1DCIA

Dienoyl-coa isomerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
AYESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSITFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIENOYL-COA ISOMERASE
publication title The crystal structure of dienoyl-CoA isomerase at 1.5 A resolution reveals the importance of aspartate and glutamate sidechains for catalysis.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
total genus 106
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1998-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1dciA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1dciA01
3NJDA 1HZDA 4FZWA 3IBBA 2F6QA 4RYFH 4RYFA 3MOYA 1XX4A 4MXIA 1YG6A 2FBMA 3PEAA 3OT6A 2X58A 4JJTA 3TT7A 1UYVA 1OD2A 4ZDEA 3U9RB 4B3IA 5IKLB 1FC9A 2ZL4A 5FIFA 4OG1A 3P2LA 1J7XA 3RSTA 4U0GA 4Z0MA 3K8XA 4ZDCA 2PBPA 3ZW8A 5JBXA 3FF6A 1EF9A 1FC6A 5DU8A 3TZ3A 4U0HA 5DL1A 4IZBA 4Q0GA 2C8TA 3MT6A 1XO6A 3H0JA 3IAVA 3KTJA 5MGBA 1PJHA 4GHNA 2ZL0A 3HINA 3ZW9A 3I47A 4JYJA 4KNPA 4JSBA 3KTIA 3R0OA 5C90A 1RJMA 2DUBA 3GLMA 3Q7HA 5G1RA 1TYFA 1UYRA 3WG5A 4JCSA 3VIVA 4ZU2A 2PG8A 4U1AA 3TVUA 3MYBA 3TLFA 2DEOA 4WCZA 3SLLA 3R9QA 3GKBA 2FZSA 3Q0JA 5DZKH 3IB9A 4MOUA 1EF8A 1WZ8A 3BF0A 3BEZA 3ST9A 4KPKA 3KQFA 4LK5A 3QYRA 3RSIA 3BPPA 3V5EA 1HNUA 5E0SA 1N6FA 4WYOB 4MI2A 2D3TA 1DUBA 2IEXA 1K32A 4U18A 4QIIA 2NP9A 4KD6A 5CTCA 4KWBA 2J5GA 3T3WA 4F47A 1EY3A 3T8BA 3KTHA 4I4ZA 3Q1TA 4ZDDA 2PPYA 4FN7A 3TRRA 3FDUA 3M6NA 2J5SA 1NZYA 3DJAA 2ZQRA 4QFEA 4JVTA 4IZDA 1N6EA 4JOTA 1RJNA 2J5IA 1WDMA 1Y7OA 3RRVA 4JYLA 2VSUA 5KDRA 1JXZA 3H02A 3JU1A 4HC8A 1W2XA 4FJWD 4ELWA 3GMAA 2A81A 3T88A 2Q35A 5E0NX 1ON9A 5FUSA 4FZWC 1HNOA 2F9IB 4I42A 3QXZA 5DU4A 5DTWA 3R6HA 3OC7A 2A7KA 2QQ3A 3STAA 3R9SA 2UZFA 1MJ3A 2HW5A 4ELXA 3U9TB 4IZCA 4K29A 4ZDBA 4K3WA 5KJPA 4GM2A 5INFA 3TT6A 1N6DA 4RCNA 3R9TA 3GF3A 4HNKA 4NEKA 5INGA 3H81A 3HLN1 2GTRA 4JWVA 3ZWAA 4K2NA 4FNDA 2X24A 2F6IA 5C9GA 2VX2A 5DZKA 4OLQA 2VSUF 2W3PA 2F9YB 3QWDA 4ELSA 1PIXA 3LAOA 3ISAA 1X0UA 4Q1IA 4ZDFA 3M6MA 3HRXA 4NNQA 3PZKA 5DU6A 3H0SA 3KTKA 5DUCA 2Q34A 5DTPA 3ZWBA 5G1QA 2EJ5A 3P5MA 1FCFA 1VRGA 3L3SA 4WZ8B 4YLHA 1UYSA 3QREA 2ZL3A 3PE8A 4G2RA 1WDLA 3DORA 2CBYA 3QK8A 3T8AA 1UYTA 4OMRA 3SWXA 2J5II 5JBWA 2VSUE 4EMLA 2F9IA 1YG8A 5INIA 1Q52A 3OMEA 1Q51A 3NJBA 4U19A 3QXIA 1K39A 3PGQA 4B3HA 4U0GH 3TVWA 2VREA 3HE2A 3TV5A 2A7SA 4JFCA 3ZWCA 3QMJA 2VSSF 4QIJA 3T89A 1UIYA 4ASIA 1XNYA 2Q2XA 4FN8A 3H0UA 2ZQQA 1NZYB 4L6WA 5G1SA 3G64A 1WDKA 5DUFA 2BZRA 4EMMA 3MFMA 3QKAA 3P85A 3K50A 2J5IB 2J5GD 4JCRA 3V5IA 2F9YA 2ZL2A 3U9SB 3H0QA 4B3JA 4EMPA 5KDRB 1DCIA 1O8UA 1XNWA 4DI1A 4JCQA 3N6RB 1TG6A 1SZOA 4I52A 3LKEA 4JCTA 4L8KA 2VSUC 3HP0A 3KTGA 3TDCA 4FNBA 1XNVA 3Q0GA 2VSSE 4FB8A 2FW2A 3GF7A 2CE3A 5CTBA 5DKPA 2VSSA 1FC7A 2WTBA 1SG4A 1ON3A 1OD4A 5E0SH
chains in the Genus database with same CATH superfamily
3NJDA 1HZDA 4FZWA 3IBBA 2F6QA 4RYFH 4RYFA 3MOYA 1XX4A 4MXIA 1YG6A 2FBMA 3PEAA 3OT6A 2X58A 4JJTA 3TT7A 1UYVA 1OD2A 4ZDEA 3U9RB 4B3IA 5IKLB 1FC9A 2ZL4A 5FIFA 4OG1A 3P2LA 1J7XA 3RSTA 4U0GA 4Z0MA 3K8XA 4ZDCA 2PBPA 3ZW8A 5JBXA 3FF6A 1EF9A 1FC6A 5DU8A 3TZ3A 4U0HA 5DL1A 4IZBA 4Q0GA 2C8TA 3MT6A 1XO6A 3H0JA 3IAVA 3KTJA 5MGBA 1PJHA 4GHNA 2ZL0A 3HINA 3ZW9A 3I47A 4JYJA 4KNPA 4JSBA 3L8JA 3KTIA 3R0OA 5C90A 1RJMA 2DUBA 4NARA 3GLMA 3Q7HA 5G1RA 1TYFA 1UYRA 3WG5A 4JCSA 3VIVA 4ZU2A 2PG8A 4U1AA 3TVUA 3MYBA 3TLFA 2DEOA 4WCZA 3SLLA 3R9QA 3RQEA 4GEHB 3GKBA 2FZSA 3Q0JA 5DZKH 3IB9A 4MOUA 2P63A 1EF8A 1WZ8A 3BF0A 3BEZA 3ST9A 4KPKA 3KQFA 4LK5A 3QYRA 3A4NA 3RSIA 3BPPA 3V5EA 1HNUA 5E0SA 1N6FA 4WYOB 4MI2A 2D3TA 1DUBA 2IEXA 1K32A 4U18A 4QIIA 2NP9A 4KD6A 5CTCA 4KWBA 2J5GA 3T3WA 4F47A 1EY3A 3T8BA 3KTHA 4I4ZA 3Q1TA 4ZDDA 2PPYA 4FN7A 3TRRA 3FDUA 3M6NA 2J5SA 1NZYA 3DJAA 2ZQRA 4QFEA 4JVTA 4IZDA 3RQGA 1N6EA 4JOTA 1RJNA 2J5IA 1WDMA 3BPTA 1Y7OA 3RRVA 3W8HB 4JYLA 2VSUA 5KDRA 1JXZA 3H02A 3JU1A 4HC8A 1Y64B 1W2XA 4FJWD 4ELWA 3GMAA 2A81A 3T88A 2Q35A 5E0NX 1ON9A 5FUSA 4FZWC 1HNOA 2F9IB 4I42A 3QXZA 3IRBA 5DU4A 5DTWA 3R6HA 3OC7A 2A7KA 2QQ3A 3STAA 3R9SA 2UZFA 1MJ3A 2HW5A 4ELXA 3U9TB 4IZCA 4K29A 4ZDBA 4K3WA 5KJPA 4GM2A 5INFA 3TT6A 1N6DA 4RCNA 3R9TA 3GF3A 4HNKA 4NEKA 5INGA 3L8IA 3H81A 3HLN1 2GTRA 4JWVA 3ZWAA 4K2NA 3ADDA 4FNDA 2X24A 3AJMA 2F6IA 5C9GA 3O4XE 2VX2A 5DZKA 4OLQA 2VSUF 2W3PA 2F9YB 4ELSA 1PIXA 3LAOA 3ISAA 1X0UA 4Q1IA 4ZDFA 3M6MA 3AM1A 3HRXA 4NNQA 2YJGA 3PZKA 5DU6A 3H0SA 3KTKA 5DUCA 2Q34A 5DTPA 3ZWBA 3W8IB 5G1QA 2EJ5A 3P5MA 1FCFA 1VRGA 3L3SA 4WZ8B 4YLHA 1UYSA 3QREA 2ZL3A 3PE8A 4G2RA 1WDLA 4J2UA 3DORA 2CBYA 3QK8A 3ADCA 3T8AA 1UYTA 4OMRA 3A4MA 3SWXA 2J5II 5JBWA 2VSUE 4EMLA 2F9IA 1YG8A 5INIA 1Q52A 3OMEA 1Q51A 3NJBA 4U19A 3QXIA 1K39A 3PGQA 4B3HA 4U0GH 3TVWA 2VREA 3HE2A 3TV5A 2A7SA 4JFCA 3ZWCA 3QMJA 2VSSF 4QIJA 3T89A 1UIYA 4ASIA 1XNYA 2Q2XA 4FN8A 3H0UA 2ZQQA 1NZYB 3A4LA 4HDTA 4L6WA 5G1SA 3G64A 1WDKA 5DUFA 2BZRA 4EMMA 3MFMA 5HUQA 3QKAA 3P85A 3K50A 2J5IB 2J5GD 4JCRA 3V5IA 2F9YA 2ZL2A 3U9SB 3H0QA 4B3JA 4EMPA 5KDRB 3RQFA 1DCIA 1UX5A 1O8UA 1XNWA 4DI1A 4JCQA 3N6RB 1TG6A 1SZOA 4I52A 3LKEA 4JCTA 4L8KA 2VSUC 3HP0A 3KTGA 5E0SH 3TDCA 4FNBA 1XNVA 3Q0GA 2VSSE 4FB8A 2FW2A 3GF7A 1UX4A 2CE3A 5CTBA 5DKPA 2VSSA 1FC7A 2WTBA 1SG4A 1ON3A 1OD4A 3ADBA 3QWDA
chains in the Genus database with same CATH topology
3NJDA 1HZDA 4FZWA 3IBBA 2F6QA 4RYFH 4RYFA 3MOYA 1XX4A 4MXIA 1YG6A 2FBMA 3PEAA 3OT6A 2X58A 4JJTA 3TT7A 1UYVA 1OD2A 4ZDEA 3U9RB 4B3IA 5IKLB 1FC9A 2ZL4A 5FIFA 4OG1A 3P2LA 1J7XA 3RSTA 4U0GA 4Z0MA 3K8XA 4ZDCA 2PBPA 3ZW8A 5JBXA 3FF6A 1EF9A 1FC6A 5DU8A 3TZ3A 4U0HA 5DL1A 4IZBA 4Q0GA 2C8TA 3MT6A 1XO6A 3H0JA 3IAVA 3KTJA 5MGBA 1PJHA 4GHNA 2ZL0A 3HINA 3ZW9A 3I47A 4JYJA 4KNPA 4JSBA 3KTIA 3R0OA 5C90A 1RJMA 2DUBA 4NARA 3GLMA 3Q7HA 5G1RA 1TYFA 1UYRA 3WG5A 4JCSA 3VIVA 4ZU2A 2PG8A 4U1AA 3TVUA 3MYBA 3TLFA 2DEOA 4WCZA 3SLLA 3R9QA 3GKBA 2FZSA 3Q0JA 5DZKH 3IB9A 4MOUA 1EF8A 1WZ8A 3BF0A 3BEZA 3ST9A 4KPKA 3KQFA 4LK5A 3QYRA 3RSIA 3BPPA 3V5EA 1HNUA 5E0SA 1N6FA 4WYOB 4MI2A 2D3TA 1DUBA 2IEXA 1K32A 4U18A 4QIIA 2NP9A 4KD6A 5CTCA 4KWBA 2J5GA 3T3WA 4F47A 1EY3A 3T8BA 3KTHA 4I4ZA 3Q1TA 4ZDDA 2PPYA 4FN7A 3TRRA 3FDUA 3M6NA 2J5SA 1NZYA 3DJAA 2ZQRA 4QFEA 4JVTA 4IZDA 1N6EA 4JOTA 1RJNA 2J5IA 1WDMA 3BPTA 1Y7OA 3RRVA 4JYLA 2VSUA 5KDRA 1JXZA 3H02A 3JU1A 4HC8A 1W2XA 4FJWD 4ELWA 3GMAA 2A81A 3T88A 2Q35A 5E0NX 1ON9A 5FUSA 4FZWC 1HNOA 2F9IB 4I42A 3QXZA 5DU4A 5DTWA 3R6HA 3OC7A 2A7KA 2QQ3A 3STAA 3R9SA 2UZFA 1MJ3A 2HW5A 4ELXA 3U9TB 4IZCA 4K29A 4ZDBA 4K3WA 5KJPA 4GM2A 5INFA 3TT6A 1N6DA 4RCNA 3R9TA 3GF3A 4HNKA 4NEKA 5INGA 3H81A 3HLN1 2GTRA 4JWVA 3ZWAA 4K2NA 4FNDA 2X24A 2F6IA 5C9GA 2VX2A 5DZKA 4OLQA 2VSUF 2W3PA 2F9YB 3QWDA 4ELSA 1PIXA 3LAOA 3ISAA 1X0UA 4Q1IA 4ZDFA 3M6MA 3HRXA 4NNQA 2YJGA 3PZKA 5DU6A 3H0SA 3KTKA 5DUCA 2Q34A 5DTPA 3ZWBA 5G1QA 2EJ5A 3P5MA 1FCFA 1VRGA 3L3SA 4WZ8B 4YLHA 1UYSA 3QREA 2ZL3A 3PE8A 4G2RA 1WDLA 4J2UA 3DORA 2CBYA 3QK8A 3T8AA 1UYTA 4OMRA 3SWXA 2J5II 5JBWA 2VSUE 4EMLA 2F9IA 1YG8A 5INIA 1Q52A 3OMEA 1Q51A 3NJBA 4U19A 3QXIA 1K39A 3PGQA 4B3HA 4U0GH 3TVWA 2VREA 3HE2A 3TV5A 2A7SA 4JFCA 3ZWCA 3QMJA 2VSSF 4QIJA 3T89A 1UIYA 4ASIA 1XNYA 2Q2XA 4FN8A 3H0UA 2ZQQA 1NZYB 4HDTA 4L6WA 5G1SA 3G64A 1WDKA 5DUFA 2BZRA 4EMMA 3MFMA 5HUQA 3QKAA 3P85A 3K50A 2J5IB 2J5GD 4JCRA 3V5IA 2F9YA 2ZL2A 3U9SB 3H0QA 4B3JA 4EMPA 5KDRB 1DCIA 1O8UA 1XNWA 4DI1A 4JCQA 3N6RB 1TG6A 1SZOA 4I52A 3LKEA 4JCTA 4L8KA 2VSUC 3HP0A 3KTGA 3TDCA 4FNBA 1XNVA 3Q0GA 2VSSE 4FB8A 2FW2A 3GF7A 2CE3A 5CTBA 5DKPA 2VSSA 1FC7A 2WTBA 1SG4A 1ON3A 1OD4A 5E0SH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NJD A;  1HZD A;  4FZW A;  3IBB A;  2F6Q A;  4RYF H;  4RYF A;  3MOY A;  1XX4 A;  4MXI A;  1YG6 A;  2FBM A;  3PEA A;  3OT6 A;  2X58 A;  4JJT A;  3TT7 A;  1UYV A;  1OD2 A;  4ZDE A;  3U9R B;  4B3I A;  5IKL B;  1FC9 A;  2ZL4 A;  5FIF A;  4OG1 A;  3P2L A;  1J7X A;  3RST A;  4U0G A;  4Z0M A;  3K8X A;  4ZDC A;  2PBP A;  3ZW8 A;  5JBX A;  3FF6 A;  1EF9 A;  1FC6 A;  5DU8 A;  3TZ3 A;  4U0H A;  5DL1 A;  4IZB A;  4Q0G A;  2C8T A;  3MT6 A;  1XO6 A;  3H0J A;  3IAV A;  3KTJ A;  5MGB A;  1PJH A;  4GHN A;  2ZL0 A;  3HIN A;  3ZW9 A;  3I47 A;  4JYJ A;  4KNP A;  4JSB A;  3KTI A;  3R0O A;  5C90 A;  1RJM A;  2DUB A;  3GLM A;  3Q7H A;  5G1R A;  1TYF A;  1UYR A;  3WG5 A;  4JCS A;  3VIV A;  4ZU2 A;  2PG8 A;  4U1A A;  3TVU A;  3MYB A;  3TLF A;  2DEO A;  4WCZ A;  3SLL A;  3R9Q A;  3GKB A;  2FZS A;  3Q0J A;  5DZK H;  3IB9 A;  4MOU A;  1EF8 A;  1WZ8 A;  3BF0 A;  3BEZ A;  3ST9 A;  4KPK A;  3KQF A;  4LK5 A;  3QYR A;  3RSI A;  3BPP A;  3V5E A;  1HNU A;  5E0S A;  1N6F A;  4WYO B;  4MI2 A;  2D3T A;  1DUB A;  2IEX A;  1K32 A;  4U18 A;  4QII A;  2NP9 A;  4KD6 A;  5CTC A;  4KWB A;  2J5G A;  3T3W A;  4F47 A;  1EY3 A;  3T8B A;  3KTH A;  4I4Z A;  3Q1T A;  4ZDD A;  2PPY A;  4FN7 A;  3TRR A;  3FDU A;  3M6N A;  2J5S A;  1NZY A;  3DJA A;  2ZQR A;  4QFE A;  4JVT A;  4IZD A;  1N6E A;  4JOT A;  1RJN A;  2J5I A;  1WDM A;  1Y7O A;  3RRV A;  4JYL A;  2VSU A;  5KDR A;  1JXZ A;  3H02 A;  3JU1 A;  4HC8 A;  1W2X A;  4FJW D;  4ELW A;  3GMA A;  2A81 A;  3T88 A;  2Q35 A;  5E0N X;  1ON9 A;  5FUS A;  4FZW C;  1HNO A;  2F9I B;  4I42 A;  3QXZ A;  5DU4 A;  5DTW A;  3R6H A;  3OC7 A;  2A7K A;  2QQ3 A;  3STA A;  3R9S A;  2UZF A;  1MJ3 A;  2HW5 A;  4ELX A;  3U9T B;  4IZC A;  4K29 A;  4ZDB A;  4K3W A;  5KJP A;  4GM2 A;  5INF A;  3TT6 A;  1N6D A;  4RCN A;  3R9T A;  3GF3 A;  4HNK A;  4NEK A;  5ING A;  3H81 A;  3HLN 1;  2GTR A;  4JWV A;  3ZWA A;  4K2N A;  4FND A;  2X24 A;  2F6I A;  5C9G A;  2VX2 A;  5DZK A;  4OLQ A;  2VSU F;  2W3P A;  2F9Y B;  3QWD A;  4ELS A;  1PIX A;  3LAO A;  3ISA A;  1X0U A;  4Q1I A;  4ZDF A;  3M6M A;  3HRX A;  4NNQ A;  3PZK A;  5DU6 A;  3H0S A;  3KTK A;  5DUC A;  2Q34 A;  5DTP A;  3ZWB A;  5G1Q A;  2EJ5 A;  3P5M A;  1FCF A;  1VRG A;  3L3S A;  4WZ8 B;  4YLH A;  1UYS A;  3QRE A;  2ZL3 A;  3PE8 A;  4G2R A;  1WDL A;  3DOR A;  2CBY A;  3QK8 A;  3T8A A;  1UYT A;  4OMR A;  3SWX A;  2J5I I;  5JBW A;  2VSU E;  4EML A;  2F9I A;  1YG8 A;  5INI A;  1Q52 A;  3OME A;  1Q51 A;  3NJB A;  4U19 A;  3QXI A;  1K39 A;  3PGQ A;  4B3H A;  4U0G H;  3TVW A;  2VRE A;  3HE2 A;  3TV5 A;  2A7S A;  4JFC A;  3ZWC A;  3QMJ A;  2VSS F;  4QIJ A;  3T89 A;  1UIY A;  4ASI A;  1XNY A;  2Q2X A;  4FN8 A;  3H0U A;  2ZQQ A;  1NZY B;  4L6W A;  5G1S A;  3G64 A;  1WDK A;  5DUF A;  2BZR A;  4EMM A;  3MFM A;  3QKA A;  3P85 A;  3K50 A;  2J5I B;  2J5G D;  4JCR A;  3V5I A;  2F9Y A;  2ZL2 A;  3U9S B;  3H0Q A;  4B3J A;  4EMP A;  5KDR B;  1DCI A;  1O8U A;  1XNW A;  4DI1 A;  4JCQ A;  3N6R B;  1TG6 A;  1SZO A;  4I52 A;  3LKE A;  4JCT A;  4L8K A;  2VSU C;  3HP0 A;  3KTG A;  3TDC A;  4FNB A;  1XNV A;  3Q0G A;  2VSS E;  4FB8 A;  2FW2 A;  3GF7 A;  2CE3 A;  5CTB A;  5DKP A;  2VSS A;  1FC7 A;  2WTB A;  1SG4 A;  1ON3 A;  1OD4 A;  5E0S H; 
#chains in the Genus database with same CATH topology
 3NJD A;  1HZD A;  4FZW A;  3IBB A;  2F6Q A;  4RYF H;  4RYF A;  3MOY A;  1XX4 A;  4MXI A;  1YG6 A;  2FBM A;  3PEA A;  3OT6 A;  2X58 A;  4JJT A;  3TT7 A;  1UYV A;  1OD2 A;  4ZDE A;  3U9R B;  4B3I A;  5IKL B;  1FC9 A;  2ZL4 A;  5FIF A;  4OG1 A;  3P2L A;  1J7X A;  3RST A;  4U0G A;  4Z0M A;  3K8X A;  4ZDC A;  2PBP A;  3ZW8 A;  5JBX A;  3FF6 A;  1EF9 A;  1FC6 A;  5DU8 A;  3TZ3 A;  4U0H A;  5DL1 A;  4IZB A;  4Q0G A;  2C8T A;  3MT6 A;  1XO6 A;  3H0J A;  3IAV A;  3KTJ A;  5MGB A;  1PJH A;  4GHN A;  2ZL0 A;  3HIN A;  3ZW9 A;  3I47 A;  4JYJ A;  4KNP A;  4JSB A;  3L8J A;  3KTI A;  3R0O A;  5C90 A;  1RJM A;  2DUB A;  4NAR A;  3GLM A;  3Q7H A;  5G1R A;  1TYF A;  1UYR A;  3WG5 A;  4JCS A;  3VIV A;  4ZU2 A;  2PG8 A;  4U1A A;  3TVU A;  3MYB A;  3TLF A;  2DEO A;  4WCZ A;  3SLL A;  3R9Q A;  3RQE A;  4GEH B;  3GKB A;  2FZS A;  3Q0J A;  5DZK H;  3IB9 A;  4MOU A;  2P63 A;  1EF8 A;  1WZ8 A;  3BF0 A;  3BEZ A;  3ST9 A;  4KPK A;  3KQF A;  4LK5 A;  3QYR A;  3A4N A;  3RSI A;  3BPP A;  3V5E A;  1HNU A;  5E0S A;  1N6F A;  4WYO B;  4MI2 A;  2D3T A;  1DUB A;  2IEX A;  1K32 A;  4U18 A;  4QII A;  2NP9 A;  4KD6 A;  5CTC A;  4KWB A;  2J5G A;  3T3W A;  4F47 A;  1EY3 A;  3T8B A;  3KTH A;  4I4Z A;  3Q1T A;  4ZDD A;  2PPY A;  4FN7 A;  3TRR A;  3FDU A;  3M6N A;  2J5S A;  1NZY A;  3DJA A;  2ZQR A;  4QFE A;  4JVT A;  4IZD A;  3RQG A;  1N6E A;  4JOT A;  1RJN A;  2J5I A;  1WDM A;  3BPT A;  1Y7O A;  3RRV A;  3W8H B;  4JYL A;  2VSU A;  5KDR A;  1JXZ A;  3H02 A;  3JU1 A;  4HC8 A;  1Y64 B;  1W2X A;  4FJW D;  4ELW A;  3GMA A;  2A81 A;  3T88 A;  2Q35 A;  5E0N X;  1ON9 A;  5FUS A;  4FZW C;  1HNO A;  2F9I B;  4I42 A;  3QXZ A;  3IRB A;  5DU4 A;  5DTW A;  3R6H A;  3OC7 A;  2A7K A;  2QQ3 A;  3STA A;  3R9S A;  2UZF A;  1MJ3 A;  2HW5 A;  4ELX A;  3U9T B;  4IZC A;  4K29 A;  4ZDB A;  4K3W A;  5KJP A;  4GM2 A;  5INF A;  3TT6 A;  1N6D A;  4RCN A;  3R9T A;  3GF3 A;  4HNK A;  4NEK A;  5ING A;  3L8I A;  3H81 A;  3HLN 1;  2GTR A;  4JWV A;  3ZWA A;  4K2N A;  3ADD A;  4FND A;  2X24 A;  3AJM A;  2F6I A;  5C9G A;  3O4X E;  2VX2 A;  5DZK A;  4OLQ A;  2VSU F;  2W3P A;  2F9Y B;  4ELS A;  1PIX A;  3LAO A;  3ISA A;  1X0U A;  4Q1I A;  4ZDF A;  3M6M A;  3AM1 A;  3HRX A;  4NNQ A;  2YJG A;  3PZK A;  5DU6 A;  3H0S A;  3KTK A;  5DUC A;  2Q34 A;  5DTP A;  3ZWB A;  3W8I B;  5G1Q A;  2EJ5 A;  3P5M A;  1FCF A;  1VRG A;  3L3S A;  4WZ8 B;  4YLH A;  1UYS A;  3QRE A;  2ZL3 A;  3PE8 A;  4G2R A;  1WDL A;  4J2U A;  3DOR A;  2CBY A;  3QK8 A;  3ADC A;  3T8A A;  1UYT A;  4OMR A;  3A4M A;  3SWX A;  2J5I I;  5JBW A;  2VSU E;  4EML A;  2F9I A;  1YG8 A;  5INI A;  1Q52 A;  3OME A;  1Q51 A;  3NJB A;  4U19 A;  3QXI A;  1K39 A;  3PGQ A;  4B3H A;  4U0G H;  3TVW A;  2VRE A;  3HE2 A;  3TV5 A;  2A7S A;  4JFC A;  3ZWC A;  3QMJ A;  2VSS F;  4QIJ A;  3T89 A;  1UIY A;  4ASI A;  1XNY A;  2Q2X A;  4FN8 A;  3H0U A;  2ZQQ A;  1NZY B;  3A4L A;  4HDT A;  4L6W A;  5G1S A;  3G64 A;  1WDK A;  5DUF A;  2BZR A;  4EMM A;  3MFM A;  5HUQ A;  3QKA A;  3P85 A;  3K50 A;  2J5I B;  2J5G D;  4JCR A;  3V5I A;  2F9Y A;  2ZL2 A;  3U9S B;  3H0Q A;  4B3J A;  4EMP A;  5KDR B;  3RQF A;  1DCI A;  1UX5 A;  1O8U A;  1XNW A;  4DI1 A;  4JCQ A;  3N6R B;  1TG6 A;  1SZO A;  4I52 A;  3LKE A;  4JCT A;  4L8K A;  2VSU C;  3HP0 A;  3KTG A;  5E0S H;  3TDC A;  4FNB A;  1XNV A;  3Q0G A;  2VSS E;  4FB8 A;  2FW2 A;  3GF7 A;  1UX4 A;  2CE3 A;  5CTB A;  5DKP A;  2VSS A;  1FC7 A;  2WTB A;  1SG4 A;  1ON3 A;  1OD4 A;  3ADB A;  3QWD A; 
#chains in the Genus database with same CATH homology
 3NJD A;  1HZD A;  4FZW A;  3IBB A;  2F6Q A;  4RYF H;  4RYF A;  3MOY A;  1XX4 A;  4MXI A;  1YG6 A;  2FBM A;  3PEA A;  3OT6 A;  2X58 A;  4JJT A;  3TT7 A;  1UYV A;  1OD2 A;  4ZDE A;  3U9R B;  4B3I A;  5IKL B;  1FC9 A;  2ZL4 A;  5FIF A;  4OG1 A;  3P2L A;  1J7X A;  3RST A;  4U0G A;  4Z0M A;  3K8X A;  4ZDC A;  2PBP A;  3ZW8 A;  5JBX A;  3FF6 A;  1EF9 A;  1FC6 A;  5DU8 A;  3TZ3 A;  4U0H A;  5DL1 A;  4IZB A;  4Q0G A;  2C8T A;  3MT6 A;  1XO6 A;  3H0J A;  3IAV A;  3KTJ A;  5MGB A;  1PJH A;  4GHN A;  2ZL0 A;  3HIN A;  3ZW9 A;  3I47 A;  4JYJ A;  4KNP A;  4JSB A;  3KTI A;  3R0O A;  5C90 A;  1RJM A;  2DUB A;  4NAR A;  3GLM A;  3Q7H A;  5G1R A;  1TYF A;  1UYR A;  3WG5 A;  4JCS A;  3VIV A;  4ZU2 A;  2PG8 A;  4U1A A;  3TVU A;  3MYB A;  3TLF A;  2DEO A;  4WCZ A;  3SLL A;  3R9Q A;  3GKB A;  2FZS A;  3Q0J A;  5DZK H;  3IB9 A;  4MOU A;  1EF8 A;  1WZ8 A;  3BF0 A;  3BEZ A;  3ST9 A;  4KPK A;  3KQF A;  4LK5 A;  3QYR A;  3RSI A;  3BPP A;  3V5E A;  1HNU A;  5E0S A;  1N6F A;  4WYO B;  4MI2 A;  2D3T A;  1DUB A;  2IEX A;  1K32 A;  4U18 A;  4QII A;  2NP9 A;  4KD6 A;  5CTC A;  4KWB A;  2J5G A;  3T3W A;  4F47 A;  1EY3 A;  3T8B A;  3KTH A;  4I4Z A;  3Q1T A;  4ZDD A;  2PPY A;  4FN7 A;  3TRR A;  3FDU A;  3M6N A;  2J5S A;  1NZY A;  3DJA A;  2ZQR A;  4QFE A;  4JVT A;  4IZD A;  1N6E A;  4JOT A;  1RJN A;  2J5I A;  1WDM A;  3BPT A;  1Y7O A;  3RRV A;  4JYL A;  2VSU A;  5KDR A;  1JXZ A;  3H02 A;  3JU1 A;  4HC8 A;  1W2X A;  4FJW D;  4ELW A;  3GMA A;  2A81 A;  3T88 A;  2Q35 A;  5E0N X;  1ON9 A;  5FUS A;  4FZW C;  1HNO A;  2F9I B;  4I42 A;  3QXZ A;  5DU4 A;  5DTW A;  3R6H A;  3OC7 A;  2A7K A;  2QQ3 A;  3STA A;  3R9S A;  2UZF A;  1MJ3 A;  2HW5 A;  4ELX A;  3U9T B;  4IZC A;  4K29 A;  4ZDB A;  4K3W A;  5KJP A;  4GM2 A;  5INF A;  3TT6 A;  1N6D A;  4RCN A;  3R9T A;  3GF3 A;  4HNK A;  4NEK A;  5ING A;  3H81 A;  3HLN 1;  2GTR A;  4JWV A;  3ZWA A;  4K2N A;  4FND A;  2X24 A;  2F6I A;  5C9G A;  2VX2 A;  5DZK A;  4OLQ A;  2VSU F;  2W3P A;  2F9Y B;  3QWD A;  4ELS A;  1PIX A;  3LAO A;  3ISA A;  1X0U A;  4Q1I A;  4ZDF A;  3M6M A;  3HRX A;  4NNQ A;  2YJG A;  3PZK A;  5DU6 A;  3H0S A;  3KTK A;  5DUC A;  2Q34 A;  5DTP A;  3ZWB A;  5G1Q A;  2EJ5 A;  3P5M A;  1FCF A;  1VRG A;  3L3S A;  4WZ8 B;  4YLH A;  1UYS A;  3QRE A;  2ZL3 A;  3PE8 A;  4G2R A;  1WDL A;  4J2U A;  3DOR A;  2CBY A;  3QK8 A;  3T8A A;  1UYT A;  4OMR A;  3SWX A;  2J5I I;  5JBW A;  2VSU E;  4EML A;  2F9I A;  1YG8 A;  5INI A;  1Q52 A;  3OME A;  1Q51 A;  3NJB A;  4U19 A;  3QXI A;  1K39 A;  3PGQ A;  4B3H A;  4U0G H;  3TVW A;  2VRE A;  3HE2 A;  3TV5 A;  2A7S A;  4JFC A;  3ZWC A;  3QMJ A;  2VSS F;  4QIJ A;  3T89 A;  1UIY A;  4ASI A;  1XNY A;  2Q2X A;  4FN8 A;  3H0U A;  2ZQQ A;  1NZY B;  4HDT A;  4L6W A;  5G1S A;  3G64 A;  1WDK A;  5DUF A;  2BZR A;  4EMM A;  3MFM A;  5HUQ A;  3QKA A;  3P85 A;  3K50 A;  2J5I B;  2J5G D;  4JCR A;  3V5I A;  2F9Y A;  2ZL2 A;  3U9S B;  3H0Q A;  4B3J A;  4EMP A;  5KDR B;  1DCI A;  1O8U A;  1XNW A;  4DI1 A;  4JCQ A;  3N6R B;  1TG6 A;  1SZO A;  4I52 A;  3LKE A;  4JCT A;  4L8K A;  2VSU C;  3HP0 A;  3KTG A;  3TDC A;  4FNB A;  1XNV A;  3Q0G A;  2VSS E;  4FB8 A;  2FW2 A;  3GF7 A;  2CE3 A;  5CTB A;  5DKP A;  2VSS A;  1FC7 A;  2WTB A;  1SG4 A;  1ON3 A;  1OD4 A;  5E0S H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...