2P63A

Suprafacial orientation of the scfcdc4 dimer accommodates multiple geometries for substrate ubiquitination
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
52
structure length
52
Chain Sequence
b'GSPEYLSDEIFSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 4
publication title Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 17
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16856 CDC4_D Cell division control protein 4 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.50 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 2p63A01
2P63A
chains in the Genus database with same CATH superfamily
3PZKA 4FZWC 4JFCA 3L8IA 3QXZA 4K2NA 3H02A 1Q51A 1JXZA 4IZDA 4U1AA 3A4MA 4FZWA 3HINA 4MI2A 3TLFA 1RJMA 4FJWD 3MOYA 5C9GA 4I52A 2F6QA 4ELWA 1EF8A 1UIYA 3O4XE 2UZFA 3A4LA 4OLQA 1MJ3A 3OC7A 4EMLA 4JCSA 3RQGA 3HRXA 1Y64B 1DCIA 3AM1A 4WCZA 1RJNA 2QQ3A 4JOTA 4KNPA 4ZU2A 2EJ5A 1DUBA 4NEKA 1Q52A 4F47A 2P63A 2DUBA 3QXIA 1UX5A 2VREA 3Q0GA 3T8AA 3Q0JA 2IEXA 2ZQQA 3I47A 4JWVA 3SWXA 4QIIA 3Q1TA 1WZ8A 3KQFA 2HW5A 3T88A 4IZBA 1NZYB 2FW2A 4NNQA 3R9SA 3P5MA 1HZDA 3T89A 4IZCA 5JBXA 3RQFA 1EY3A 4I42A 1EF9A 3AJMA 3R0OA 2VX2A 4OG1A 3ADDA 5KJPA 3MYBA 2PBPA 3RQEA 1NZYA 3G64A 3R9TA 4U19A 4QIJA 3L8JA 4I4ZA 3QK8A 3W8IB 1UX4A 5JBWA 3A4NA 3TRRA 3H81A 2FBMA 3IRBA 3ADBA 3RSIA 3W8HB 4K3WA 4ELSA 2GTRA 4U18A 3FDUA 4GEHB 4ELXA 4JYLA 3SLLA 4MOUA 2PPYA 3ADCA 2ZQRA
chains in the Genus database with same CATH topology
3L8JA 3W8IB 1UX4A 3A4NA 3L8IA 3IRBA 3ADBA 4NNQA 3A4MA 3W8HB 2P63A 1RJMA 3RQFA 1UX5A 3AJMA 3ADDA 4GEHB 3O4XE 3A4LA 3RQEA 3RQGA 1Y64B 3AM1A 3ADCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P63 A; 
#chains in the Genus database with same CATH topology
 3PZK A;  4FZW C;  4JFC A;  3L8I A;  3QXZ A;  4K2N A;  3H02 A;  1Q51 A;  1JXZ A;  4IZD A;  4U1A A;  3A4M A;  4FZW A;  3HIN A;  4MI2 A;  3TLF A;  1RJM A;  4FJW D;  3MOY A;  5C9G A;  4I52 A;  2F6Q A;  4ELW A;  1EF8 A;  1UIY A;  3O4X E;  2UZF A;  3A4L A;  4OLQ A;  1MJ3 A;  3OC7 A;  4EML A;  4JCS A;  3RQG A;  3HRX A;  1Y64 B;  1DCI A;  3AM1 A;  4WCZ A;  1RJN A;  2QQ3 A;  4JOT A;  4KNP A;  4ZU2 A;  2EJ5 A;  1DUB A;  4NEK A;  1Q52 A;  4F47 A;  2P63 A;  2DUB A;  3QXI A;  1UX5 A;  2VRE A;  3Q0G A;  3T8A A;  3Q0J A;  2IEX A;  2ZQQ A;  3I47 A;  4JWV A;  3SWX A;  4QII A;  3Q1T A;  1WZ8 A;  3KQF A;  2HW5 A;  3T88 A;  4IZB A;  1NZY B;  2FW2 A;  4NNQ A;  3R9S A;  3P5M A;  1HZD A;  3T89 A;  4IZC A;  5JBX A;  3RQF A;  1EY3 A;  4I42 A;  1EF9 A;  3AJM A;  3R0O A;  2VX2 A;  4OG1 A;  3ADD A;  5KJP A;  3MYB A;  2PBP A;  3RQE A;  1NZY A;  3G64 A;  3R9T A;  4U19 A;  4QIJ A;  3L8J A;  4I4Z A;  3QK8 A;  3W8I B;  1UX4 A;  5JBW A;  3A4N A;  3TRR A;  3H81 A;  2FBM A;  3IRB A;  3ADB A;  3RSI A;  3W8H B;  4K3W A;  4ELS A;  2GTR A;  4U18 A;  3FDU A;  4GEH B;  4ELX A;  4JYL A;  3SLL A;  4MOU A;  2PPY A;  3ADC A;  2ZQR A; 
#chains in the Genus database with same CATH homology
 3L8J A;  3W8I B;  1UX4 A;  3A4N A;  3L8I A;  3IRB A;  3ADB A;  4NNQ A;  3A4M A;  3W8H B;  2P63 A;  1RJM A;  3RQF A;  1UX5 A;  3AJM A;  3ADD A;  4GEH B;  3O4X E;  3A4L A;  3RQE A;  3RQG A;  1Y64 B;  3AM1 A;  3ADC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...