1DCIA

Dienoyl-coa isomerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
AYESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSITFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of dienoyl-CoA isomerase at 1.5 A resolution reveals the importance of aspartate and glutamate sidechains for catalysis.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lyase
molecule keywords DIENOYL-COA ISOMERASE
total genus 106
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1998-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1dciA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1dciA01
1XNVA 4L8KA 2A7SA 4KD6A 1FCFA 1W2XA 4WYOB 3IAVA 2WTBA 4KWBA 1EF9A 3LKEA 1YG8A 4JCTA 4FN7A 5G1SA 5INFA 4ZDDA 3KTIA 1Q52A 3HLN1 1ON3A 3BF0A 5KDRB 3GLMA 1XO6A 5INIA 4ELXA 3ZWBA 4K29A 2EJ5A 2J5IB 4IZBA 1SG4A 2J5II 2VSUA 4ZDFA 2CE3A 3I47A 2Q34A 3ZW9A 1MJ3A 2A81A 4GHNA 3IBBA 5INGA 5DUFA 4MXIA 3QYRA 4FZWA 3KTJA 2GTRA 3TRRA 5KJPA 2W3PA 2DEOA 4ZU2A 5CTCA 4HC8A 1WDLA 1J7XA 1HNUA 3P85A 3QKAA 3GF7A 3T8BA 4U19A 4JYLA 5DU4A 1PIXA 4JCSA 3H02A 4KNPA 3ST9A 1XNYA 1SZOA 1ON9A 4NEKA 3STAA 2ZL3A 2FBMA 2ZQRA 3P2LA 3KTGA 3Q7HA 5E0NX 5E0SA 3TT6A 2FZSA 3QXZA 3KTHA 4LK5A 3TZ3A 5JBXA 3P5MA 3PZKA 3MT6A 1WDMA 3H0SA 2D3TA 2VSSE 4WZ8B 3R9SA 2F9IB 3HRXA 1FC7A 2ZL2A 5DTWA 3HE2A 3DJAA 4DI1A 1UYTA 5E0SH 3BPPA 2ZL0A 3IB9A 3KTKA 3SWXA 1DUBA 1K32A 5JBWA 5CTBA 4RCNA 5C90A 4JWVA 1NZYA 2DUBA 4L6WA 4MOUA 2QQ3A 2BZRA 2ZL4A 1FC9A 4FNDA 3V5EA 3H0UA 3QREA 3LAOA 2X58A 4JOTA 3PE8A 5IKLB 4OG1A 5DU6A 2J5SA 1TYFA 4WCZA 4B3HA 3H81A 1PJHA 2CBYA 3GMAA 2J5IA 2PPYA 3R9TA 3M6NA 3G64A 3MFMA 4EMPA 3PEAA 1WDKA 1EY3A 4JVTA 3K50A 4ASIA 4U0GA 4EMLA 3QMJA 1OD2A 2C8TA 3QXIA 4RYFA 3T8AA 4Q0GA 4FJWD 5DTPA 4ZDBA 4FN8A 4JFCA 2VSSF 1RJMA 3V5IA 1RJNA 3QK8A 4MI2A 3TDCA 3ZWAA 4OLQA 5C9GA 3T88A 2Q35A 1K39A 4G2RA 4Q1IA 4JCRA 3RRVA 2FW2A 3U9SB 3ISAA 3WG5A 1HZDA 2IEXA 4I42A 5FUSA 4JJTA 5DKPA 3TVUA 3OMEA 3R9QA 3DORA 2VREA 1Q51A 1X0UA 4FZWC 1UYSA 3GF3A 4FB8A 1NZYB 3BEZA 5G1RA 2F9IA 3ZWCA 4U0GH 3T89A 3HINA 5DUCA 3PGQA 1XX4A 3MOYA 1XNWA 4U1AA 3N6RB 5FIFA 5MGBA 3VIVA 4IZDA 3TVWA 1Y7OA 4ELSA 3MYBA 2HW5A 4K2NA 4HNKA 4IZCA 1JXZA 4F47A 3RSTA 4GM2A 1N6DA 1HNOA 3FF6A 3NJBA 4JYJA 5KDRA 4FNBA 4YLHA 3HP0A 1N6FA 1UYVA 3L3SA 1EF8A 4K3WA 4B3IA 3K8XA 4ZDCA 1TG6A 2VSSA 1DCIA 1FC6A 3NJDA 3TLFA 4U18A 3Q1TA 2VSUF 3Q0GA 2F9YA 3U9TB 3RSIA 4OMRA 3QWDA 2X24A 5DZKH 3T3WA 1UYRA 1O8UA 3M6MA 4EMMA 2F6QA 3Q0JA 4JCQA 4B3JA 2VSUC 2UZFA 1N6EA 4ZDEA 3H0JA 5DL1A 5DZKA 3H0QA 2ZQQA 3FDUA 3OC7A 1UIYA 4NNQA 3R6HA 5DU8A 1YG6A 5G1QA 3KQFA 4JSBA 4I4ZA 3JU1A 1WZ8A 2PBPA 2F9YB 2NP9A 3OT6A 1VRGA 3U9RB 1OD4A 3TT7A 4KPKA 2PG8A 2A7KA 2VX2A 2J5GA 4ELWA 4U0HA 2VSUE 4QFEA 3SLLA 3R0OA 2J5GD 4RYFH 2F6IA 4I52A 4QIJA 2Q2XA 4Z0MA 4QIIA 3GKBA 3TV5A 3ZW8A
chains in the Genus database with same CATH superfamily
1XNVA 3BPTA 4L8KA 2A7SA 4KD6A 1FCFA 1W2XA 4WYOB 3IAVA 2WTBA 4KWBA 1EF9A 3LKEA 1YG8A 4JCTA 4FN7A 5G1SA 5INFA 4ZDDA 3KTIA 1Q52A 4HDTA 3HLN1 1ON3A 3BF0A 5KDRB 3GLMA 1XO6A 5INIA 4ELXA 3ZWBA 4K29A 2EJ5A 2J5IB 4IZBA 1SG4A 3IRBA 2J5II 2VSUA 2CE3A 3I47A 4ZDFA 2Q34A 3ZW9A 1MJ3A 2A81A 4GHNA 3IBBA 5INGA 5DUFA 1UX5A 4MXIA 3QYRA 4FZWA 3ADDA 3KTJA 2GTRA 3TRRA 5KJPA 3W8HB 2W3PA 2DEOA 4ZU2A 5CTCA 4HC8A 1WDLA 1J7XA 1HNUA 3P85A 3QKAA 3GF7A 3T8BA 3A4LA 4JYLA 4U19A 5DU4A 1PIXA 4JCSA 3H02A 4KNPA 3ST9A 1XNYA 1SZOA 1ON9A 4NEKA 3STAA 2ZL3A 2FBMA 2ZQRA 3P2LA 3KTGA 3Q7HA 5E0NX 5E0SA 3TT6A 2FZSA 3QXZA 3KTHA 4LK5A 3TZ3A 5JBXA 3P5MA 3PZKA 3MT6A 1WDMA 3H0SA 2D3TA 4GEHB 2VSSE 4WZ8B 3R9SA 2F9IB 3HRXA 1FC7A 2ZL2A 5DTWA 3HE2A 3DJAA 4DI1A 1UYTA 5E0SH 3BPPA 2ZL0A 3IB9A 3KTKA 3SWXA 3L8IA 1DUBA 1K32A 5JBWA 5CTBA 4RCNA 5C90A 4JWVA 1NZYA 2DUBA 4L6WA 4MOUA 2QQ3A 3W8IB 2BZRA 2ZL4A 1FC9A 4FNDA 3V5EA 3H0UA 3RQFA 3QREA 4J2UA 3LAOA 2X58A 4JOTA 3PE8A 5IKLB 4OG1A 5DU6A 2J5SA 1TYFA 4WCZA 4B3HA 3H81A 1PJHA 2CBYA 3GMAA 2J5IA 2PPYA 1UX4A 3R9TA 3M6NA 3G64A 3MFMA 4EMPA 3RQGA 3PEAA 5HUQA 1WDKA 1EY3A 4JVTA 3K50A 4ASIA 4U0GA 4EMLA 3QMJA 1OD2A 2C8TA 3QXIA 4RYFA 3T8AA 3O4XE 4Q0GA 4FJWD 5DTPA 4ZDBA 4FN8A 4JFCA 2VSSF 1RJMA 3V5IA 1RJNA 3L8JA 3QK8A 4MI2A 3TDCA 3RQEA 3A4MA 3ZWAA 4OLQA 5C9GA 3T88A 2Q35A 1K39A 4G2RA 4Q1IA 4JCRA 3RRVA 2FW2A 3U9SB 3ISAA 3WG5A 1HZDA 2IEXA 4I42A 5FUSA 4JJTA 5DKPA 3TVUA 3OMEA 3R9QA 3DORA 3A4NA 2VREA 1Q51A 1X0UA 4FZWC 1UYSA 3GF3A 4FB8A 1NZYB 3BEZA 5G1RA 2F9IA 3ZWCA 4U0GH 3T89A 3HINA 5DUCA 3PGQA 1XX4A 3MOYA 1XNWA 4U1AA 3N6RB 5FIFA 5MGBA 3VIVA 4IZDA 3TVWA 1Y7OA 4ELSA 3MYBA 2HW5A 4K2NA 2P63A 4HNKA 4IZCA 1JXZA 4F47A 3RSTA 4GM2A 1N6DA 1HNOA 3FF6A 3NJBA 4JYJA 5KDRA 4FNBA 4YLHA 3ADBA 3HP0A 3ADCA 1N6FA 1UYVA 3L3SA 1EF8A 4K3WA 4B3IA 3K8XA 4ZDCA 1TG6A 2VSSA 1DCIA 1FC6A 3NJDA 1Y64B 3TLFA 4U18A 3Q1TA 2VSUF 3Q0GA 2F9YA 3U9TB 3RSIA 4OMRA 3QWDA 3AM1A 2X24A 5DZKH 3T3WA 1UYRA 1O8UA 3M6MA 4EMMA 2F6QA 3Q0JA 4JCQA 4B3JA 2VSUC 2UZFA 1N6EA 4ZDEA 3H0JA 5DL1A 5DZKA 3H0QA 2ZQQA 3FDUA 3OC7A 1UIYA 4NNQA 3R6HA 5DU8A 1YG6A 5G1QA 3KQFA 4JSBA 4I4ZA 3JU1A 1WZ8A 2PBPA 2F9YB 2NP9A 3OT6A 1VRGA 3U9RB 1OD4A 3TT7A 4KPKA 2PG8A 2A7KA 2VX2A 2J5GA 2YJGA 4ELWA 4U0HA 2VSUE 4QFEA 3SLLA 3R0OA 2J5GD 4RYFH 2F6IA 3AJMA 4I52A 4QIJA 2Q2XA 4Z0MA 4QIIA 3GKBA 3TV5A 4NARA 3ZW8A
chains in the Genus database with same CATH topology
1XNVA 3BPTA 4L8KA 2A7SA 4KD6A 1FCFA 1W2XA 4WYOB 3IAVA 2WTBA 4KWBA 1EF9A 3LKEA 1YG8A 4JCTA 4FN7A 5G1SA 5INFA 4ZDDA 3KTIA 1Q52A 4HDTA 3HLN1 1ON3A 3BF0A 5KDRB 3GLMA 1XO6A 5INIA 4ELXA 3ZWBA 4K29A 2EJ5A 2J5IB 4IZBA 1SG4A 2J5II 2VSUA 4ZDFA 2CE3A 3I47A 2Q34A 3ZW9A 1MJ3A 2A81A 4GHNA 3IBBA 5INGA 5DUFA 4MXIA 3QYRA 4FZWA 3KTJA 2GTRA 3TRRA 5KJPA 2W3PA 2DEOA 4ZU2A 5CTCA 4HC8A 1WDLA 1J7XA 1HNUA 3P85A 3QKAA 3GF7A 3T8BA 4U19A 4JYLA 5DU4A 1PIXA 4JCSA 3H02A 4KNPA 3ST9A 1XNYA 1SZOA 1ON9A 4NEKA 3STAA 2ZL3A 2FBMA 2ZQRA 3P2LA 3KTGA 3Q7HA 5E0NX 5E0SA 3TT6A 2FZSA 3QXZA 3KTHA 4LK5A 3TZ3A 5JBXA 3P5MA 3PZKA 3MT6A 1WDMA 3H0SA 2D3TA 2VSSE 4WZ8B 3R9SA 2F9IB 3HRXA 1FC7A 2ZL2A 5DTWA 3HE2A 3DJAA 4DI1A 1UYTA 5E0SH 3BPPA 2ZL0A 3IB9A 3KTKA 3SWXA 1DUBA 1K32A 5JBWA 5CTBA 4RCNA 5C90A 4JWVA 1NZYA 2DUBA 4L6WA 4MOUA 2QQ3A 2BZRA 2ZL4A 1FC9A 4FNDA 3V5EA 3H0UA 3QREA 4J2UA 3LAOA 2X58A 4JOTA 3PE8A 5IKLB 4OG1A 5DU6A 2J5SA 1TYFA 4WCZA 4B3HA 3H81A 1PJHA 2CBYA 3GMAA 2J5IA 2PPYA 3R9TA 3M6NA 3G64A 3MFMA 4EMPA 3PEAA 5HUQA 1WDKA 1EY3A 4JVTA 3K50A 4ASIA 4U0GA 4EMLA 3QMJA 1OD2A 2C8TA 3QXIA 4RYFA 3T8AA 4Q0GA 4FJWD 5DTPA 4ZDBA 4FN8A 4JFCA 2VSSF 1RJMA 3V5IA 1RJNA 3QK8A 4MI2A 3TDCA 3ZWAA 4OLQA 5C9GA 3T88A 2Q35A 1K39A 4G2RA 4Q1IA 4JCRA 3RRVA 2FW2A 3U9SB 3ISAA 3WG5A 1HZDA 2IEXA 4I42A 5FUSA 4JJTA 5DKPA 3TVUA 3OMEA 3R9QA 3DORA 2VREA 1Q51A 1X0UA 4FZWC 1UYSA 3GF3A 4FB8A 1NZYB 3BEZA 5G1RA 2F9IA 3ZWCA 4U0GH 3T89A 3HINA 5DUCA 3PGQA 1XX4A 3MOYA 1XNWA 4U1AA 3N6RB 5FIFA 5MGBA 3VIVA 4IZDA 3TVWA 1Y7OA 4ELSA 3MYBA 2HW5A 4K2NA 4HNKA 4IZCA 1JXZA 4F47A 3RSTA 4GM2A 1N6DA 1HNOA 3FF6A 3NJBA 4JYJA 5KDRA 4FNBA 4YLHA 3HP0A 1N6FA 1UYVA 3L3SA 1EF8A 4K3WA 4B3IA 3K8XA 4ZDCA 1TG6A 2VSSA 1DCIA 1FC6A 3NJDA 3TLFA 4U18A 3Q1TA 2VSUF 3Q0GA 2F9YA 3U9TB 3RSIA 4OMRA 3QWDA 2X24A 5DZKH 3T3WA 1UYRA 1O8UA 3M6MA 4EMMA 2F6QA 3Q0JA 4JCQA 4B3JA 2VSUC 2UZFA 1N6EA 4ZDEA 3H0JA 5DL1A 5DZKA 3H0QA 2ZQQA 3FDUA 3OC7A 1UIYA 4NNQA 3R6HA 5DU8A 1YG6A 5G1QA 3KQFA 4JSBA 4I4ZA 3JU1A 1WZ8A 2PBPA 2F9YB 2NP9A 3OT6A 1VRGA 3U9RB 1OD4A 3TT7A 4KPKA 2PG8A 2A7KA 2VX2A 2J5GA 2YJGA 4ELWA 4U0HA 2VSUE 4QFEA 3SLLA 3R0OA 2J5GD 4RYFH 2F6IA 4I52A 4QIJA 2Q2XA 4Z0MA 4QIIA 3GKBA 3TV5A 4NARA 3ZW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNV A;  4L8K A;  2A7S A;  4KD6 A;  1FCF A;  1W2X A;  4WYO B;  3IAV A;  2WTB A;  4KWB A;  1EF9 A;  3LKE A;  1YG8 A;  4JCT A;  4FN7 A;  5G1S A;  5INF A;  4ZDD A;  3KTI A;  1Q52 A;  3HLN 1;  1ON3 A;  3BF0 A;  5KDR B;  3GLM A;  1XO6 A;  5INI A;  4ELX A;  3ZWB A;  4K29 A;  2EJ5 A;  2J5I B;  4IZB A;  1SG4 A;  2J5I I;  2VSU A;  4ZDF A;  2CE3 A;  3I47 A;  2Q34 A;  3ZW9 A;  1MJ3 A;  2A81 A;  4GHN A;  3IBB A;  5ING A;  5DUF A;  4MXI A;  3QYR A;  4FZW A;  3KTJ A;  2GTR A;  3TRR A;  5KJP A;  2W3P A;  2DEO A;  4ZU2 A;  5CTC A;  4HC8 A;  1WDL A;  1J7X A;  1HNU A;  3P85 A;  3QKA A;  3GF7 A;  3T8B A;  4U19 A;  4JYL A;  5DU4 A;  1PIX A;  4JCS A;  3H02 A;  4KNP A;  3ST9 A;  1XNY A;  1SZO A;  1ON9 A;  4NEK A;  3STA A;  2ZL3 A;  2FBM A;  2ZQR A;  3P2L A;  3KTG A;  3Q7H A;  5E0N X;  5E0S A;  3TT6 A;  2FZS A;  3QXZ A;  3KTH A;  4LK5 A;  3TZ3 A;  5JBX A;  3P5M A;  3PZK A;  3MT6 A;  1WDM A;  3H0S A;  2D3T A;  2VSS E;  4WZ8 B;  3R9S A;  2F9I B;  3HRX A;  1FC7 A;  2ZL2 A;  5DTW A;  3HE2 A;  3DJA A;  4DI1 A;  1UYT A;  5E0S H;  3BPP A;  2ZL0 A;  3IB9 A;  3KTK A;  3SWX A;  1DUB A;  1K32 A;  5JBW A;  5CTB A;  4RCN A;  5C90 A;  4JWV A;  1NZY A;  2DUB A;  4L6W A;  4MOU A;  2QQ3 A;  2BZR A;  2ZL4 A;  1FC9 A;  4FND A;  3V5E A;  3H0U A;  3QRE A;  3LAO A;  2X58 A;  4JOT A;  3PE8 A;  5IKL B;  4OG1 A;  5DU6 A;  2J5S A;  1TYF A;  4WCZ A;  4B3H A;  3H81 A;  1PJH A;  2CBY A;  3GMA A;  2J5I A;  2PPY A;  3R9T A;  3M6N A;  3G64 A;  3MFM A;  4EMP A;  3PEA A;  1WDK A;  1EY3 A;  4JVT A;  3K50 A;  4ASI A;  4U0G A;  4EML A;  3QMJ A;  1OD2 A;  2C8T A;  3QXI A;  4RYF A;  3T8A A;  4Q0G A;  4FJW D;  5DTP A;  4ZDB A;  4FN8 A;  4JFC A;  2VSS F;  1RJM A;  3V5I A;  1RJN A;  3QK8 A;  4MI2 A;  3TDC A;  3ZWA A;  4OLQ A;  5C9G A;  3T88 A;  2Q35 A;  1K39 A;  4G2R A;  4Q1I A;  4JCR A;  3RRV A;  2FW2 A;  3U9S B;  3ISA A;  3WG5 A;  1HZD A;  2IEX A;  4I42 A;  5FUS A;  4JJT A;  5DKP A;  3TVU A;  3OME A;  3R9Q A;  3DOR A;  2VRE A;  1Q51 A;  1X0U A;  4FZW C;  1UYS A;  3GF3 A;  4FB8 A;  1NZY B;  3BEZ A;  5G1R A;  2F9I A;  3ZWC A;  4U0G H;  3T89 A;  3HIN A;  5DUC A;  3PGQ A;  1XX4 A;  3MOY A;  1XNW A;  4U1A A;  3N6R B;  5FIF A;  5MGB A;  3VIV A;  4IZD A;  3TVW A;  1Y7O A;  4ELS A;  3MYB A;  2HW5 A;  4K2N A;  4HNK A;  4IZC A;  1JXZ A;  4F47 A;  3RST A;  4GM2 A;  1N6D A;  1HNO A;  3FF6 A;  3NJB A;  4JYJ A;  5KDR A;  4FNB A;  4YLH A;  3HP0 A;  1N6F A;  1UYV A;  3L3S A;  1EF8 A;  4K3W A;  4B3I A;  3K8X A;  4ZDC A;  1TG6 A;  2VSS A;  1DCI A;  1FC6 A;  3NJD A;  3TLF A;  4U18 A;  3Q1T A;  2VSU F;  3Q0G A;  2F9Y A;  3U9T B;  3RSI A;  4OMR A;  3QWD A;  2X24 A;  5DZK H;  3T3W A;  1UYR A;  1O8U A;  3M6M A;  4EMM A;  2F6Q A;  3Q0J A;  4JCQ A;  4B3J A;  2VSU C;  2UZF A;  1N6E A;  4ZDE A;  3H0J A;  5DL1 A;  5DZK A;  3H0Q A;  2ZQQ A;  3FDU A;  3OC7 A;  1UIY A;  4NNQ A;  3R6H A;  5DU8 A;  1YG6 A;  5G1Q A;  3KQF A;  4JSB A;  4I4Z A;  3JU1 A;  1WZ8 A;  2PBP A;  2F9Y B;  2NP9 A;  3OT6 A;  1VRG A;  3U9R B;  1OD4 A;  3TT7 A;  4KPK A;  2PG8 A;  2A7K A;  2VX2 A;  2J5G A;  4ELW A;  4U0H A;  2VSU E;  4QFE A;  3SLL A;  3R0O A;  2J5G D;  4RYF H;  2F6I A;  4I52 A;  4QIJ A;  2Q2X A;  4Z0M A;  4QII A;  3GKB A;  3TV5 A;  3ZW8 A; 
#chains in the Genus database with same CATH topology
 1XNV A;  3BPT A;  4L8K A;  2A7S A;  4KD6 A;  1FCF A;  1W2X A;  4WYO B;  3IAV A;  2WTB A;  4KWB A;  1EF9 A;  3LKE A;  1YG8 A;  4JCT A;  4FN7 A;  5G1S A;  5INF A;  4ZDD A;  3KTI A;  1Q52 A;  4HDT A;  3HLN 1;  1ON3 A;  3BF0 A;  5KDR B;  3GLM A;  1XO6 A;  5INI A;  4ELX A;  3ZWB A;  4K29 A;  2EJ5 A;  2J5I B;  4IZB A;  1SG4 A;  3IRB A;  2J5I I;  2VSU A;  2CE3 A;  3I47 A;  4ZDF A;  2Q34 A;  3ZW9 A;  1MJ3 A;  2A81 A;  4GHN A;  3IBB A;  5ING A;  5DUF A;  1UX5 A;  4MXI A;  3QYR A;  4FZW A;  3ADD A;  3KTJ A;  2GTR A;  3TRR A;  5KJP A;  3W8H B;  2W3P A;  2DEO A;  4ZU2 A;  5CTC A;  4HC8 A;  1WDL A;  1J7X A;  1HNU A;  3P85 A;  3QKA A;  3GF7 A;  3T8B A;  3A4L A;  4JYL A;  4U19 A;  5DU4 A;  1PIX A;  4JCS A;  3H02 A;  4KNP A;  3ST9 A;  1XNY A;  1SZO A;  1ON9 A;  4NEK A;  3STA A;  2ZL3 A;  2FBM A;  2ZQR A;  3P2L A;  3KTG A;  3Q7H A;  5E0N X;  5E0S A;  3TT6 A;  2FZS A;  3QXZ A;  3KTH A;  4LK5 A;  3TZ3 A;  5JBX A;  3P5M A;  3PZK A;  3MT6 A;  1WDM A;  3H0S A;  2D3T A;  4GEH B;  2VSS E;  4WZ8 B;  3R9S A;  2F9I B;  3HRX A;  1FC7 A;  2ZL2 A;  5DTW A;  3HE2 A;  3DJA A;  4DI1 A;  1UYT A;  5E0S H;  3BPP A;  2ZL0 A;  3IB9 A;  3KTK A;  3SWX A;  3L8I A;  1DUB A;  1K32 A;  5JBW A;  5CTB A;  4RCN A;  5C90 A;  4JWV A;  1NZY A;  2DUB A;  4L6W A;  4MOU A;  2QQ3 A;  3W8I B;  2BZR A;  2ZL4 A;  1FC9 A;  4FND A;  3V5E A;  3H0U A;  3RQF A;  3QRE A;  4J2U A;  3LAO A;  2X58 A;  4JOT A;  3PE8 A;  5IKL B;  4OG1 A;  5DU6 A;  2J5S A;  1TYF A;  4WCZ A;  4B3H A;  3H81 A;  1PJH A;  2CBY A;  3GMA A;  2J5I A;  2PPY A;  1UX4 A;  3R9T A;  3M6N A;  3G64 A;  3MFM A;  4EMP A;  3RQG A;  3PEA A;  5HUQ A;  1WDK A;  1EY3 A;  4JVT A;  3K50 A;  4ASI A;  4U0G A;  4EML A;  3QMJ A;  1OD2 A;  2C8T A;  3QXI A;  4RYF A;  3T8A A;  3O4X E;  4Q0G A;  4FJW D;  5DTP A;  4ZDB A;  4FN8 A;  4JFC A;  2VSS F;  1RJM A;  3V5I A;  1RJN A;  3L8J A;  3QK8 A;  4MI2 A;  3TDC A;  3RQE A;  3A4M A;  3ZWA A;  4OLQ A;  5C9G A;  3T88 A;  2Q35 A;  1K39 A;  4G2R A;  4Q1I A;  4JCR A;  3RRV A;  2FW2 A;  3U9S B;  3ISA A;  3WG5 A;  1HZD A;  2IEX A;  4I42 A;  5FUS A;  4JJT A;  5DKP A;  3TVU A;  3OME A;  3R9Q A;  3DOR A;  3A4N A;  2VRE A;  1Q51 A;  1X0U A;  4FZW C;  1UYS A;  3GF3 A;  4FB8 A;  1NZY B;  3BEZ A;  5G1R A;  2F9I A;  3ZWC A;  4U0G H;  3T89 A;  3HIN A;  5DUC A;  3PGQ A;  1XX4 A;  3MOY A;  1XNW A;  4U1A A;  3N6R B;  5FIF A;  5MGB A;  3VIV A;  4IZD A;  3TVW A;  1Y7O A;  4ELS A;  3MYB A;  2HW5 A;  4K2N A;  2P63 A;  4HNK A;  4IZC A;  1JXZ A;  4F47 A;  3RST A;  4GM2 A;  1N6D A;  1HNO A;  3FF6 A;  3NJB A;  4JYJ A;  5KDR A;  4FNB A;  4YLH A;  3ADB A;  3HP0 A;  3ADC A;  1N6F A;  1UYV A;  3L3S A;  1EF8 A;  4K3W A;  4B3I A;  3K8X A;  4ZDC A;  1TG6 A;  2VSS A;  1DCI A;  1FC6 A;  3NJD A;  1Y64 B;  3TLF A;  4U18 A;  3Q1T A;  2VSU F;  3Q0G A;  2F9Y A;  3U9T B;  3RSI A;  4OMR A;  3QWD A;  3AM1 A;  2X24 A;  5DZK H;  3T3W A;  1UYR A;  1O8U A;  3M6M A;  4EMM A;  2F6Q A;  3Q0J A;  4JCQ A;  4B3J A;  2VSU C;  2UZF A;  1N6E A;  4ZDE A;  3H0J A;  5DL1 A;  5DZK A;  3H0Q A;  2ZQQ A;  3FDU A;  3OC7 A;  1UIY A;  4NNQ A;  3R6H A;  5DU8 A;  1YG6 A;  5G1Q A;  3KQF A;  4JSB A;  4I4Z A;  3JU1 A;  1WZ8 A;  2PBP A;  2F9Y B;  2NP9 A;  3OT6 A;  1VRG A;  3U9R B;  1OD4 A;  3TT7 A;  4KPK A;  2PG8 A;  2A7K A;  2VX2 A;  2J5G A;  2YJG A;  4ELW A;  4U0H A;  2VSU E;  4QFE A;  3SLL A;  3R0O A;  2J5G D;  4RYF H;  2F6I A;  3AJM A;  4I52 A;  4QIJ A;  2Q2X A;  4Z0M A;  4QII A;  3GKB A;  3TV5 A;  4NAR A;  3ZW8 A; 
#chains in the Genus database with same CATH homology
 1XNV A;  3BPT A;  4L8K A;  2A7S A;  4KD6 A;  1FCF A;  1W2X A;  4WYO B;  3IAV A;  2WTB A;  4KWB A;  1EF9 A;  3LKE A;  1YG8 A;  4JCT A;  4FN7 A;  5G1S A;  5INF A;  4ZDD A;  3KTI A;  1Q52 A;  4HDT A;  3HLN 1;  1ON3 A;  3BF0 A;  5KDR B;  3GLM A;  1XO6 A;  5INI A;  4ELX A;  3ZWB A;  4K29 A;  2EJ5 A;  2J5I B;  4IZB A;  1SG4 A;  2J5I I;  2VSU A;  4ZDF A;  2CE3 A;  3I47 A;  2Q34 A;  3ZW9 A;  1MJ3 A;  2A81 A;  4GHN A;  3IBB A;  5ING A;  5DUF A;  4MXI A;  3QYR A;  4FZW A;  3KTJ A;  2GTR A;  3TRR A;  5KJP A;  2W3P A;  2DEO A;  4ZU2 A;  5CTC A;  4HC8 A;  1WDL A;  1J7X A;  1HNU A;  3P85 A;  3QKA A;  3GF7 A;  3T8B A;  4U19 A;  4JYL A;  5DU4 A;  1PIX A;  4JCS A;  3H02 A;  4KNP A;  3ST9 A;  1XNY A;  1SZO A;  1ON9 A;  4NEK A;  3STA A;  2ZL3 A;  2FBM A;  2ZQR A;  3P2L A;  3KTG A;  3Q7H A;  5E0N X;  5E0S A;  3TT6 A;  2FZS A;  3QXZ A;  3KTH A;  4LK5 A;  3TZ3 A;  5JBX A;  3P5M A;  3PZK A;  3MT6 A;  1WDM A;  3H0S A;  2D3T A;  2VSS E;  4WZ8 B;  3R9S A;  2F9I B;  3HRX A;  1FC7 A;  2ZL2 A;  5DTW A;  3HE2 A;  3DJA A;  4DI1 A;  1UYT A;  5E0S H;  3BPP A;  2ZL0 A;  3IB9 A;  3KTK A;  3SWX A;  1DUB A;  1K32 A;  5JBW A;  5CTB A;  4RCN A;  5C90 A;  4JWV A;  1NZY A;  2DUB A;  4L6W A;  4MOU A;  2QQ3 A;  2BZR A;  2ZL4 A;  1FC9 A;  4FND A;  3V5E A;  3H0U A;  3QRE A;  4J2U A;  3LAO A;  2X58 A;  4JOT A;  3PE8 A;  5IKL B;  4OG1 A;  5DU6 A;  2J5S A;  1TYF A;  4WCZ A;  4B3H A;  3H81 A;  1PJH A;  2CBY A;  3GMA A;  2J5I A;  2PPY A;  3R9T A;  3M6N A;  3G64 A;  3MFM A;  4EMP A;  3PEA A;  5HUQ A;  1WDK A;  1EY3 A;  4JVT A;  3K50 A;  4ASI A;  4U0G A;  4EML A;  3QMJ A;  1OD2 A;  2C8T A;  3QXI A;  4RYF A;  3T8A A;  4Q0G A;  4FJW D;  5DTP A;  4ZDB A;  4FN8 A;  4JFC A;  2VSS F;  1RJM A;  3V5I A;  1RJN A;  3QK8 A;  4MI2 A;  3TDC A;  3ZWA A;  4OLQ A;  5C9G A;  3T88 A;  2Q35 A;  1K39 A;  4G2R A;  4Q1I A;  4JCR A;  3RRV A;  2FW2 A;  3U9S B;  3ISA A;  3WG5 A;  1HZD A;  2IEX A;  4I42 A;  5FUS A;  4JJT A;  5DKP A;  3TVU A;  3OME A;  3R9Q A;  3DOR A;  2VRE A;  1Q51 A;  1X0U A;  4FZW C;  1UYS A;  3GF3 A;  4FB8 A;  1NZY B;  3BEZ A;  5G1R A;  2F9I A;  3ZWC A;  4U0G H;  3T89 A;  3HIN A;  5DUC A;  3PGQ A;  1XX4 A;  3MOY A;  1XNW A;  4U1A A;  3N6R B;  5FIF A;  5MGB A;  3VIV A;  4IZD A;  3TVW A;  1Y7O A;  4ELS A;  3MYB A;  2HW5 A;  4K2N A;  4HNK A;  4IZC A;  1JXZ A;  4F47 A;  3RST A;  4GM2 A;  1N6D A;  1HNO A;  3FF6 A;  3NJB A;  4JYJ A;  5KDR A;  4FNB A;  4YLH A;  3HP0 A;  1N6F A;  1UYV A;  3L3S A;  1EF8 A;  4K3W A;  4B3I A;  3K8X A;  4ZDC A;  1TG6 A;  2VSS A;  1DCI A;  1FC6 A;  3NJD A;  3TLF A;  4U18 A;  3Q1T A;  2VSU F;  3Q0G A;  2F9Y A;  3U9T B;  3RSI A;  4OMR A;  3QWD A;  2X24 A;  5DZK H;  3T3W A;  1UYR A;  1O8U A;  3M6M A;  4EMM A;  2F6Q A;  3Q0J A;  4JCQ A;  4B3J A;  2VSU C;  2UZF A;  1N6E A;  4ZDE A;  3H0J A;  5DL1 A;  5DZK A;  3H0Q A;  2ZQQ A;  3FDU A;  3OC7 A;  1UIY A;  4NNQ A;  3R6H A;  5DU8 A;  1YG6 A;  5G1Q A;  3KQF A;  4JSB A;  4I4Z A;  3JU1 A;  1WZ8 A;  2PBP A;  2F9Y B;  2NP9 A;  3OT6 A;  1VRG A;  3U9R B;  1OD4 A;  3TT7 A;  4KPK A;  2PG8 A;  2A7K A;  2VX2 A;  2J5G A;  2YJG A;  4ELW A;  4U0H A;  2VSU E;  4QFE A;  3SLL A;  3R0O A;  2J5G D;  4RYF H;  2F6I A;  4I52 A;  4QIJ A;  2Q2X A;  4Z0M A;  4QII A;  3GKB A;  3TV5 A;  4NAR A;  3ZW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...