1DCIA

Dienoyl-coa isomerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
b'AYESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSITFSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIENOYL-COA ISOMERASE
publication title The crystal structure of dienoyl-CoA isomerase at 1.5 A resolution reveals the importance of aspartate and glutamate sidechains for catalysis.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
total genus 106
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1998-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1dciA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1dciA01
3BF0A 1RJNA 4ELXA 1UYVA 1XX4A 1SG4A 2IEXA 4ELSA 3H0UA 3GLMA 3TDCA 4IZDA 4B3JA 1VRGA 4FNDA 3TZ3A 3FF6A 4MXIA 1Q51A 3P85A 5KDRB 4GM2A 4U19A 3TRRA 4QIIA 5DU6A 5E0NX 3KTKA 4FJWD 2DEOA 3GF7A 3OC7A 4ZDEA 1WDMA 5DZKH 3MOYA 3H0QA 3K8XA 4YLHA 3P5MA 3SLLA 3PZKA 5C9GA 2PPYA 4JSBA 2F9YB 4K29A 3NJDA 4RYFA 5E0SA 4NNQA 3U9SB 3M6MA 3QK8A 3QXIA 2Q2XA 3LKEA 4EMPA 1WDLA 3HE2A 3GKBA 3PEAA 3Q0JA 2VREA 3TV5A 5DU4A 1UYRA 1XNWA 5KJPA 1JXZA 2VSUA 4ZDCA 1N6DA 5C90A 3SWXA 3QMJA 2J5GD 4KWBA 5IKLB 4FB8A 2GTRA 5CTCA 3T8AA 4EMLA 1UYTA 2ZL2A 4MOUA 3H81A 1FC6A 2UZFA 3NJBA 4L6WA 2ZQRA 5DUFA 1ON3A 3H0SA 1HNOA 3ZW9A 4B3HA 3KTGA 1FC7A 2J5SA 2J5IB 2VSUF 5G1SA 3PE8A 3LAOA 5E0SH 4FZWA 4F47A 3MYBA 4HC8A 5JBXA 3ZWCA 3TT7A 3Q0GA 2F6IA 4WZ8B 2FW2A 1N6FA 3KTJA 2D3TA 1XO6A 3L3SA 3T8BA 3R9QA 2ZQQA 3BPPA 4JYLA 3DORA 3HINA 1W2XA 1J7XA 4QFEA 3R6HA 2VSSA 5G1QA 3V5IA 2F9IB 4G2RA 3T89A 1FCFA 4RCNA 4JFCA 4Q0GA 1EY3A 4OLQA 2A81A 5INIA 4I42A 5G1RA 5DTPA 5CTBA 4ZDBA 3TVUA 2EJ5A 3OT6A 3ST9A 2CE3A 1FC9A 2QQ3A 3IAVA 2VSUE 4LK5A 1K39A 2A7KA 3T88A 4ZU2A 4U0HA 3M6NA 3MFMA 4FNBA 4JWVA 2ZL3A 1PJHA 3QYRA 1YG8A 2ZL0A 3JU1A 4U18A 1TG6A 4L8KA 2F6QA 4HNKA 1O8UA 3HP0A 4JVTA 2VX2A 2Q35A 4OMRA 2HW5A 3ZWBA 3R9TA 1UIYA 4ELWA 1XNVA 3GMAA 1MJ3A 1Y7OA 5DKPA 1RJMA 4U1AA 3KTIA 4JJTA 3KTHA 1EF8A 4ZDDA 5DL1A 4RYFH 3QWDA 2BZRA 2J5IA 2C8TA 3QREA 1PIXA 3G64A 3R0OA 4K2NA 3N6RB 4KNPA 4I4ZA 4IZBA 1NZYB 3IB9A 3V5EA 3FDUA 4ASIA 5MGBA 4JYJA 2W3PA 3TLFA 2X24A 5INFA 2CBYA 3RRVA 3Q7HA 1WZ8A 3OMEA 3BEZA 2DUBA 2WTBA 1TYFA 4JOTA 2ZL4A 4WYOB 5KDRA 2VSUC 2A7SA 3MT6A 4KD6A 1YG6A 2VSSF 4NEKA 4U0GA 3QKAA 1Q52A 4EMMA 3HLN1 5JBWA 3VIVA 4Z0MA 3IBBA 3U9RB 5FIFA 1WDKA 1DUBA 2F9YA 3TVWA 1HNUA 2NP9A 3GF3A 4K3WA 4FZWC 4FN8A 2X58A 2Q34A 3RSIA 4JCSA 1DCIA 2J5GA 4B3IA 1X0UA 5DUCA 4I52A 3QXZA 1K32A 4JCTA 5DTWA 4QIJA 2PG8A 3KQFA 1HZDA 1ON9A 3I47A 3STAA 1OD4A 3ZWAA 4FN7A 3Q1TA 1N6EA 2PBPA 1EF9A 4U0GH 3TT6A 3U9TB 3RSTA 5INGA 2VSSE 3HRXA 1UYSA 3R9SA 4JCRA 1XNYA 1OD2A 3K50A 3WG5A 4ZDFA 2FZSA 3H0JA 4OG1A 5DU8A 3H02A 3ZW8A 3PGQA 1SZOA 2J5II 5DZKA 4GHNA 4JCQA 5FUSA 4Q1IA 4IZCA 1NZYA 4WCZA 3ISAA 3P2LA 3T3WA 4MI2A 4DI1A 3DJAA 2F9IA 2FBMA 4KPKA
chains in the Genus database with same CATH superfamily
4HDTA 3BF0A 1RJNA 4ELXA 1UYVA 3ADBA 1XX4A 1SG4A 2IEXA 4ELSA 3H0UA 3GLMA 3TDCA 4IZDA 4B3JA 3IRBA 1VRGA 4FNDA 3TZ3A 3FF6A 4MXIA 1Q51A 4NARA 3P85A 5KDRB 4GM2A 4U19A 3TRRA 4QIIA 5DU6A 5E0NX 3KTKA 4GEHB 4FJWD 2DEOA 3GF7A 3OC7A 4ZDEA 1WDMA 5DZKH 3MOYA 3H0QA 3K8XA 4YLHA 3P5MA 3SLLA 3PZKA 5C9GA 2PPYA 3RQFA 4JSBA 5HUQA 2F9YB 4K29A 3NJDA 4RYFA 5E0SA 4NNQA 3U9SB 3M6MA 3QK8A 3QXIA 2Q2XA 3LKEA 4EMPA 1WDLA 3HE2A 4J2UA 3GKBA 3PEAA 3Q0JA 2VREA 3TV5A 5DU4A 1UYRA 1XNWA 5KJPA 1JXZA 2VSUA 1UX4A 4ZDCA 3L8IA 1N6DA 5C90A 3SWXA 3QMJA 2J5GD 4KWBA 5IKLB 4FB8A 2GTRA 1UX5A 5CTCA 3T8AA 4EMLA 1UYTA 2ZL2A 4MOUA 3H81A 1FC6A 2UZFA 3NJBA 4L6WA 2ZQRA 5DUFA 1ON3A 3H0SA 1HNOA 3ZW9A 4B3HA 1Y64B 3KTGA 1FC7A 2J5SA 2J5IB 2VSUF 3L8JA 5G1SA 3PE8A 3LAOA 5E0SH 4FZWA 4F47A 3W8IB 3MYBA 4HC8A 5JBXA 3ZWCA 3TT7A 3Q0GA 2F6IA 4WZ8B 2FW2A 1N6FA 3KTJA 2D3TA 1XO6A 3L3SA 3T8BA 3R9QA 2ZQQA 3BPPA 4JYLA 3DORA 3HINA 1W2XA 1J7XA 4QFEA 3R6HA 2VSSA 5G1QA 3V5IA 2F9IB 4G2RA 3T89A 1FCFA 4RCNA 4JFCA 4Q0GA 1EY3A 4OLQA 2A81A 5INIA 4I42A 5G1RA 5DTPA 5CTBA 4ZDBA 3TVUA 2EJ5A 3OT6A 3ST9A 2CE3A 1FC9A 2QQ3A 3IAVA 2VSUE 3AM1A 4LK5A 1K39A 2A7KA 3T88A 4ZU2A 4U0HA 3RQEA 3M6NA 3MFMA 4FNBA 4JWVA 2ZL3A 1PJHA 3QYRA 1YG8A 2ZL0A 3JU1A 4U18A 1TG6A 4L8KA 2F6QA 4HNKA 1O8UA 3HP0A 4JVTA 2VX2A 2Q35A 4OMRA 2HW5A 3ZWBA 3R9TA 1UIYA 4ELWA 1XNVA 3GMAA 1MJ3A 1Y7OA 3ADDA 5DKPA 1RJMA 4U1AA 3BPTA 3KTIA 4JJTA 3KTHA 1EF8A 4ZDDA 5DL1A 4RYFH 3QWDA 2BZRA 2J5IA 2C8TA 3QREA 1PIXA 3G64A 3R0OA 4K2NA 3N6RB 4KNPA 4I4ZA 4IZBA 1NZYB 3IB9A 3V5EA 3FDUA 4ASIA 5MGBA 4JYJA 2W3PA 3TLFA 2X24A 5INFA 2CBYA 3RRVA 3Q7HA 1WZ8A 3OMEA 3BEZA 2DUBA 2WTBA 1TYFA 3A4LA 4JOTA 2ZL4A 4WYOB 5KDRA 2VSUC 2A7SA 3W8HB 3MT6A 4KD6A 1YG6A 2VSSF 4NEKA 4U0GA 3QKAA 1Q52A 4EMMA 3HLN1 5JBWA 3VIVA 4Z0MA 3IBBA 3U9RB 5FIFA 1WDKA 1DUBA 2F9YA 3TVWA 1HNUA 2NP9A 3GF3A 4K3WA 4FZWC 4FN8A 2X58A 2P63A 2Q34A 2YJGA 3RSIA 4JCSA 1DCIA 2J5GA 4B3IA 1X0UA 5DUCA 4I52A 3QXZA 1K32A 4JCTA 5DTWA 4QIJA 2PG8A 3KQFA 3ADCA 1HZDA 3RQGA 1ON9A 3I47A 3STAA 1OD4A 3ZWAA 3A4NA 4FN7A 3Q1TA 1N6EA 2PBPA 1EF9A 4U0GH 3TT6A 3U9TB 3RSTA 5INGA 2VSSE 3HRXA 1UYSA 3R9SA 4JCRA 1XNYA 1OD2A 3K50A 3WG5A 4ZDFA 2FZSA 3H0JA 4OG1A 5DU8A 3H02A 3A4MA 3ZW8A 3PGQA 1SZOA 3AJMA 2J5II 5DZKA 4GHNA 4JCQA 5FUSA 4Q1IA 4IZCA 1NZYA 4WCZA 3ISAA 3P2LA 3T3WA 4MI2A 4DI1A 3O4XE 3DJAA 2F9IA 2FBMA 4KPKA
chains in the Genus database with same CATH topology
4HDTA 3BF0A 1RJNA 4ELXA 1UYVA 1XX4A 1SG4A 2IEXA 4ELSA 3H0UA 3GLMA 3TDCA 4IZDA 4B3JA 1VRGA 4FNDA 3TZ3A 3FF6A 4MXIA 1Q51A 4NARA 3P85A 5KDRB 4GM2A 4U19A 3TRRA 4QIIA 5DU6A 5E0NX 3KTKA 4FJWD 2DEOA 3GF7A 3OC7A 4ZDEA 1WDMA 5DZKH 3MOYA 3H0QA 3K8XA 4YLHA 3P5MA 3SLLA 3PZKA 5C9GA 2PPYA 4JSBA 5HUQA 2F9YB 4K29A 3NJDA 4RYFA 5E0SA 4NNQA 3U9SB 3M6MA 3QK8A 3QXIA 2Q2XA 3LKEA 4EMPA 1WDLA 3HE2A 4J2UA 3GKBA 3PEAA 3Q0JA 2VREA 3TV5A 5DU4A 1UYRA 1XNWA 5KJPA 1JXZA 2VSUA 4ZDCA 1N6DA 5C90A 3SWXA 3QMJA 2J5GD 4KWBA 5IKLB 4FB8A 2GTRA 5CTCA 3T8AA 4EMLA 1UYTA 2ZL2A 4MOUA 3H81A 1FC6A 2UZFA 3NJBA 4L6WA 2ZQRA 5DUFA 1ON3A 3H0SA 1HNOA 3ZW9A 4B3HA 3KTGA 1FC7A 2J5SA 2J5IB 2VSUF 5G1SA 3PE8A 3LAOA 5E0SH 4FZWA 4F47A 3MYBA 4HC8A 5JBXA 3ZWCA 3TT7A 3Q0GA 2F6IA 4WZ8B 2FW2A 1N6FA 3KTJA 2D3TA 1XO6A 3L3SA 3T8BA 3R9QA 2ZQQA 3BPPA 4JYLA 3DORA 3HINA 1W2XA 1J7XA 4QFEA 3R6HA 2VSSA 5G1QA 3V5IA 2F9IB 4G2RA 3T89A 1FCFA 4RCNA 4JFCA 4Q0GA 1EY3A 4OLQA 2A81A 5INIA 4I42A 5G1RA 5DTPA 5CTBA 4ZDBA 3TVUA 2EJ5A 3OT6A 3ST9A 2CE3A 1FC9A 2QQ3A 3IAVA 2VSUE 4LK5A 1K39A 2A7KA 3T88A 4ZU2A 4U0HA 3M6NA 3MFMA 4FNBA 4JWVA 2ZL3A 1PJHA 3QYRA 1YG8A 2ZL0A 3JU1A 4U18A 1TG6A 4L8KA 2F6QA 4HNKA 1O8UA 3HP0A 4JVTA 2VX2A 2Q35A 4OMRA 2HW5A 3ZWBA 3R9TA 1UIYA 4ELWA 1XNVA 3GMAA 1MJ3A 1Y7OA 5DKPA 1RJMA 4U1AA 3BPTA 3KTIA 4JJTA 3KTHA 1EF8A 4ZDDA 5DL1A 4RYFH 3QWDA 2BZRA 2J5IA 2C8TA 3QREA 1PIXA 3G64A 3R0OA 4K2NA 3N6RB 4KNPA 4I4ZA 4IZBA 1NZYB 3IB9A 3V5EA 3FDUA 4ASIA 5MGBA 4JYJA 2W3PA 3TLFA 2X24A 5INFA 2CBYA 3RRVA 3Q7HA 1WZ8A 3OMEA 3BEZA 2DUBA 2WTBA 1TYFA 4JOTA 2ZL4A 4WYOB 5KDRA 2VSUC 2A7SA 3MT6A 4KD6A 1YG6A 2VSSF 4NEKA 4U0GA 3QKAA 1Q52A 4EMMA 3HLN1 5JBWA 3VIVA 4Z0MA 3IBBA 3U9RB 5FIFA 1WDKA 1DUBA 2F9YA 3TVWA 1HNUA 2NP9A 3GF3A 4K3WA 4FZWC 4FN8A 2X58A 2Q34A 2YJGA 3RSIA 4JCSA 1DCIA 2J5GA 4B3IA 1X0UA 5DUCA 4I52A 3QXZA 1K32A 4JCTA 5DTWA 4QIJA 2PG8A 3KQFA 1HZDA 1ON9A 3I47A 3STAA 1OD4A 3ZWAA 4FN7A 3Q1TA 1N6EA 2PBPA 1EF9A 4U0GH 3TT6A 3U9TB 3RSTA 5INGA 2VSSE 3HRXA 1UYSA 3R9SA 4JCRA 1XNYA 1OD2A 3K50A 3WG5A 4ZDFA 2FZSA 3H0JA 4OG1A 5DU8A 3H02A 3ZW8A 3PGQA 1SZOA 2J5II 5DZKA 4GHNA 4JCQA 5FUSA 4Q1IA 4IZCA 1NZYA 4WCZA 3ISAA 3P2LA 3T3WA 4MI2A 4DI1A 3DJAA 2F9IA 2FBMA 4KPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF0 A;  1RJN A;  4ELX A;  1UYV A;  1XX4 A;  1SG4 A;  2IEX A;  4ELS A;  3H0U A;  3GLM A;  3TDC A;  4IZD A;  4B3J A;  1VRG A;  4FND A;  3TZ3 A;  3FF6 A;  4MXI A;  1Q51 A;  3P85 A;  5KDR B;  4GM2 A;  4U19 A;  3TRR A;  4QII A;  5DU6 A;  5E0N X;  3KTK A;  4FJW D;  2DEO A;  3GF7 A;  3OC7 A;  4ZDE A;  1WDM A;  5DZK H;  3MOY A;  3H0Q A;  3K8X A;  4YLH A;  3P5M A;  3SLL A;  3PZK A;  5C9G A;  2PPY A;  4JSB A;  2F9Y B;  4K29 A;  3NJD A;  4RYF A;  5E0S A;  4NNQ A;  3U9S B;  3M6M A;  3QK8 A;  3QXI A;  2Q2X A;  3LKE A;  4EMP A;  1WDL A;  3HE2 A;  3GKB A;  3PEA A;  3Q0J A;  2VRE A;  3TV5 A;  5DU4 A;  1UYR A;  1XNW A;  5KJP A;  1JXZ A;  2VSU A;  4ZDC A;  1N6D A;  5C90 A;  3SWX A;  3QMJ A;  2J5G D;  4KWB A;  5IKL B;  4FB8 A;  2GTR A;  5CTC A;  3T8A A;  4EML A;  1UYT A;  2ZL2 A;  4MOU A;  3H81 A;  1FC6 A;  2UZF A;  3NJB A;  4L6W A;  2ZQR A;  5DUF A;  1ON3 A;  3H0S A;  1HNO A;  3ZW9 A;  4B3H A;  3KTG A;  1FC7 A;  2J5S A;  2J5I B;  2VSU F;  5G1S A;  3PE8 A;  3LAO A;  5E0S H;  4FZW A;  4F47 A;  3MYB A;  4HC8 A;  5JBX A;  3ZWC A;  3TT7 A;  3Q0G A;  2F6I A;  4WZ8 B;  2FW2 A;  1N6F A;  3KTJ A;  2D3T A;  1XO6 A;  3L3S A;  3T8B A;  3R9Q A;  2ZQQ A;  3BPP A;  4JYL A;  3DOR A;  3HIN A;  1W2X A;  1J7X A;  4QFE A;  3R6H A;  2VSS A;  5G1Q A;  3V5I A;  2F9I B;  4G2R A;  3T89 A;  1FCF A;  4RCN A;  4JFC A;  4Q0G A;  1EY3 A;  4OLQ A;  2A81 A;  5INI A;  4I42 A;  5G1R A;  5DTP A;  5CTB A;  4ZDB A;  3TVU A;  2EJ5 A;  3OT6 A;  3ST9 A;  2CE3 A;  1FC9 A;  2QQ3 A;  3IAV A;  2VSU E;  4LK5 A;  1K39 A;  2A7K A;  3T88 A;  4ZU2 A;  4U0H A;  3M6N A;  3MFM A;  4FNB A;  4JWV A;  2ZL3 A;  1PJH A;  3QYR A;  1YG8 A;  2ZL0 A;  3JU1 A;  4U18 A;  1TG6 A;  4L8K A;  2F6Q A;  4HNK A;  1O8U A;  3HP0 A;  4JVT A;  2VX2 A;  2Q35 A;  4OMR A;  2HW5 A;  3ZWB A;  3R9T A;  1UIY A;  4ELW A;  1XNV A;  3GMA A;  1MJ3 A;  1Y7O A;  5DKP A;  1RJM A;  4U1A A;  3KTI A;  4JJT A;  3KTH A;  1EF8 A;  4ZDD A;  5DL1 A;  4RYF H;  3QWD A;  2BZR A;  2J5I A;  2C8T A;  3QRE A;  1PIX A;  3G64 A;  3R0O A;  4K2N A;  3N6R B;  4KNP A;  4I4Z A;  4IZB A;  1NZY B;  3IB9 A;  3V5E A;  3FDU A;  4ASI A;  5MGB A;  4JYJ A;  2W3P A;  3TLF A;  2X24 A;  5INF A;  2CBY A;  3RRV A;  3Q7H A;  1WZ8 A;  3OME A;  3BEZ A;  2DUB A;  2WTB A;  1TYF A;  4JOT A;  2ZL4 A;  4WYO B;  5KDR A;  2VSU C;  2A7S A;  3MT6 A;  4KD6 A;  1YG6 A;  2VSS F;  4NEK A;  4U0G A;  3QKA A;  1Q52 A;  4EMM A;  3HLN 1;  5JBW A;  3VIV A;  4Z0M A;  3IBB A;  3U9R B;  5FIF A;  1WDK A;  1DUB A;  2F9Y A;  3TVW A;  1HNU A;  2NP9 A;  3GF3 A;  4K3W A;  4FZW C;  4FN8 A;  2X58 A;  2Q34 A;  3RSI A;  4JCS A;  1DCI A;  2J5G A;  4B3I A;  1X0U A;  5DUC A;  4I52 A;  3QXZ A;  1K32 A;  4JCT A;  5DTW A;  4QIJ A;  2PG8 A;  3KQF A;  1HZD A;  1ON9 A;  3I47 A;  3STA A;  1OD4 A;  3ZWA A;  4FN7 A;  3Q1T A;  1N6E A;  2PBP A;  1EF9 A;  4U0G H;  3TT6 A;  3U9T B;  3RST A;  5ING A;  2VSS E;  3HRX A;  1UYS A;  3R9S A;  4JCR A;  1XNY A;  1OD2 A;  3K50 A;  3WG5 A;  4ZDF A;  2FZS A;  3H0J A;  4OG1 A;  5DU8 A;  3H02 A;  3ZW8 A;  3PGQ A;  1SZO A;  2J5I I;  5DZK A;  4GHN A;  4JCQ A;  5FUS A;  4Q1I A;  4IZC A;  1NZY A;  4WCZ A;  3ISA A;  3P2L A;  3T3W A;  4MI2 A;  4DI1 A;  3DJA A;  2F9I A;  2FBM A;  4KPK A; 
#chains in the Genus database with same CATH topology
 4HDT A;  3BF0 A;  1RJN A;  4ELX A;  1UYV A;  3ADB A;  1XX4 A;  1SG4 A;  2IEX A;  4ELS A;  3H0U A;  3GLM A;  3TDC A;  4IZD A;  4B3J A;  3IRB A;  1VRG A;  4FND A;  3TZ3 A;  3FF6 A;  4MXI A;  1Q51 A;  4NAR A;  3P85 A;  5KDR B;  4GM2 A;  4U19 A;  3TRR A;  4QII A;  5DU6 A;  5E0N X;  3KTK A;  4GEH B;  4FJW D;  2DEO A;  3GF7 A;  3OC7 A;  4ZDE A;  1WDM A;  5DZK H;  3MOY A;  3H0Q A;  3K8X A;  4YLH A;  3P5M A;  3SLL A;  3PZK A;  5C9G A;  2PPY A;  3RQF A;  4JSB A;  5HUQ A;  2F9Y B;  4K29 A;  3NJD A;  4RYF A;  5E0S A;  4NNQ A;  3U9S B;  3M6M A;  3QK8 A;  3QXI A;  2Q2X A;  3LKE A;  4EMP A;  1WDL A;  3HE2 A;  4J2U A;  3GKB A;  3PEA A;  3Q0J A;  2VRE A;  3TV5 A;  5DU4 A;  1UYR A;  1XNW A;  5KJP A;  1JXZ A;  2VSU A;  1UX4 A;  4ZDC A;  3L8I A;  1N6D A;  5C90 A;  3SWX A;  3QMJ A;  2J5G D;  4KWB A;  5IKL B;  4FB8 A;  2GTR A;  1UX5 A;  5CTC A;  3T8A A;  4EML A;  1UYT A;  2ZL2 A;  4MOU A;  3H81 A;  1FC6 A;  2UZF A;  3NJB A;  4L6W A;  2ZQR A;  5DUF A;  1ON3 A;  3H0S A;  1HNO A;  3ZW9 A;  4B3H A;  1Y64 B;  3KTG A;  1FC7 A;  2J5S A;  2J5I B;  2VSU F;  3L8J A;  5G1S A;  3PE8 A;  3LAO A;  5E0S H;  4FZW A;  4F47 A;  3W8I B;  3MYB A;  4HC8 A;  5JBX A;  3ZWC A;  3TT7 A;  3Q0G A;  2F6I A;  4WZ8 B;  2FW2 A;  1N6F A;  3KTJ A;  2D3T A;  1XO6 A;  3L3S A;  3T8B A;  3R9Q A;  2ZQQ A;  3BPP A;  4JYL A;  3DOR A;  3HIN A;  1W2X A;  1J7X A;  4QFE A;  3R6H A;  2VSS A;  5G1Q A;  3V5I A;  2F9I B;  4G2R A;  3T89 A;  1FCF A;  4RCN A;  4JFC A;  4Q0G A;  1EY3 A;  4OLQ A;  2A81 A;  5INI A;  4I42 A;  5G1R A;  5DTP A;  5CTB A;  4ZDB A;  3TVU A;  2EJ5 A;  3OT6 A;  3ST9 A;  2CE3 A;  1FC9 A;  2QQ3 A;  3IAV A;  2VSU E;  3AM1 A;  4LK5 A;  1K39 A;  2A7K A;  3T88 A;  4ZU2 A;  4U0H A;  3RQE A;  3M6N A;  3MFM A;  4FNB A;  4JWV A;  2ZL3 A;  1PJH A;  3QYR A;  1YG8 A;  2ZL0 A;  3JU1 A;  4U18 A;  1TG6 A;  4L8K A;  2F6Q A;  4HNK A;  1O8U A;  3HP0 A;  4JVT A;  2VX2 A;  2Q35 A;  4OMR A;  2HW5 A;  3ZWB A;  3R9T A;  1UIY A;  4ELW A;  1XNV A;  3GMA A;  1MJ3 A;  1Y7O A;  3ADD A;  5DKP A;  1RJM A;  4U1A A;  3BPT A;  3KTI A;  4JJT A;  3KTH A;  1EF8 A;  4ZDD A;  5DL1 A;  4RYF H;  3QWD A;  2BZR A;  2J5I A;  2C8T A;  3QRE A;  1PIX A;  3G64 A;  3R0O A;  4K2N A;  3N6R B;  4KNP A;  4I4Z A;  4IZB A;  1NZY B;  3IB9 A;  3V5E A;  3FDU A;  4ASI A;  5MGB A;  4JYJ A;  2W3P A;  3TLF A;  2X24 A;  5INF A;  2CBY A;  3RRV A;  3Q7H A;  1WZ8 A;  3OME A;  3BEZ A;  2DUB A;  2WTB A;  1TYF A;  3A4L A;  4JOT A;  2ZL4 A;  4WYO B;  5KDR A;  2VSU C;  2A7S A;  3W8H B;  3MT6 A;  4KD6 A;  1YG6 A;  2VSS F;  4NEK A;  4U0G A;  3QKA A;  1Q52 A;  4EMM A;  3HLN 1;  5JBW A;  3VIV A;  4Z0M A;  3IBB A;  3U9R B;  5FIF A;  1WDK A;  1DUB A;  2F9Y A;  3TVW A;  1HNU A;  2NP9 A;  3GF3 A;  4K3W A;  4FZW C;  4FN8 A;  2X58 A;  2P63 A;  2Q34 A;  2YJG A;  3RSI A;  4JCS A;  1DCI A;  2J5G A;  4B3I A;  1X0U A;  5DUC A;  4I52 A;  3QXZ A;  1K32 A;  4JCT A;  5DTW A;  4QIJ A;  2PG8 A;  3KQF A;  3ADC A;  1HZD A;  3RQG A;  1ON9 A;  3I47 A;  3STA A;  1OD4 A;  3ZWA A;  3A4N A;  4FN7 A;  3Q1T A;  1N6E A;  2PBP A;  1EF9 A;  4U0G H;  3TT6 A;  3U9T B;  3RST A;  5ING A;  2VSS E;  3HRX A;  1UYS A;  3R9S A;  4JCR A;  1XNY A;  1OD2 A;  3K50 A;  3WG5 A;  4ZDF A;  2FZS A;  3H0J A;  4OG1 A;  5DU8 A;  3H02 A;  3A4M A;  3ZW8 A;  3PGQ A;  1SZO A;  3AJM A;  2J5I I;  5DZK A;  4GHN A;  4JCQ A;  5FUS A;  4Q1I A;  4IZC A;  1NZY A;  4WCZ A;  3ISA A;  3P2L A;  3T3W A;  4MI2 A;  4DI1 A;  3O4X E;  3DJA A;  2F9I A;  2FBM A;  4KPK A; 
#chains in the Genus database with same CATH homology
 4HDT A;  3BF0 A;  1RJN A;  4ELX A;  1UYV A;  1XX4 A;  1SG4 A;  2IEX A;  4ELS A;  3H0U A;  3GLM A;  3TDC A;  4IZD A;  4B3J A;  1VRG A;  4FND A;  3TZ3 A;  3FF6 A;  4MXI A;  1Q51 A;  4NAR A;  3P85 A;  5KDR B;  4GM2 A;  4U19 A;  3TRR A;  4QII A;  5DU6 A;  5E0N X;  3KTK A;  4FJW D;  2DEO A;  3GF7 A;  3OC7 A;  4ZDE A;  1WDM A;  5DZK H;  3MOY A;  3H0Q A;  3K8X A;  4YLH A;  3P5M A;  3SLL A;  3PZK A;  5C9G A;  2PPY A;  4JSB A;  5HUQ A;  2F9Y B;  4K29 A;  3NJD A;  4RYF A;  5E0S A;  4NNQ A;  3U9S B;  3M6M A;  3QK8 A;  3QXI A;  2Q2X A;  3LKE A;  4EMP A;  1WDL A;  3HE2 A;  4J2U A;  3GKB A;  3PEA A;  3Q0J A;  2VRE A;  3TV5 A;  5DU4 A;  1UYR A;  1XNW A;  5KJP A;  1JXZ A;  2VSU A;  4ZDC A;  1N6D A;  5C90 A;  3SWX A;  3QMJ A;  2J5G D;  4KWB A;  5IKL B;  4FB8 A;  2GTR A;  5CTC A;  3T8A A;  4EML A;  1UYT A;  2ZL2 A;  4MOU A;  3H81 A;  1FC6 A;  2UZF A;  3NJB A;  4L6W A;  2ZQR A;  5DUF A;  1ON3 A;  3H0S A;  1HNO A;  3ZW9 A;  4B3H A;  3KTG A;  1FC7 A;  2J5S A;  2J5I B;  2VSU F;  5G1S A;  3PE8 A;  3LAO A;  5E0S H;  4FZW A;  4F47 A;  3MYB A;  4HC8 A;  5JBX A;  3ZWC A;  3TT7 A;  3Q0G A;  2F6I A;  4WZ8 B;  2FW2 A;  1N6F A;  3KTJ A;  2D3T A;  1XO6 A;  3L3S A;  3T8B A;  3R9Q A;  2ZQQ A;  3BPP A;  4JYL A;  3DOR A;  3HIN A;  1W2X A;  1J7X A;  4QFE A;  3R6H A;  2VSS A;  5G1Q A;  3V5I A;  2F9I B;  4G2R A;  3T89 A;  1FCF A;  4RCN A;  4JFC A;  4Q0G A;  1EY3 A;  4OLQ A;  2A81 A;  5INI A;  4I42 A;  5G1R A;  5DTP A;  5CTB A;  4ZDB A;  3TVU A;  2EJ5 A;  3OT6 A;  3ST9 A;  2CE3 A;  1FC9 A;  2QQ3 A;  3IAV A;  2VSU E;  4LK5 A;  1K39 A;  2A7K A;  3T88 A;  4ZU2 A;  4U0H A;  3M6N A;  3MFM A;  4FNB A;  4JWV A;  2ZL3 A;  1PJH A;  3QYR A;  1YG8 A;  2ZL0 A;  3JU1 A;  4U18 A;  1TG6 A;  4L8K A;  2F6Q A;  4HNK A;  1O8U A;  3HP0 A;  4JVT A;  2VX2 A;  2Q35 A;  4OMR A;  2HW5 A;  3ZWB A;  3R9T A;  1UIY A;  4ELW A;  1XNV A;  3GMA A;  1MJ3 A;  1Y7O A;  5DKP A;  1RJM A;  4U1A A;  3BPT A;  3KTI A;  4JJT A;  3KTH A;  1EF8 A;  4ZDD A;  5DL1 A;  4RYF H;  3QWD A;  2BZR A;  2J5I A;  2C8T A;  3QRE A;  1PIX A;  3G64 A;  3R0O A;  4K2N A;  3N6R B;  4KNP A;  4I4Z A;  4IZB A;  1NZY B;  3IB9 A;  3V5E A;  3FDU A;  4ASI A;  5MGB A;  4JYJ A;  2W3P A;  3TLF A;  2X24 A;  5INF A;  2CBY A;  3RRV A;  3Q7H A;  1WZ8 A;  3OME A;  3BEZ A;  2DUB A;  2WTB A;  1TYF A;  4JOT A;  2ZL4 A;  4WYO B;  5KDR A;  2VSU C;  2A7S A;  3MT6 A;  4KD6 A;  1YG6 A;  2VSS F;  4NEK A;  4U0G A;  3QKA A;  1Q52 A;  4EMM A;  3HLN 1;  5JBW A;  3VIV A;  4Z0M A;  3IBB A;  3U9R B;  5FIF A;  1WDK A;  1DUB A;  2F9Y A;  3TVW A;  1HNU A;  2NP9 A;  3GF3 A;  4K3W A;  4FZW C;  4FN8 A;  2X58 A;  2Q34 A;  2YJG A;  3RSI A;  4JCS A;  1DCI A;  2J5G A;  4B3I A;  1X0U A;  5DUC A;  4I52 A;  3QXZ A;  1K32 A;  4JCT A;  5DTW A;  4QIJ A;  2PG8 A;  3KQF A;  1HZD A;  1ON9 A;  3I47 A;  3STA A;  1OD4 A;  3ZWA A;  4FN7 A;  3Q1T A;  1N6E A;  2PBP A;  1EF9 A;  4U0G H;  3TT6 A;  3U9T B;  3RST A;  5ING A;  2VSS E;  3HRX A;  1UYS A;  3R9S A;  4JCR A;  1XNY A;  1OD2 A;  3K50 A;  3WG5 A;  4ZDF A;  2FZS A;  3H0J A;  4OG1 A;  5DU8 A;  3H02 A;  3ZW8 A;  3PGQ A;  1SZO A;  2J5I I;  5DZK A;  4GHN A;  4JCQ A;  5FUS A;  4Q1I A;  4IZC A;  1NZY A;  4WCZ A;  3ISA A;  3P2L A;  3T3W A;  4MI2 A;  4DI1 A;  3DJA A;  2F9I A;  2FBM A;  4KPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...