPB 2R7XA 1EA8A 2V26A 1A7DA 4PJJA 3MYFA 1M56C 3W8HB 1HY5A 4JKVA 2R7SA 4MTOA 2J45A 2C04A 2XLWA 3T4RA 2DGJA 1VLSA 3RIPA 3SP1A 1ZZPA 4EBKA 1I5NA 3UGOA 4K2NA 2MYSA 3O10A 1FNTc 1ST6A 2M4EA 2QNLA 4JURI 4MVQA 4Z9JA 2G3KA 2XM0A 1WOLA 1D1CA 1VMAA 3I5QA 1JR8A 2YHSA 5TJ5E 5JBWA 2TMVP 2XLHA 3X1OA 1NZYB 4QI2A 1VTMP 1ZW2A 4BEMJ 4I4ZA 4GQHA 3M79A 3U3BA 1YZAA 4FWVA 1J8YF 1D1BA 1QPUA 4RD9A 1E83A 5AC5A 4LLCA 3A11A 1Y6DA 2IM8A 2UUIA 4A4AA 1TFKB 4JC7A 3M4CA 5JSLA 1Y4CA 4EBJA 1SYQA 3VAYA 3EGDA 3FDUA 5AC4A 1C02A 3MYIA 3SZRA 5T3WA 4I1OB 1M2VA 1WN0A 2HKVA 2Q7RA 4IZDA 2L6FA 3K7DA 4KBLA 3B29A 2NUPB 2QUPA 1Q51A 3IHUA 2R25A 2Y39A 1OW6A 2HSQA 2R7QA 1MMAA 3IRBA 4ELSA 4F4BA 3T88A 1JPJA 5T1DB 1WASA 5L3QA 2JX0A 3JSEO 4IZBA 3AQCA 2J0WA 4N6HA 4U9DA 4MVRA 2Q3TA 3U8VA 4CSAA 3MLGA 3C8GA 2PPYA 4YT4A 5EK0A 1YVIA 3RVZA 3DE8A 3LLIA 3E9VA 1EQ1A 1T9KA 2KNHA 3T6BA 1LS4A 5DS4A 3W8IA 3Q6NA 3AG3C 1BZ4A 3DJNB 3B0VC 1M2OA 1TWAA 5F5HA 1K05A 5KYNA 1BBHA 4EMLA 1G5ZA 4CS8A 2AWYA 5DQZA 3ZTMA 4JIOA 3ZIBA 4UDVA 2J9UA 2L81A 5KYWB 3C8GD 5E33A 1D0YA 1RMVA 3FDQA 3UMIA 3I5PA 1E2XA 3ZWIA 4MNDA 4MOUA 4YL3A 4CX9A 1QQ3A 3AQBA 2AWCA 3AGUA 4HEAJ 2WZFA 1NZEA 4XPWA 4XLPF 2I8BA 1JMWA 5DS5A 3TD7A 1M57C 3C7JA 4J7YA 3PCVA 3HJCA 3IQ6A 4N4WA 2CW0F 2EINC 3HNLA 4JWVA 4WABA 4OIQF 2J0XA 3TRRA 3O39A 3JRMO 1OCZC 3LJBA 4LDKA 3U5SA 2WVOA 3KYJA 5COGA 1I4YA 4C3BA 1Q0GA 1A0BA 5L0FA 2P1AA 4I1MA 3TQOA 4BJ5A 3LS0A 3NDBB 2LD6A 1UFBA 3DAFA 4XEVA 1MMDA 4P9TA 3ABMC 5COMA 1DUBA 4IARA 1YA7O 2A0UA 3QXIA 1TWGA 2QY9A 1KU2A 2XLMA 4ZLCA 3HKKA 4XQ1A 1QZXA 1FFTC 1YAUO 1T5OA 3DM5A 4E7SA 4U5GA 4CIHA 3ABLC 2BE5F 4FJWD 1KNYA 4CJOA 2I15A 1ZHXA 3ADCA 3EGDB 3B0UX 3EGXA 3Q1TA 4ANJA 3KMIA 5JUAA 3Q7LA 1LPEA 1AEPA 3DXJF 2HV6A 1MNEA 2HS5A 1OW7A 4NTFA 2VCCA 1M2VB 5BQGA 4NTBA 1ZYRF 3ZQYA 1GQAA 2HZ8A 3WHNA 2P63A 1G8XA 4GEHA 4XEKA 2CNWA 2EIJC 4JTAB 5L0HA 3QTHA 3K6BA 3U2LA 3UMKA 3US6A 2KJGA 4C7OA 1OKKD 1CGOA 2YRFA 3AOUA 2QE9A 4BEJA 3HNKA 4G0HA 2OEVA 4QDLA 5A6BA 2G62A 1KTMA 3T6JA 4D4NA 3TK0A 2CNWD 3C8GB 2IEXA 1ORSC 2WZLA 3EFOA 4MVSA 1HW2A 4DRJB 1ZU4A 2IXNA 5EGYA 3JRTA 3VYWA 2FBMA 4J32B 3ZSUA 4XEFA 3W8IB 2Q9AA 2NSGA 2A6HF 4QIJA 2LK4A 3E70C 1UX5A 2X0CA 4DBRA 4I52A 5A6BD 1I4ZA
chains in the Genus database with same CATH topology
1V4AA 2L6FA 3K7DA 3ADCA 3U3FA 4NQFA 1WWPA 3AJMA 3GM2A 1ZZPA 3GM3A 3JZ0A 1WTYA 2PBEA 4EBKA 1OW6A 3O4XE 3IRBA 4R32A 1Y64B 3RQFA 3C18A 3O10A 3BRJA 1OW7A 3ADDA 3S9OA 3ADBA 3L8IA 2JX0A 1QVXA 1WOLA 2P63A 1JOGA 2HSBA 3A4NA 4XEKA 4NNQA 3A4MA 1UX4A 3C8GA 3JYYA 1K40A 3U0CA 2Q00A 2L6GA 1RJMA 1UFBA 4XEVA 4GEHB 3B71A 3RQEA 2JPUA 1KTMA 1K05A 3MFNA 1OW8A 3GM1A 1O3UA 3C8GB 3TULA 2L6HA 3AM1A 2YWAA 4EBJA 3C8GD 5F28E 3A4LA 1K04A 3W8IB 4XEFA 2KK1A 3L8JA 2LK4A 3RQGA 1UX5A 1KNYA 1PV3A 3W8HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G D;  1V4A A;  2Q00 A;  5F28 E;  2L6F A;  3K7D A;  3S9O A;  3U3F A;  4NQF A;  3L8I A;  2JX0 A;  1QVX A;  2L6G A;  1WOL A;  1WWP A;  2YWA A;  1K04 A;  1UFB A;  3W8I B;  4XEF A;  1JOG A;  2HSB A;  4XEK A;  3AJM A;  3GM2 A;  4XEV A;  4GEH B;  1ZZP A;  3B71 A;  1WTY A;  2PBE A;  3GM3 A;  3JZ0 A;  4EBJ A;  3RQE A;  2JPU A;  1OW6 A;  1KTM A;  1K05 A;  2KK1 A;  3C8G A;  3MFN A;  3L8J A;  1OW8 A;  2LK4 A;  3JYY A;  3RQG A;  1O3U A;  3GM1 A;  4R32 A;  3C8G B;  3RQF A;  3C18 A;  1KNY A;  3O10 A;  1K40 A;  1PV3 A;  1OW7 A;  2L6H A;  3BRJ A;  3TUL A;  3U0C A;  4EBK A;  3W8H B; 
#chains in the Genus database with same CATH topology
 1CGN A;  4N06 A;  2PNO A;  5BUO A;  2LQG A;  2Z15 A;  3SNH A;  2R9R B;  2W9Y A;  2QQ3 A;  3AJM A;  2YEV A;  3A9C A;  2PP4 A;  3AGT A;  3H2U A;  4WGZ A;  3L34 A;  1PD0 A;  2ZXP A;  3T8A A;  3R7C A;  3L8I A;  1MMN A;  3GAN A;  2FW2 A;  2KQ9 A;  2ICW G;  1UX4 A;  3NKD A;  4U19 A;  2NSF A;  4Q7C A;  2A69 F;  3L0I A;  1JXZ A;  1VLT A;  1M6T A;  1A7E A;  1JRA A;  4EIY A;  3G64 A;  4AX2 A;  1AUE A;  1ORY A;  2YL3 A;  1YJG A;  4J30 B;  3EHN A;  3FOO A;  1TKN A;  1MND A;  4G7O F;  1OW8 A;  1TR2 A;  4PJM A;  5KYY A;  1JPN A;  2PX3 A;  2ASR A;  1OR2 A;  3MYB A;  5JRA A;  4KNW A;  2XS1 A;  4ONS A;  3F46 A;  2VCA A;  1NFN A;  1PV3 A;  2A68 F;  4ZU2 A;  4X0R A;  5D91 A;  3U3F A;  1DCI A;  3ZG1 A;  1WWP A;  1GM5 A;  1LE4 A;  4OLQ A;  4OG1 A;  3GM2 A;  4LAC B;  3G4Z A;  1YDI A;  3V7O A;  4DVZ A;  4K0D A;  2PBP A;  4LLE A;  3H65 A;  4OD4 A;  3OWT A;  4JZA A;  5JBX A;  5COF A;  3A4M A;  3AG2 C;  3EGX B;  2DUB A;  4MW3 A;  3QW1 A;  2YZS A;  3IEE A;  4WJ0 A;  2LFD A;  1EF8 A;  2GFH A;  4IWB A;  4KNP A;  2XL8 A;  3EJN A;  2L6G A;  1FR0 A;  3RW0 A;  4YT2 A;  4U9E A;  5E2Q A;  3Q6M A;  4GEH B;  2FFH A;  4YJW A;  3GEE A;  2RSE B;  1RCP A;  4U1A A;  3RF3 A;  1PD1 A;  2R7U A;  4C7O B;  2DB4 A;  1NSG B;  2X51 A;  1GGQ A;  4BJ1 A;  3A4L A;  1MQV A;  5GPG B;  3IQC A;  2YVK A;  1LVK A;  4JCH A;  3NYL A;  1DOW A;  2H7V C;  2HFI A;  4JOT A;  5C9G A;  2Q9B A;  2IXP A;  3EFO B;  2FAP B;  1A41 A;  1G4U S;  2ZXR A;  3PHF 2;  2PBE A;  3IQT A;  2MWQ A;  4RBN A;  4IAO A;  2PFD A;  2VCB A;  5B1A C;  3M1C B;  3PDM P;  3PMR A;  4I42 A;  3SLL A;  4JTC B;  2YQY A;  3S9O A;  1SF8 A;  2O9X A;  2R03 A;  3QMK A;  4O6Y A;  4EUK B;  4K7B A;  2MHR A;  3M15 A;  2XXA A;  1L7C A;  3C62 A;  1NG1 A;  2A1D D;  3QW0 A;  2ZXW C;  3G4X A;  1Z6A A;  2NUT A;  5B1B C;  3R9T A;  2VAS A;  2DI3 A;  3S0X A;  3B71 A;  4P9F A;  2OCC C;  4NTA A;  2P0N A;  2XS8 A;  5JVE A;  1Q0M A;  4QII A;  1LS1 A;  2RD9 A;  3WOD F;  3IPM O;  3KL4 A;  1LE2 A;  3DJU B;  2EIM C;  4JCZ A;  5CI9 A;  4FX5 A;  2AU5 A;  5B3I A;  4E7Z A;  4LDR A;  2VRE A;  4BJ6 A;  3L8J A;  3DAG A;  1NU9 C;  2L9J A;  4G7Z F;  3NYM A;  4MVZ A;  5KYY B;  1Z63 A;  4JRZ A;  2ZD9 A;  4NQF A;  4CSA C;  2UUH A;  5AGF A;  1XWJ A;  4ELX A;  3O6X A;  2HW5 A;  1ZHZ A;  4XLN F;  5EHH A;  1RKE A;  1BR2 A;  4CDY A;  4MVU A;  3RFY A;  3JSZ A;  3CSK A;  2R7O A;  3ITF A;  1HZD A;  2A6E F;  1XZP A;  1WAT A;  3UGP A;  1A7V A;  2IYL D;  1GS9 A;  3U0C A;  3UNG C;  4G7H F;  2VH3 A;  1HW1 A;  1UG7 A;  5KJP A;  3G50 A;  5KYU A;  4BPM A;  2HMZ A;  1OCC C;  3KYI A;  5L3V A;  3F47 A;  4NY3 A;  2KSF A;  1UIY A;  2EPN A;  1OCR C;  1D0Z A;  2GAQ A;  2F22 A;  1YA9 A;  4FZW A;  4Q5S F;  3C63 A;  3TJ6 A;  3HTK C;  4I44 A;  1AVO B;  4LER A;  2BC5 A;  4IRU A;  3R0O A;  2J7P A;  1WZ8 A;  1BR4 A;  1OXK A;  3FXH A;  1Z7Q c;  1NU7 D;  1YZC A;  3ECS A;  4C3D A;  3ZDL A;  4H4K C;  3GM3 A;  1WTY A;  1EKY A;  1APC A;  4BJ5 C;  3MX3 A;  2YLD A;  4L6R A;  1NFO A;  2AP3 A;  4MTF A;  3BEH A;  5L0D A;  1ZW3 A;  2OJE D;  1VOM A;  4HFK B;  2J8W A;  1QLE C;  4JCS A;  1E85 A;  2LIG A;  1FFH A;  2YL1 A;  4HFF B;  3WG7 C;  2NG1 A;  4JTD B;  2OKU A;  3N2Z B;  2C03 A;  1W2W A;  3FAP B;  3NMI A;  3ASO C;  3RH3 A;  3HNI A;  2XXA B;  1QSP A;  3DE9 A;  2Q4F A;  2EPL X;  1MMG A;  4XPY A;  3QK8 A;  4C3E A;  2KW3 C;  4XWJ A;  3DMD A;  2NUT B;  3EG9 A;  1FTS A;  1K04 A;  2VB6 A;  3CQZ A;  4IZC A;  2NPU A;  2VX2 A;  4U18 A;  3SYN A;  4W8P A;  3SXM A;  3U2M A;  2OEX A;  1OQC A;  2UZF A;  2D5R B;  3LES A;  2XLV A;  3KKB A;  3KPH A;  3NYJ A;  5D92 A;  2ETS A;  1V55 C;  2GWW A;  5E3C A;  3K1I A;  2R7W A;  4ER9 A;  3JZ0 A;  3I4U A;  4XPX A;  5FZT A;  2W4M A;  2XL4 A;  3U9J A;  3QVZ A;  1R4T A;  2XLE A;  1Y64 B;  1LKX A;  4OIP F;  3W4Y A;  5L0I A;  1XZQ A;  4DOZ A;  2P6V A;  3EQL F;  4BJT A;  2OOC A;  2ZXO A;  1H7I A;  4DJ9 A;  1JOG A;  3A4N A;  4NNQ A;  2YKZ A;  4MVM A;  1Z3I X;  4E17 A;  4U5B E;  4WGY A;  1Z5Z A;  2FGY A;  1RKE B;  1TFO B;  1L3P A;  4BG0 A;  3DKA A;  3P5M A;  4CS9 A;  1T6I A;  4MI2 A;  2WL8 A;  4OIN F;  3RVY A;  2OU6 A;  3GEI A;  3MFN A;  4EBB A;  5DS6 A;  4KC9 A;  5IY5 C;  3GWN A;  1S05 A;  5CIV A;  4NEK A;  3ZVR A;  1RJ9 A;  5BQH A;  2KK1 A;  3O55 A;  3HRX A;  3SWX A;  2B0J A;  4D4X A;  5KYU B;  4NCQ A;  2J9W A;  4MS2 A;  1V4A A;  5DVW A;  4DVY P;  1FAP B;  3HIN A;  2CDQ A;  3PZK A;  4M63 A;  4PK4 A;  4WCZ A;  1U0B B;  4JE9 A;  2G3V A;  4U5E E;  3R2P A;  3S90 A;  2W45 A;  3ADD A;  3JTL O;  1HMD A;  2DYR C;  4ULW A;  5B3S C;  2XLD A;  2WZG A;  4YT8 A;  4YWQ A;  4MTG A;  4CDV A;  4W8K A;  2H8A A;  1IZM A;  4JEA A;  2WVN A;  2Q00 A;  2HJ3 A;  2P61 A;  3L1M A;  3EH2 A;  3NMK A;  4JEB A;  3EZI A;  1BDJ B;  1WGW A;  1D1A A;  2IBF A;  2R02 A;  4YN0 B;  2L6H A;  1VYK A;  5CI8 A;  3TOM A;  1HE1 A;  3I47 A;  4JJG A;  2EIK C;  2M64 A;  4Q4Z F;  2GA0 A;  1G4W R;  1R5I D;  1JAF A;  1NLX A;  5HV9 A;  1ZHW A;  2H7B A;  1T6Q A;  1YYX A;  2B0H A;  5KYX A;  3OA1 A;  3EG9 B;  4U5C E;  2LSE A;  1NBB A;  3DM9 B;  1Q0D A;  1OXB A;  1LI5 A;  3C18 A;  5BQI A;  3FMS A;  1YAR O;  3T89 A;  4FES A;  3LAY A;  4DXW A;  3U9M A;  3UMH A;  4N6C A;  5JLI A;  1VK5 A;  3SEO A;  1O87 A;  5JP7 A;  2YLI A;  1V74 B;  1LIH A;  1K40 A;  4PR9 A;  3T6G B;  4OIO F;  1PCX A;  2R7V A;  3S27 A;  3LEV A;  1RXQ A;  3KQF A;  2GTR A;  4E0H A;  3ZC4 A;  3X2Q C;  1Z23 A;  4PFO A;  3SXZ A;  4AL1 A;  2CYD A;  3AM1 A;  1FMV A;  1ZU5 A;  2EPM X;  4AL0 A;  3N24 A;  4JW1 A;  3ABK C;  2EPK X;  2J46 A;  3LNR A;  3HNJ A;  1Q0K A;  2R7R A;  4DBQ A;  5DLJ A;  5L0C A;  3IQ5 A;  4IGG A;  2W4B A;  3EZH A;  4U5H A;  2Y3D A;  1ZHT A;  1TWC A;  1S7Z A;  3RYL A;  3K1H A;  3FHD A;  1RJ9 B;  4E0I A;  4OD5 A;  1VYI A;  2JD3 A;  4R32 A;  3ATP A;  2EIL C;  4JYL A;  3RKO F;  3MOY A;  2OG2 A;  2Q9C A;  3EH1 A;  3NG1 A;  5E3A A;  3ADB A;  2CCY A;  256B A;  4PJN A;  3K66 A;  2HSB A;  1V54 C;  1ZVZ A;  2ZPA A;  3DZA A;  4CJG A;  1D0X A;  4QI0 A;  3S28 A;  4EHP A;  3V5Y A;  2E87 A;  4PAC A;  3POV A;  2A0B A;  5L0G A;  1TWH A;  1O5H A;  2HJM A;  4O79 A;  3V5X A;  3WAQ A;  4BJ6 C;  3EPV A;  3S84 A;  3CZ6 A;  4Z9I A;  4CS8 C;  2KGO A;  3RQE A;  3K33 A;  1BR1 A;  4B6I A;  2YL7 A;  1SZI A;  5L0J A;  2H7O A;  3R9S A;  2WVQ A;  3S29 A;  2ZQQ A;  2PF4 E;  2XRH A;  3C8Z A;  3TOL A;  2LCH A;  2R7T A;  1H9T A;  2L7A A;  1U89 A;  2QTV A;  2CGE A;  3RQG A;  3QVY A;  3LUT B;  3EHM A;  1MJ3 A;  4MW8 A;  1QKR A;  3UR3 C;  3VRC A;  2PX0 A;  1OR3 A;  3Q0J A;  4AE4 A;  1B68 A;  3ZQV A;  3GOD A;  2LP4 A;  4HE8 D;  3CEX A;  4F47 A;  3RQF A;  3FOP A;  4ZLD A;  2OQM A;  1ORJ A;  5FCL A;  4U5D E;  1QVX A;  5KYX B;  3TJ5 A;  1OCO C;  1RKC A;  2HV7 A;  4IB4 A;  1T01 A;  3H81 A;  2VC9 A;  5A6A A;  4NC3 A;  1T6U A;  4FZW C;  2EPO A;  4K1O A;  2KC3 A;  3J06 A;  3U8P A;  3AG1 C;  1H9G A;  4A2N B;  1TQG A;  4JJF A;  2P7V A;  4KNV A;  3VM6 A;  1Q0F A;  2J7P D;  2J9V A;  1SR2 A;  3GM1 A;  3W8H A;  2J9B A;  3TUL A;  3FVY A;  5F28 E;  1LI7 A;  4O6M A;  3Q0G A;  2HMQ A;  4YT5 A;  1DOV A;  2LFF A;  4DRH B;  5JT4 A;  1OKK A;  4YK5 A;  4EKW A;  1E84 A;  3FAJ A;  3H02 A;  1C03 A;  4K3W A;  4DRI B;  2QLA A;  2Y69 C;  3W2W A;  3NKE A;  3LNM B;  4PFP A;  2WB7 A;  3GOR A;  3KH2 A;  3TLF A;  3QXZ A;  1IW7 F;  1NZY A;  2KYH A;  4G78 A;  3ZTZ A;  5A6K A;  3BRJ A;  1FMW A;  1U6H A;  3SXY A;  4CS7 A;  2HUJ A;  2XSE A;  3HLZ A;  3AG4 C;  4CBE A;  3DI5 A;  4JVS A;  1YYJ A;  3MBG A;  3DWW A;  4MVO A;  4EWC A;  2ZQR A;  4YL1 A;  3CAX A;  3H2V A;  3JYY A;  3B9Q A;  5DQT A;  1RJN A;  4CDA A;  2YLG A;  1ZHY A;  4O6N A;  4MQ9 F;  3LLK A;  1CPR A;  3VF0 A;  2IXO A;  4LDQ A;  4OIR F;  2AVK A;  2XM4 A;  3RSI A;  2YWA A;  3K1I C;  1EY3 A;  2XL6 A;  4P6I C;  3JCU Q;  4Z9H A;  1HMO A;  2NUP A;  2Y3G A;  2R05 A;  2OJQ A;  5A69 A;  3JT1 A;  4JFC A;  5K0I A;  4KI2 A;  3LS1 A;  2Y3H A;  4XTK A;  3QZC A;  3OC7 A;  1F1M A;  3W2V A;  4YL0 A;  1Q52 A;  3OEO A;  4I3M A;  1N1C A;  3M4B A;  5JS5 A;  2F6Q A;  4ELW A;  2BL2 A;  4ULV A;  3Q7G A;  1SMY F;  3V5Z A;  4IAQ A;  5A6J A;  2D4U A;  1J8M F;  4U5F E;  5T3T A;  1C17 M;  3O4X E;  5F5F A;  3SXK A;  3DD7 A;  3T9O A;  4CS9 C;  2Y3B A;  1CGM E;  1H6G A;  4RDA A;  3GWL A;  5HSW A;  1CPQ A;  4AE4 B;  2V3C C;  4AK9 A;  1EI7 A;  1HE9 A;  1LM3 B;  1E86 A;  3NMJ A;  3NRH A;  1VB5 A;  2GDC A;  2IOQ A;  5KYW A;  4H54 A;  2DYS C;  4GYT A;  3LEO A;  4O7G A;  1RJM A;  4CIP A;  3JYH A;  2JPU A;  2IXM A;  2XLO A;  1YLM A;  4J7T A;  1O3U A;  3GEH A;  3N0T A;  2EJ5 A;  4E18 A;  3B0P A;  3ASN C;  2YL0 A;  4PJL A;  4IJJ A;  1EF9 A;  4FAP B;  2R7X A;  1EA8 A;  2V26 A;  1A7D A;  4PJJ A;  3MYF A;  1M56 C;  3W8H B;  1HY5 A;  4JKV A;  2R7S A;  4MTO A;  2J45 A;  2C04 A;  2XLW A;  3T4R A;  2DGJ A;  1VLS A;  3RIP A;  3SP1 A;  1ZZP A;  4EBK A;  1I5N A;  3UGO A;  4K2N A;  2MYS A;  3O10 A;  1FNT c;  1ST6 A;  2M4E A;  2QNL A;  4JUR I;  4MVQ A;  4Z9J A;  2G3K A;  2XM0 A;  1WOL A;  1D1C A;  1VMA A;  3I5Q A;  1JR8 A;  2YHS A;  5TJ5 E;  5JBW A;  2TMV P;  2XLH A;  3X1O A;  1NZY B;  4QI2 A;  1VTM P;  1ZW2 A;  4BEM J;  4I4Z A;  4GQH A;  3M79 A;  3U3B A;  1YZA A;  4FWV A;  1J8Y F;  1D1B A;  1QPU A;  4RD9 A;  1E83 A;  5AC5 A;  4LLC A;  3A11 A;  1Y6D A;  2IM8 A;  2UUI A;  4A4A A;  1TFK B;  4JC7 A;  3M4C A;  5JSL A;  1Y4C A;  4EBJ A;  1SYQ A;  3VAY A;  3EGD A;  3FDU A;  5AC4 A;  1C02 A;  3MYI A;  3SZR A;  5T3W A;  4I1O B;  1M2V A;  1WN0 A;  2HKV A;  2Q7R A;  4IZD A;  2L6F A;  3K7D A;  4KBL A;  3B29 A;  2NUP B;  2QUP A;  1Q51 A;  3IHU A;  2R25 A;  2Y39 A;  1OW6 A;  2HSQ A;  2R7Q A;  1MMA A;  3IRB A;  4ELS A;  4F4B A;  3T88 A;  1JPJ A;  5T1D B;  1WAS A;  5L3Q A;  2JX0 A;  3JSE O;  4IZB A;  3AQC A;  2J0W A;  4N6H A;  4U9D A;  4MVR A;  2Q3T A;  3U8V A;  4CSA A;  3MLG A;  3C8G A;  2PPY A;  4YT4 A;  5EK0 A;  1YVI A;  3RVZ A;  3DE8 A;  3LLI A;  3E9V A;  1EQ1 A;  1T9K A;  2KNH A;  3T6B A;  1LS4 A;  5DS4 A;  3W8I A;  3Q6N A;  3AG3 C;  1BZ4 A;  3DJN B;  3B0V C;  1M2O A;  1TWA A;  5F5H A;  1K05 A;  5KYN A;  1BBH A;  4EML A;  1G5Z A;  4CS8 A;  2AWY A;  5DQZ A;  3ZTM A;  4JIO A;  3ZIB A;  4UDV A;  2J9U A;  2L81 A;  5KYW B;  3C8G D;  5E33 A;  1D0Y A;  1RMV A;  3FDQ A;  3UMI A;  3I5P A;  1E2X A;  3ZWI A;  4MND A;  4MOU A;  4YL3 A;  4CX9 A;  1QQ3 A;  3AQB A;  2AWC A;  3AGU A;  4HEA J;  2WZF A;  1NZE A;  4XPW A;  4XLP F;  2I8B A;  1JMW A;  5DS5 A;  3TD7 A;  1M57 C;  3C7J A;  4J7Y A;  3PCV A;  3HJC A;  3IQ6 A;  4N4W A;  2CW0 F;  2EIN C;  3HNL A;  4JWV A;  4WAB A;  4OIQ F;  2J0X A;  3TRR A;  3O39 A;  3JRM O;  1OCZ C;  3LJB A;  4LDK A;  3U5S A;  2WVO A;  3KYJ A;  5COG A;  1I4Y A;  4C3B A;  1Q0G A;  1A0B A;  5L0F A;  2P1A A;  4I1M A;  3TQO A;  4BJ5 A;  3LS0 A;  3NDB B;  2LD6 A;  1UFB A;  3DAF A;  4XEV A;  1MMD A;  4P9T A;  3ABM C;  5COM A;  1DUB A;  4IAR A;  1YA7 O;  2A0U A;  3QXI A;  1TWG A;  2QY9 A;  1KU2 A;  2XLM A;  4ZLC A;  3HKK A;  4XQ1 A;  1QZX A;  1FFT C;  1YAU O;  1T5O A;  3DM5 A;  4E7S A;  4U5G A;  4CIH A;  3ABL C;  2BE5 F;  4FJW D;  1KNY A;  4CJO A;  2I15 A;  1ZHX A;  3ADC A;  3EGD B;  3B0U X;  3EGX A;  3Q1T A;  4ANJ A;  3KMI A;  5JUA A;  3Q7L A;  1LPE A;  1AEP A;  3DXJ F;  2HV6 A;  1MNE A;  2HS5 A;  1OW7 A;  4NTF A;  2VCC A;  1M2V B;  5BQG A;  4NTB A;  1ZYR F;  3ZQY A;  1GQA A;  2HZ8 A;  3WHN A;  2P63 A;  1G8X A;  4GEH A;  4XEK A;  2CNW A;  2EIJ C;  4JTA B;  5L0H A;  3QTH A;  3K6B A;  3U2L A;  3UMK A;  3US6 A;  2KJG A;  4C7O A;  1OKK D;  1CGO A;  2YRF A;  3AOU A;  2QE9 A;  4BEJ A;  3HNK A;  4G0H A;  2OEV A;  4QDL A;  5A6B A;  2G62 A;  1KTM A;  3T6J A;  4D4N A;  3TK0 A;  2CNW D;  3C8G B;  2IEX A;  1ORS C;  2WZL A;  3EFO A;  4MVS A;  1HW2 A;  4DRJ B;  1ZU4 A;  2IXN A;  5EGY A;  3JRT A;  3VYW A;  2FBM A;  4J32 B;  3ZSU A;  4XEF A;  3W8I B;  2Q9A A;  2NSG A;  2A6H F;  4QIJ A;  2LK4 A;  3E70 C;  1UX5 A;  2X0C A;  4DBR A;  4I52 A;  5A6B D;  1I4Z A; 
#chains in the Genus database with same CATH homology
 1V4A A;  2L6F A;  3K7D A;  3ADC A;  3U3F A;  4NQF A;  1WWP A;  3AJM A;  3GM2 A;  1ZZP A;  3GM3 A;  3JZ0 A;  1WTY A;  2PBE A;  4EBK A;  1OW6 A;  3O4X E;  3IRB A;  4R32 A;  1Y64 B;  3RQF A;  3C18 A;  3O10 A;  3BRJ A;  1OW7 A;  3ADD A;  3S9O A;  3ADB A;  3L8I A;  2JX0 A;  1QVX A;  1WOL A;  2P63 A;  1JOG A;  2HSB A;  3A4N A;  4XEK A;  4NNQ A;  3A4M A;  1UX4 A;  3C8G A;  3JYY A;  1K40 A;  3U0C A;  2Q00 A;  2L6G A;  1RJM A;  1UFB A;  4XEV A;  4GEH B;  3B71 A;  3RQE A;  2JPU A;  1KTM A;  1K05 A;  3MFN A;  1OW8 A;  3GM1 A;  1O3U A;  3C8G B;  3TUL A;  2L6H A;  3AM1 A;  2YWA A;  4EBJ A;  3C8G D;  5F28 E;  3A4L A;  1K04 A;  3W8I B;  4XEF A;  2KK1 A;  3L8J A;  2LK4 A;  3RQG A;  1UX5 A;  1KNY A;  1PV3 A;  3W8H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...