1DCIA

Dienoyl-coa isomerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
AYESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSITFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of dienoyl-CoA isomerase at 1.5 A resolution reveals the importance of aspartate and glutamate sidechains for catalysis.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
molecule keywords DIENOYL-COA ISOMERASE
total genus 106
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1998-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1dciA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1dciA01
2VSSE 4ELXA 4I52A 4QFEA 4EMLA 2Q2XA 1K39A 4MI2A 1WDLA 3H0SA 5CTBA 1EY3A 4JCSA 3IAVA 3TT7A 3ZW9A 2IEXA 4G2RA 5G1SA 5MGBA 1UYTA 3M6NA 5DZKA 1UYSA 3KTGA 3ZWAA 3TVWA 5FIFA 2DUBA 3KQFA 3RSIA 1TYFA 1WDMA 2BZRA 4I4ZA 1RJMA 3P2LA 1X0UA 5DTPA 1HNOA 4B3HA 4JVTA 2VSSF 2ZQRA 3QYRA 4B3IA 4JCTA 3RRVA 4JWVA 4ZDDA 5DZKH 1JXZA 1FC6A 3SWXA 2Q34A 2WTBA 3PGQA 4GHNA 4Q0GA 5DKPA 3P5MA 3OT6A 3GLMA 4Z0MA 3HE2A 4WZ8B 4HNKA 2W3PA 4ZDFA 4OMRA 1Q51A 1SG4A 5KDRB 4ZDCA 3T3WA 3ST9A 5E0SA 1YG8A 3GF3A 4JCRA 4FJWD 5C9GA 4GM2A 2EJ5A 4FN7A 3U9TB 3T88A 1UYRA 3I47A 4L8KA 1N6FA 1K32A 1FC9A 5KDRA 5FUSA 4Q1IA 3R6HA 3Q1TA 3LKEA 3IB9A 4L6WA 3H0JA 4MXIA 2VSUE 5DL1A 3GMAA 3GKBA 1W2XA 2F9YA 4FZWA 3Q7HA 5DU6A 3N6RB 1XNVA 3MYBA 4JSBA 2A81A 3TRRA 4ASIA 2X58A 4RYFH 3ZWBA 3NJBA 4U1AA 5INIA 4YLHA 3G64A 5DUCA 5KJPA 1Q52A 2C8TA 3PE8A 1XNYA 1UYVA 3TLFA 5INFA 3TZ3A 4ELSA 4FNDA 2F6QA 3VIVA 3ZWCA 4ZDEA 3QKAA 4OLQA 4IZDA 3PZKA 3HP0A 5E0NX 2CE3A 3V5EA 5INGA 5E0SH 1EF9A 3NJDA 4FNBA 1FC7A 1MJ3A 1YG6A 3MT6A 5DU8A 4QIIA 4FN8A 3U9RB 2F9IB 1J7XA 3QWDA 4JFCA 1XNWA 2UZFA 3M6MA 1SZOA 4JJTA 3MOYA 3DORA 3QMJA 3KTKA 3QXIA 3HRXA 2CBYA 4KWBA 3R0OA 3T8AA 3PEAA 4ZDBA 4JYLA 2VSUC 4KNPA 4JCQA 1ON3A 3TDCA 4FB8A 3KTJA 4FZWC 3SLLA 4ELWA 4KD6A 1DUBA 2VSUF 2ZL4A 3TV5A 4RCNA 4LK5A 2DEOA 3L3SA 4WYOB 5DU4A 4U18A 4OG1A 2J5SA 1FCFA 2VREA 4JOTA 1NZYA 2A7KA 3U9SB 3ZW8A 2J5IA 1Y7OA 3H81A 4IZBA 2VX2A 3FDUA 3R9TA 3RSTA 3IBBA 3K8XA 2ZQQA 1WZ8A 2A7SA 3T8BA 2ZL2A 2J5GA 1UIYA 4EMPA 4U0GH 4F47A 3TT6A 3H02A 5DTWA 3HINA 1XX4A 2ZL0A 1OD4A 3DJAA 2GTRA 3P85A 1NZYB 2PBPA 3FF6A 4K3WA 1HZDA 3LAOA 3R9QA 2PG8A 4KPKA 5CTCA 4DI1A 4B3JA 3GF7A 2PPYA 2HW5A 4IZCA 2VSUA 2VSSA 3QK8A 1RJNA 4EMMA 5G1QA 3BF0A 4U19A 2QQ3A 2D3TA 5JBWA 3H0UA 1ON9A 2NP9A 1WDKA 3TVUA 4WCZA 1DCIA 4U0HA 3Q0GA 1HNUA 4I42A 5G1RA 1PIXA 3WG5A 3OMEA 3HLN1 2J5II 3KTIA 5JBXA 3K50A 4NNQA 2F9YB 3MFMA 2FW2A 2Q35A 2X24A 2F9IA 5DUFA 4K2NA 4U0GA 4MOUA 3T89A 4QIJA 3QREA 2F6IA 4ZU2A 1TG6A 1PJHA 5IKLB 4JYJA 3JU1A 1VRGA 3V5IA 3OC7A 1N6DA 2J5GD 3ISAA 4HC8A 1OD2A 2ZL3A 2FBMA 3BPPA 3KTHA 3STAA 3H0QA 3BEZA 5C90A 3Q0JA 1EF8A 1XO6A 3R9SA 1N6EA 2J5IB 4RYFA 3QXZA 2FZSA 4K29A 4NEKA 1O8UA
chains in the Genus database with same CATH superfamily
2VSSE 4ELXA 4I52A 4QFEA 4EMLA 2Q2XA 1K39A 4MI2A 1WDLA 3H0SA 5CTBA 1EY3A 3ADDA 4JCSA 3IAVA 3TT7A 3ZW9A 2IEXA 4G2RA 5G1SA 5MGBA 1UYTA 3M6NA 5DZKA 1UYSA 3KTGA 3ZWAA 3TVWA 5FIFA 2DUBA 3KQFA 3RSIA 1TYFA 1WDMA 2BZRA 4I4ZA 1RJMA 3P2LA 1X0UA 5DTPA 1HNOA 4B3HA 4JVTA 2VSSF 3W8IB 2ZQRA 3QYRA 4B3IA 4JCTA 3RRVA 3RQGA 4JWVA 3A4NA 4ZDDA 5DZKH 1JXZA 1FC6A 1Y64B 3SWXA 2Q34A 2WTBA 3PGQA 4GHNA 4Q0GA 5DKPA 3P5MA 3OT6A 3GLMA 4Z0MA 3HE2A 4WZ8B 4HNKA 2W3PA 4ZDFA 3AM1A 4OMRA 1Q51A 1SG4A 5KDRB 4ZDCA 3T3WA 4NARA 3ST9A 5E0SA 1YG8A 3GF3A 4JCRA 4FJWD 5C9GA 4GM2A 2EJ5A 4FN7A 3U9TB 3T88A 1UYRA 3I47A 4GEHB 4L8KA 1N6FA 1K32A 1FC9A 5KDRA 5FUSA 4Q1IA 3R6HA 3Q1TA 3W8HB 3LKEA 3IB9A 4L6WA 3H0JA 4MXIA 2VSUE 5DL1A 3GMAA 3GKBA 1W2XA 2F9YA 4FZWA 3Q7HA 5DU6A 3N6RB 1XNVA 3MYBA 4JSBA 2A81A 3TRRA 4ASIA 2X58A 3ADBA 4RYFH 3ZWBA 3NJBA 4U1AA 5INIA 4YLHA 3G64A 5DUCA 5KJPA 3IRBA 1Q52A 2C8TA 3PE8A 1XNYA 1UYVA 3TLFA 5INFA 3AJMA 3TZ3A 4ELSA 4FNDA 2F6QA 3VIVA 3ZWCA 4ZDEA 3QKAA 4OLQA 4IZDA 3PZKA 3HP0A 5E0NX 1UX5A 2CE3A 3V5EA 5INGA 5E0SH 1EF9A 3NJDA 4FNBA 1FC7A 1MJ3A 3L8IA 1YG6A 3MT6A 5DU8A 4QIIA 4FN8A 3U9RB 2F9IB 1J7XA 3QWDA 4JFCA 1XNWA 2UZFA 3M6MA 1SZOA 4JJTA 3MOYA 3DORA 3QMJA 3KTKA 3QXIA 3HRXA 2CBYA 4KWBA 3R0OA 3T8AA 3PEAA 4ZDBA 4JYLA 2VSUC 4KNPA 3ADCA 4JCQA 1ON3A 3TDCA 4FB8A 3KTJA 4FZWC 3SLLA 1UX4A 4ELWA 4KD6A 1DUBA 2VSUF 3O4XE 2ZL4A 3TV5A 4RCNA 4LK5A 2DEOA 3L3SA 4WYOB 5DU4A 4U18A 4OG1A 2J5SA 1FCFA 2VREA 4JOTA 1NZYA 2A7KA 3U9SB 3ZW8A 2J5IA 1Y7OA 3H81A 2P63A 4IZBA 2VX2A 3FDUA 3R9TA 3RSTA 3IBBA 3K8XA 2ZQQA 1WZ8A 2A7SA 3T8BA 2ZL2A 2J5GA 1UIYA 4EMPA 4U0GH 4F47A 3TT6A 3H02A 5DTWA 3HINA 1XX4A 2ZL0A 1OD4A 3DJAA 2GTRA 3P85A 1NZYB 2PBPA 3A4LA 3FF6A 4K3WA 1HZDA 3LAOA 3R9QA 2PG8A 4KPKA 5CTCA 4DI1A 4B3JA 3GF7A 2PPYA 2HW5A 4IZCA 5HUQA 4HDTA 2VSUA 2VSSA 3QK8A 1RJNA 4EMMA 5G1QA 3BF0A 4U19A 2QQ3A 2D3TA 5JBWA 3H0UA 1ON9A 2NP9A 1WDKA 3L8JA 3TVUA 4WCZA 1DCIA 4U0HA 3Q0GA 1HNUA 4I42A 5G1RA 1PIXA 3WG5A 3OMEA 3HLN1 2J5II 3KTIA 4NNQA 5JBXA 3K50A 2F9YB 3MFMA 3BPTA 2FW2A 3RQEA 2Q35A 2X24A 2F9IA 5DUFA 4K2NA 4U0GA 4MOUA 3T89A 2YJGA 4QIJA 3QREA 2F6IA 4ZU2A 1TG6A 1PJHA 5IKLB 4JYJA 3JU1A 1VRGA 3A4MA 3V5IA 3OC7A 4J2UA 1N6DA 2J5GD 3ISAA 4HC8A 1OD2A 3RQFA 2ZL3A 2FBMA 3BPPA 3KTHA 3STAA 3H0QA 3BEZA 5C90A 3Q0JA 1EF8A 1XO6A 3R9SA 1N6EA 2J5IB 4RYFA 3QXZA 2FZSA 4K29A 4NEKA 1O8UA
chains in the Genus database with same CATH topology
2VSSE 4ELXA 4I52A 4QFEA 4EMLA 2Q2XA 1K39A 4MI2A 1WDLA 3H0SA 5CTBA 1EY3A 4JCSA 3IAVA 3TT7A 3ZW9A 2IEXA 4G2RA 5G1SA 5MGBA 1UYTA 3M6NA 5DZKA 1UYSA 3KTGA 3ZWAA 3TVWA 5FIFA 2DUBA 3KQFA 3RSIA 1TYFA 1WDMA 2BZRA 4I4ZA 1RJMA 3P2LA 1X0UA 5DTPA 1HNOA 4B3HA 4JVTA 2VSSF 2ZQRA 3QYRA 4B3IA 4JCTA 3RRVA 4JWVA 4ZDDA 5DZKH 1JXZA 1FC6A 3SWXA 2Q34A 2WTBA 3PGQA 4GHNA 4Q0GA 5DKPA 3P5MA 3OT6A 3GLMA 4Z0MA 3HE2A 4WZ8B 4HNKA 2W3PA 4ZDFA 4OMRA 1Q51A 1SG4A 5KDRB 4ZDCA 3T3WA 4NARA 3ST9A 5E0SA 1YG8A 3GF3A 4JCRA 4FJWD 5C9GA 4GM2A 2EJ5A 4FN7A 3U9TB 3T88A 1UYRA 3I47A 4L8KA 1N6FA 1K32A 1FC9A 5KDRA 5FUSA 4Q1IA 3R6HA 3Q1TA 3LKEA 3IB9A 4L6WA 3H0JA 4MXIA 2VSUE 5DL1A 3GMAA 3GKBA 1W2XA 2F9YA 4FZWA 3Q7HA 5DU6A 3N6RB 1XNVA 3MYBA 4JSBA 2A81A 3TRRA 4ASIA 2X58A 4RYFH 3ZWBA 3NJBA 4U1AA 5INIA 4YLHA 3G64A 5DUCA 5KJPA 1Q52A 2C8TA 3PE8A 1XNYA 1UYVA 3TLFA 5INFA 3TZ3A 4ELSA 4FNDA 2F6QA 3VIVA 3ZWCA 4ZDEA 3QKAA 4OLQA 4IZDA 3PZKA 3HP0A 5E0NX 2CE3A 3V5EA 5INGA 5E0SH 1EF9A 3NJDA 4FNBA 1FC7A 1MJ3A 1YG6A 3MT6A 5DU8A 4QIIA 4FN8A 3U9RB 2F9IB 1J7XA 3QWDA 4JFCA 1XNWA 2UZFA 3M6MA 1SZOA 4JJTA 3MOYA 3DORA 3QMJA 3KTKA 3QXIA 3HRXA 2CBYA 4KWBA 3R0OA 3T8AA 3PEAA 4ZDBA 4JYLA 2VSUC 4KNPA 4JCQA 1ON3A 3TDCA 4FB8A 3KTJA 4FZWC 3SLLA 4ELWA 4KD6A 1DUBA 2VSUF 2ZL4A 3TV5A 4RCNA 4LK5A 2DEOA 3L3SA 4WYOB 5DU4A 4U18A 4OG1A 2J5SA 1FCFA 2VREA 4JOTA 1NZYA 2A7KA 3U9SB 3ZW8A 2J5IA 1Y7OA 3H81A 4IZBA 2VX2A 3FDUA 3R9TA 3RSTA 3IBBA 3K8XA 2ZQQA 1WZ8A 2A7SA 3T8BA 2ZL2A 2J5GA 1UIYA 4EMPA 4U0GH 4F47A 3TT6A 3H02A 5DTWA 3HINA 1XX4A 2ZL0A 1OD4A 3DJAA 2GTRA 3P85A 1NZYB 2PBPA 3FF6A 4K3WA 1HZDA 3LAOA 3R9QA 2PG8A 4KPKA 5CTCA 4DI1A 4B3JA 3GF7A 2PPYA 2HW5A 4IZCA 5HUQA 4HDTA 2VSUA 2VSSA 3QK8A 1RJNA 4EMMA 5G1QA 3BF0A 4U19A 2QQ3A 2D3TA 5JBWA 3H0UA 1ON9A 2NP9A 1WDKA 3TVUA 4WCZA 1DCIA 4U0HA 3Q0GA 1HNUA 4I42A 5G1RA 1PIXA 3WG5A 3OMEA 3HLN1 2J5II 3KTIA 5JBXA 3K50A 4NNQA 2F9YB 3MFMA 3BPTA 2FW2A 2Q35A 2X24A 2F9IA 5DUFA 4K2NA 4U0GA 4MOUA 3T89A 2YJGA 4QIJA 3QREA 2F6IA 4ZU2A 1TG6A 1PJHA 5IKLB 4JYJA 3JU1A 1VRGA 3V5IA 3OC7A 4J2UA 1N6DA 2J5GD 3ISAA 4HC8A 1OD2A 2ZL3A 2FBMA 3BPPA 3KTHA 3STAA 3H0QA 3BEZA 5C90A 3Q0JA 1EF8A 1XO6A 3R9SA 1N6EA 2J5IB 4RYFA 3QXZA 2FZSA 4K29A 4NEKA 1O8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSS E;  4ELX A;  4I52 A;  4QFE A;  4EML A;  2Q2X A;  1K39 A;  4MI2 A;  1WDL A;  3H0S A;  5CTB A;  1EY3 A;  4JCS A;  3IAV A;  3TT7 A;  3ZW9 A;  2IEX A;  4G2R A;  5G1S A;  5MGB A;  1UYT A;  3M6N A;  5DZK A;  1UYS A;  3KTG A;  3ZWA A;  3TVW A;  5FIF A;  2DUB A;  3KQF A;  3RSI A;  1TYF A;  1WDM A;  2BZR A;  4I4Z A;  1RJM A;  3P2L A;  1X0U A;  5DTP A;  1HNO A;  4B3H A;  4JVT A;  2VSS F;  2ZQR A;  3QYR A;  4B3I A;  4JCT A;  3RRV A;  4JWV A;  4ZDD A;  5DZK H;  1JXZ A;  1FC6 A;  3SWX A;  2Q34 A;  2WTB A;  3PGQ A;  4GHN A;  4Q0G A;  5DKP A;  3P5M A;  3OT6 A;  3GLM A;  4Z0M A;  3HE2 A;  4WZ8 B;  4HNK A;  2W3P A;  4ZDF A;  4OMR A;  1Q51 A;  1SG4 A;  5KDR B;  4ZDC A;  3T3W A;  3ST9 A;  5E0S A;  1YG8 A;  3GF3 A;  4JCR A;  4FJW D;  5C9G A;  4GM2 A;  2EJ5 A;  4FN7 A;  3U9T B;  3T88 A;  1UYR A;  3I47 A;  4L8K A;  1N6F A;  1K32 A;  1FC9 A;  5KDR A;  5FUS A;  4Q1I A;  3R6H A;  3Q1T A;  3LKE A;  3IB9 A;  4L6W A;  3H0J A;  4MXI A;  2VSU E;  5DL1 A;  3GMA A;  3GKB A;  1W2X A;  2F9Y A;  4FZW A;  3Q7H A;  5DU6 A;  3N6R B;  1XNV A;  3MYB A;  4JSB A;  2A81 A;  3TRR A;  4ASI A;  2X58 A;  4RYF H;  3ZWB A;  3NJB A;  4U1A A;  5INI A;  4YLH A;  3G64 A;  5DUC A;  5KJP A;  1Q52 A;  2C8T A;  3PE8 A;  1XNY A;  1UYV A;  3TLF A;  5INF A;  3TZ3 A;  4ELS A;  4FND A;  2F6Q A;  3VIV A;  3ZWC A;  4ZDE A;  3QKA A;  4OLQ A;  4IZD A;  3PZK A;  3HP0 A;  5E0N X;  2CE3 A;  3V5E A;  5ING A;  5E0S H;  1EF9 A;  3NJD A;  4FNB A;  1FC7 A;  1MJ3 A;  1YG6 A;  3MT6 A;  5DU8 A;  4QII A;  4FN8 A;  3U9R B;  2F9I B;  1J7X A;  3QWD A;  4JFC A;  1XNW A;  2UZF A;  3M6M A;  1SZO A;  4JJT A;  3MOY A;  3DOR A;  3QMJ A;  3KTK A;  3QXI A;  3HRX A;  2CBY A;  4KWB A;  3R0O A;  3T8A A;  3PEA A;  4ZDB A;  4JYL A;  2VSU C;  4KNP A;  4JCQ A;  1ON3 A;  3TDC A;  4FB8 A;  3KTJ A;  4FZW C;  3SLL A;  4ELW A;  4KD6 A;  1DUB A;  2VSU F;  2ZL4 A;  3TV5 A;  4RCN A;  4LK5 A;  2DEO A;  3L3S A;  4WYO B;  5DU4 A;  4U18 A;  4OG1 A;  2J5S A;  1FCF A;  2VRE A;  4JOT A;  1NZY A;  2A7K A;  3U9S B;  3ZW8 A;  2J5I A;  1Y7O A;  3H81 A;  4IZB A;  2VX2 A;  3FDU A;  3R9T A;  3RST A;  3IBB A;  3K8X A;  2ZQQ A;  1WZ8 A;  2A7S A;  3T8B A;  2ZL2 A;  2J5G A;  1UIY A;  4EMP A;  4U0G H;  4F47 A;  3TT6 A;  3H02 A;  5DTW A;  3HIN A;  1XX4 A;  2ZL0 A;  1OD4 A;  3DJA A;  2GTR A;  3P85 A;  1NZY B;  2PBP A;  3FF6 A;  4K3W A;  1HZD A;  3LAO A;  3R9Q A;  2PG8 A;  4KPK A;  5CTC A;  4DI1 A;  4B3J A;  3GF7 A;  2PPY A;  2HW5 A;  4IZC A;  2VSU A;  2VSS A;  3QK8 A;  1RJN A;  4EMM A;  5G1Q A;  3BF0 A;  4U19 A;  2QQ3 A;  2D3T A;  5JBW A;  3H0U A;  1ON9 A;  2NP9 A;  1WDK A;  3TVU A;  4WCZ A;  1DCI A;  4U0H A;  3Q0G A;  1HNU A;  4I42 A;  5G1R A;  1PIX A;  3WG5 A;  3OME A;  3HLN 1;  2J5I I;  3KTI A;  5JBX A;  3K50 A;  4NNQ A;  2F9Y B;  3MFM A;  2FW2 A;  2Q35 A;  2X24 A;  2F9I A;  5DUF A;  4K2N A;  4U0G A;  4MOU A;  3T89 A;  4QIJ A;  3QRE A;  2F6I A;  4ZU2 A;  1TG6 A;  1PJH A;  5IKL B;  4JYJ A;  3JU1 A;  1VRG A;  3V5I A;  3OC7 A;  1N6D A;  2J5G D;  3ISA A;  4HC8 A;  1OD2 A;  2ZL3 A;  2FBM A;  3BPP A;  3KTH A;  3STA A;  3H0Q A;  3BEZ A;  5C90 A;  3Q0J A;  1EF8 A;  1XO6 A;  3R9S A;  1N6E A;  2J5I B;  4RYF A;  3QXZ A;  2FZS A;  4K29 A;  4NEK A;  1O8U A; 
#chains in the Genus database with same CATH topology
 2VSS E;  4ELX A;  4I52 A;  4QFE A;  4EML A;  2Q2X A;  1K39 A;  4MI2 A;  1WDL A;  3H0S A;  5CTB A;  1EY3 A;  3ADD A;  4JCS A;  3IAV A;  3TT7 A;  3ZW9 A;  2IEX A;  4G2R A;  5G1S A;  5MGB A;  1UYT A;  3M6N A;  5DZK A;  1UYS A;  3KTG A;  3ZWA A;  3TVW A;  5FIF A;  2DUB A;  3KQF A;  3RSI A;  1TYF A;  1WDM A;  2BZR A;  4I4Z A;  1RJM A;  3P2L A;  1X0U A;  5DTP A;  1HNO A;  4B3H A;  4JVT A;  2VSS F;  3W8I B;  2ZQR A;  3QYR A;  4B3I A;  4JCT A;  3RRV A;  3RQG A;  4JWV A;  3A4N A;  4ZDD A;  5DZK H;  1JXZ A;  1FC6 A;  1Y64 B;  3SWX A;  2Q34 A;  2WTB A;  3PGQ A;  4GHN A;  4Q0G A;  5DKP A;  3P5M A;  3OT6 A;  3GLM A;  4Z0M A;  3HE2 A;  4WZ8 B;  4HNK A;  2W3P A;  4ZDF A;  3AM1 A;  4OMR A;  1Q51 A;  1SG4 A;  5KDR B;  4ZDC A;  3T3W A;  4NAR A;  3ST9 A;  5E0S A;  1YG8 A;  3GF3 A;  4JCR A;  4FJW D;  5C9G A;  4GM2 A;  2EJ5 A;  4FN7 A;  3U9T B;  3T88 A;  1UYR A;  3I47 A;  4GEH B;  4L8K A;  1N6F A;  1K32 A;  1FC9 A;  5KDR A;  5FUS A;  4Q1I A;  3R6H A;  3Q1T A;  3W8H B;  3LKE A;  3IB9 A;  4L6W A;  3H0J A;  4MXI A;  2VSU E;  5DL1 A;  3GMA A;  3GKB A;  1W2X A;  2F9Y A;  4FZW A;  3Q7H A;  5DU6 A;  3N6R B;  1XNV A;  3MYB A;  4JSB A;  2A81 A;  3TRR A;  4ASI A;  2X58 A;  3ADB A;  4RYF H;  3ZWB A;  3NJB A;  4U1A A;  5INI A;  4YLH A;  3G64 A;  5DUC A;  5KJP A;  3IRB A;  1Q52 A;  2C8T A;  3PE8 A;  1XNY A;  1UYV A;  3TLF A;  5INF A;  3AJM A;  3TZ3 A;  4ELS A;  4FND A;  2F6Q A;  3VIV A;  3ZWC A;  4ZDE A;  3QKA A;  4OLQ A;  4IZD A;  3PZK A;  3HP0 A;  5E0N X;  1UX5 A;  2CE3 A;  3V5E A;  5ING A;  5E0S H;  1EF9 A;  3NJD A;  4FNB A;  1FC7 A;  1MJ3 A;  3L8I A;  1YG6 A;  3MT6 A;  5DU8 A;  4QII A;  4FN8 A;  3U9R B;  2F9I B;  1J7X A;  3QWD A;  4JFC A;  1XNW A;  2UZF A;  3M6M A;  1SZO A;  4JJT A;  3MOY A;  3DOR A;  3QMJ A;  3KTK A;  3QXI A;  3HRX A;  2CBY A;  4KWB A;  3R0O A;  3T8A A;  3PEA A;  4ZDB A;  4JYL A;  2VSU C;  4KNP A;  3ADC A;  4JCQ A;  1ON3 A;  3TDC A;  4FB8 A;  3KTJ A;  4FZW C;  3SLL A;  1UX4 A;  4ELW A;  4KD6 A;  1DUB A;  2VSU F;  3O4X E;  2ZL4 A;  3TV5 A;  4RCN A;  4LK5 A;  2DEO A;  3L3S A;  4WYO B;  5DU4 A;  4U18 A;  4OG1 A;  2J5S A;  1FCF A;  2VRE A;  4JOT A;  1NZY A;  2A7K A;  3U9S B;  3ZW8 A;  2J5I A;  1Y7O A;  3H81 A;  2P63 A;  4IZB A;  2VX2 A;  3FDU A;  3R9T A;  3RST A;  3IBB A;  3K8X A;  2ZQQ A;  1WZ8 A;  2A7S A;  3T8B A;  2ZL2 A;  2J5G A;  1UIY A;  4EMP A;  4U0G H;  4F47 A;  3TT6 A;  3H02 A;  5DTW A;  3HIN A;  1XX4 A;  2ZL0 A;  1OD4 A;  3DJA A;  2GTR A;  3P85 A;  1NZY B;  2PBP A;  3A4L A;  3FF6 A;  4K3W A;  1HZD A;  3LAO A;  3R9Q A;  2PG8 A;  4KPK A;  5CTC A;  4DI1 A;  4B3J A;  3GF7 A;  2PPY A;  2HW5 A;  4IZC A;  5HUQ A;  4HDT A;  2VSU A;  2VSS A;  3QK8 A;  1RJN A;  4EMM A;  5G1Q A;  3BF0 A;  4U19 A;  2QQ3 A;  2D3T A;  5JBW A;  3H0U A;  1ON9 A;  2NP9 A;  1WDK A;  3L8J A;  3TVU A;  4WCZ A;  1DCI A;  4U0H A;  3Q0G A;  1HNU A;  4I42 A;  5G1R A;  1PIX A;  3WG5 A;  3OME A;  3HLN 1;  2J5I I;  3KTI A;  4NNQ A;  5JBX A;  3K50 A;  2F9Y B;  3MFM A;  3BPT A;  2FW2 A;  3RQE A;  2Q35 A;  2X24 A;  2F9I A;  5DUF A;  4K2N A;  4U0G A;  4MOU A;  3T89 A;  2YJG A;  4QIJ A;  3QRE A;  2F6I A;  4ZU2 A;  1TG6 A;  1PJH A;  5IKL B;  4JYJ A;  3JU1 A;  1VRG A;  3A4M A;  3V5I A;  3OC7 A;  4J2U A;  1N6D A;  2J5G D;  3ISA A;  4HC8 A;  1OD2 A;  3RQF A;  2ZL3 A;  2FBM A;  3BPP A;  3KTH A;  3STA A;  3H0Q A;  3BEZ A;  5C90 A;  3Q0J A;  1EF8 A;  1XO6 A;  3R9S A;  1N6E A;  2J5I B;  4RYF A;  3QXZ A;  2FZS A;  4K29 A;  4NEK A;  1O8U A; 
#chains in the Genus database with same CATH homology
 2VSS E;  4ELX A;  4I52 A;  4QFE A;  4EML A;  2Q2X A;  1K39 A;  4MI2 A;  1WDL A;  3H0S A;  5CTB A;  1EY3 A;  4JCS A;  3IAV A;  3TT7 A;  3ZW9 A;  2IEX A;  4G2R A;  5G1S A;  5MGB A;  1UYT A;  3M6N A;  5DZK A;  1UYS A;  3KTG A;  3ZWA A;  3TVW A;  5FIF A;  2DUB A;  3KQF A;  3RSI A;  1TYF A;  1WDM A;  2BZR A;  4I4Z A;  1RJM A;  3P2L A;  1X0U A;  5DTP A;  1HNO A;  4B3H A;  4JVT A;  2VSS F;  2ZQR A;  3QYR A;  4B3I A;  4JCT A;  3RRV A;  4JWV A;  4ZDD A;  5DZK H;  1JXZ A;  1FC6 A;  3SWX A;  2Q34 A;  2WTB A;  3PGQ A;  4GHN A;  4Q0G A;  5DKP A;  3P5M A;  3OT6 A;  3GLM A;  4Z0M A;  3HE2 A;  4WZ8 B;  4HNK A;  2W3P A;  4ZDF A;  4OMR A;  1Q51 A;  1SG4 A;  5KDR B;  4ZDC A;  3T3W A;  4NAR A;  3ST9 A;  5E0S A;  1YG8 A;  3GF3 A;  4JCR A;  4FJW D;  5C9G A;  4GM2 A;  2EJ5 A;  4FN7 A;  3U9T B;  3T88 A;  1UYR A;  3I47 A;  4L8K A;  1N6F A;  1K32 A;  1FC9 A;  5KDR A;  5FUS A;  4Q1I A;  3R6H A;  3Q1T A;  3LKE A;  3IB9 A;  4L6W A;  3H0J A;  4MXI A;  2VSU E;  5DL1 A;  3GMA A;  3GKB A;  1W2X A;  2F9Y A;  4FZW A;  3Q7H A;  5DU6 A;  3N6R B;  1XNV A;  3MYB A;  4JSB A;  2A81 A;  3TRR A;  4ASI A;  2X58 A;  4RYF H;  3ZWB A;  3NJB A;  4U1A A;  5INI A;  4YLH A;  3G64 A;  5DUC A;  5KJP A;  1Q52 A;  2C8T A;  3PE8 A;  1XNY A;  1UYV A;  3TLF A;  5INF A;  3TZ3 A;  4ELS A;  4FND A;  2F6Q A;  3VIV A;  3ZWC A;  4ZDE A;  3QKA A;  4OLQ A;  4IZD A;  3PZK A;  3HP0 A;  5E0N X;  2CE3 A;  3V5E A;  5ING A;  5E0S H;  1EF9 A;  3NJD A;  4FNB A;  1FC7 A;  1MJ3 A;  1YG6 A;  3MT6 A;  5DU8 A;  4QII A;  4FN8 A;  3U9R B;  2F9I B;  1J7X A;  3QWD A;  4JFC A;  1XNW A;  2UZF A;  3M6M A;  1SZO A;  4JJT A;  3MOY A;  3DOR A;  3QMJ A;  3KTK A;  3QXI A;  3HRX A;  2CBY A;  4KWB A;  3R0O A;  3T8A A;  3PEA A;  4ZDB A;  4JYL A;  2VSU C;  4KNP A;  4JCQ A;  1ON3 A;  3TDC A;  4FB8 A;  3KTJ A;  4FZW C;  3SLL A;  4ELW A;  4KD6 A;  1DUB A;  2VSU F;  2ZL4 A;  3TV5 A;  4RCN A;  4LK5 A;  2DEO A;  3L3S A;  4WYO B;  5DU4 A;  4U18 A;  4OG1 A;  2J5S A;  1FCF A;  2VRE A;  4JOT A;  1NZY A;  2A7K A;  3U9S B;  3ZW8 A;  2J5I A;  1Y7O A;  3H81 A;  4IZB A;  2VX2 A;  3FDU A;  3R9T A;  3RST A;  3IBB A;  3K8X A;  2ZQQ A;  1WZ8 A;  2A7S A;  3T8B A;  2ZL2 A;  2J5G A;  1UIY A;  4EMP A;  4U0G H;  4F47 A;  3TT6 A;  3H02 A;  5DTW A;  3HIN A;  1XX4 A;  2ZL0 A;  1OD4 A;  3DJA A;  2GTR A;  3P85 A;  1NZY B;  2PBP A;  3FF6 A;  4K3W A;  1HZD A;  3LAO A;  3R9Q A;  2PG8 A;  4KPK A;  5CTC A;  4DI1 A;  4B3J A;  3GF7 A;  2PPY A;  2HW5 A;  4IZC A;  5HUQ A;  4HDT A;  2VSU A;  2VSS A;  3QK8 A;  1RJN A;  4EMM A;  5G1Q A;  3BF0 A;  4U19 A;  2QQ3 A;  2D3T A;  5JBW A;  3H0U A;  1ON9 A;  2NP9 A;  1WDK A;  3TVU A;  4WCZ A;  1DCI A;  4U0H A;  3Q0G A;  1HNU A;  4I42 A;  5G1R A;  1PIX A;  3WG5 A;  3OME A;  3HLN 1;  2J5I I;  3KTI A;  5JBX A;  3K50 A;  4NNQ A;  2F9Y B;  3MFM A;  3BPT A;  2FW2 A;  2Q35 A;  2X24 A;  2F9I A;  5DUF A;  4K2N A;  4U0G A;  4MOU A;  3T89 A;  2YJG A;  4QIJ A;  3QRE A;  2F6I A;  4ZU2 A;  1TG6 A;  1PJH A;  5IKL B;  4JYJ A;  3JU1 A;  1VRG A;  3V5I A;  3OC7 A;  4J2U A;  1N6D A;  2J5G D;  3ISA A;  4HC8 A;  1OD2 A;  2ZL3 A;  2FBM A;  3BPP A;  3KTH A;  3STA A;  3H0Q A;  3BEZ A;  5C90 A;  3Q0J A;  1EF8 A;  1XO6 A;  3R9S A;  1N6E A;  2J5I B;  4RYF A;  3QXZ A;  2FZS A;  4K29 A;  4NEK A;  1O8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...