2P63A

Suprafacial orientation of the scfcdc4 dimer accommodates multiple geometries for substrate ubiquitination
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
52
structure length
52
Chain Sequence
GSPEYLSDEIFSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Cell division control protein 4
total genus 17
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16856 CDC4_D Cell division control protein 4 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.50 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 2p63A01
2P63A
chains in the Genus database with same CATH superfamily
3W8IB 4OLQA 1NZYA 4FZWA 3T89A 3TLFA 1EF9A 4MI2A 4U19A 3R0OA 5KJPA 4U18A 4IZBA 2PBPA 3I47A 3H81A 4K3WA 4NEKA 3Q1TA 3ADDA 1HZDA 3ADCA 3ADBA 3IRBA 3KQFA 3P5MA 5C9GA 4I42A 3RQGA 2VX2A 2HW5A 4NNQA 3AJMA 4F47A 1DCIA 1NZYB 1RJNA 2QQ3A 3G64A 2ZQRA 3RSIA 3RQFA 3OC7A 3A4NA 3MYBA 1UX5A 4WCZA 2F6QA 5JBWA 3O4XE 2UZFA 4GEHB 4IZCA 4I4ZA 3MOYA 3RQEA 4JFCA 2FBMA 3SWXA 4I52A 3T88A 2GTRA 1Y64B 1JXZA 4JWVA 3AM1A 2EJ5A 3H02A 4ELSA 4U1AA 3HRXA 4FJWD 3PZKA 1UIYA 3R9TA 3W8HB 1WZ8A 4QIIA 2IEXA 3R9SA 3Q0GA 2FW2A 3TRRA 4QIJA 2PPYA 1DUBA 4MOUA 3HINA 2VREA 3L8IA 3QXZA 3L8JA 1EY3A 4JYLA 3A4MA 4ELXA 4JCSA 4ELWA 3A4LA 4FZWC 4KNPA 3Q0JA 2DUBA 5JBXA 2P63A 3QK8A 1MJ3A 3FDUA 1UX4A 4ZU2A 1Q51A 1RJMA 4IZDA 3SLLA 2ZQQA 3T8AA 4JOTA 1EF8A 4K2NA 1Q52A 4OG1A 3QXIA 4EMLA
chains in the Genus database with same CATH topology
3RQFA 3W8IB 3L8JA 3A4NA 3A4MA 1UX5A 3O4XE 3A4LA 4GEHB 3W8HB 2P63A 3RQEA 3ADDA 3ADCA 1UX4A 3ADBA 1RJMA 3IRBA 3RQGA 1Y64B 4NNQA 3AJMA 3AM1A 3L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P63 A; 
#chains in the Genus database with same CATH topology
 3W8I B;  4OLQ A;  1NZY A;  4FZW A;  3T89 A;  3TLF A;  1EF9 A;  4MI2 A;  4U19 A;  3R0O A;  5KJP A;  4U18 A;  4IZB A;  2PBP A;  3I47 A;  3H81 A;  4K3W A;  4NEK A;  3Q1T A;  3ADD A;  1HZD A;  3ADC A;  3ADB A;  3IRB A;  3KQF A;  3P5M A;  5C9G A;  4I42 A;  3RQG A;  2VX2 A;  2HW5 A;  4NNQ A;  3AJM A;  4F47 A;  1DCI A;  1NZY B;  1RJN A;  2QQ3 A;  3G64 A;  2ZQR A;  3RSI A;  3RQF A;  3OC7 A;  3A4N A;  3MYB A;  1UX5 A;  4WCZ A;  2F6Q A;  5JBW A;  3O4X E;  2UZF A;  4GEH B;  4IZC A;  4I4Z A;  3MOY A;  3RQE A;  4JFC A;  2FBM A;  3SWX A;  4I52 A;  3T88 A;  2GTR A;  1Y64 B;  1JXZ A;  4JWV A;  3AM1 A;  2EJ5 A;  3H02 A;  4ELS A;  4U1A A;  3HRX A;  4FJW D;  3PZK A;  1UIY A;  3R9T A;  3W8H B;  1WZ8 A;  4QII A;  2IEX A;  3R9S A;  3Q0G A;  2FW2 A;  3TRR A;  4QIJ A;  2PPY A;  1DUB A;  4MOU A;  3HIN A;  2VRE A;  3L8I A;  3QXZ A;  3L8J A;  1EY3 A;  4JYL A;  3A4M A;  4ELX A;  4JCS A;  4ELW A;  3A4L A;  4FZW C;  4KNP A;  3Q0J A;  2DUB A;  5JBX A;  2P63 A;  3QK8 A;  1MJ3 A;  3FDU A;  1UX4 A;  4ZU2 A;  1Q51 A;  1RJM A;  4IZD A;  3SLL A;  2ZQQ A;  3T8A A;  4JOT A;  1EF8 A;  4K2N A;  1Q52 A;  4OG1 A;  3QXI A;  4EML A; 
#chains in the Genus database with same CATH homology
 3RQF A;  3W8I B;  3L8J A;  3A4N A;  3A4M A;  1UX5 A;  3O4X E;  3A4L A;  4GEH B;  3W8H B;  2P63 A;  3RQE A;  3ADD A;  3ADC A;  1UX4 A;  3ADB A;  1RJM A;  3IRB A;  3RQG A;  1Y64 B;  4NNQ A;  3AJM A;  3AM1 A;  3L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...