3IRBA

Crystal structure of protein with unknown function from duf35 family (13815350) from sulfolobus solfataricus at 1.80 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
KEGSLLRWYDVMEAERYEYTVGPAGEQFFNGLKQNKIIGSKCSKCGRIFVPARSYCEHCFVKIENYVEINKDEAYVDSYTIIYNDDEGNKLAQPVYIALIRFPNIEGGLLCYAEGNVKVGAKAKILSFQWPLRVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Acyl-coa binding protein
molecule keywords uncharacterized protein from DUF35 family
total genus 27
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01796 OB_aCoA_assoc DUF35 OB-fold domain, acyl-CoA-associated
A PF12172 DUF35_N Rubredoxin-like zinc ribbon domain (DUF35_N)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.20 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3irbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3irbA02
1L0WA 1PH4A 4L5RC 3K0XA 1XNRL 3S2DH 1WOCA 1YBYA 1K83H 3GTLH 3CMAA 3EBEA 5AJ3L 1NBWA 2ES2A 4LUOA 3CPWA 1KAWA 3BZCA 4KLKA 2UUBQ 3HOWG 1Q81C 1XPUA 5IYCG 4K0KL 5M3FH 1HZ9A 4IPHA 2F3IA 1X3FA 1SN8A 4UY8C 4DR6Q 1VQBA 1E24A 3CW2C 4YWMA 1E1TA 5FJ8H 2PQAA 4GNXC 3CPFA 2OQ0A 1JB7A 3EN2A 3F8TA 3MEFA 4DV2L 1PV4A 1EWIA 1NMGA 1YJ9A 1BBUA 1XPRA 3AYHB 3K8AA 3S17H 3TQYA 4YY3L 4UP7A 3PUVA 1Y1WH 3I4NG 2AWNA 1VQDA 5FLMG 1EUJA 2WB1G 1HNWQ 4AIMA 3HOWH 1KQSA 3D0FA 2IHFA 3H0GG 1U5KA 3K7UC 2NVYH 4IO9A 5IP7G 5K36G 5JJLA 4AH6A 1WCMH 1SMXA 2PMZE 4LF4Q 2JA5G 2F4VL 3J81i 4A3MG 3GO5A 4DR1L 3M4OH 1QUQA 1PVOA 2JA7G 3J80c 4JI8Q 2MFIA 4DV7L 4LF7L 3LGJA 4A3DH 2E2HH 4LF8L 2HHHQ 1IXRA 4H02A 4A93G 1SE8A 5C44G 1L1OB 4LW1A 3CMEA 3BZKA 1N32Q 3E9HA 2CWAA 2JJQA 4KHZA 4BY1H 1KC8C 5GQOA 1FJGL 1X65A 2DUDA 4YCUA 4B3RQ 3EIVA 1WYDA 4X65Q 1WFQA 4JOIA 4DV3L 1ASYA 1GD7A 1BKBA 3M4PA 4PZ8A 3HOXH 3HKZG 4QQBX 1PH3A 3CCSA 1KIXA 2NVQH 1J5EQ 4OWXB 4DV4L 3NBHB 3KF8B 3U4ZA 4IOAA 2DGYA 1I94Q 1PH9A 4X62Q 2KCTA 3JAMc 1KD1C 4JI4Q 4IPDA 5C0XG 2VQEQ 2IT1A 2KCMA 3PUZA 1VQFA 1XMOQ 1XPOA 1TWFH 3GTPH 4QIWE 4LNQA 1CKMA 1GO3E 2AKWB 4Y52H 4DK6C 3PCOB 4QJFA 2I5LX 1KRTA 2VQEL 1NJIC 4YCVA 4DV5L 4B3SL 2IY5B 2Z6KC 3B6YA 1JE5A 2A19A 4R4TA 2R92H 4JI5L 4DUZQ 3PO2G 5IYDH 4QY7A 3PIPA 3I4MH 2D62A 3GTQH 1NMFA 1H95A 3S2HH 2N8NA 4AQYL 1JMCA 2WB1E 1VQAA 5BR8L 2ZM6L 2JA7H 2K52A 4J15A 5C0XI 4OWTB 4C3HH 4A3BH 1T9HA 3F1ZA 3F2CA 4AQYQ 4A76A 4LUVA 2K5VA 4DV1Q 1HNXL 2JA5H 3S1MH 4P71A 4A3MH 1MJCA 3PUYA 4UPAA 1VQMA 2YTVA 1IBKQ 2I0QA 1CSPA 3W1GA 4GNXA 3GTGH 1AE2A 4APVA 4LF5L 1HR0Q 4A3DG 4JC0A 4A3EH 5M5XH 2QEXA 1FL0A 2VL6A 4QL5A 1MKHA 3KJOA 4JI8L 3CAMA 1V43A 2MO0A 3TEHB 1YHQA 1IBKL 5H1SE 2YU9H 4A3LG 3A74A 3ULJA 4PZ6A 1VQHA 2A8VA 4JV5Q 5ELNA 4FDBA 3DLLA 4K0KQ 4HJ7A 3ULPA 3CC4A 2NVXH 4JI2L 4POGA 2K75A 1VQGA 2PI2E 4POFA 2NVTH 1CKNB 1VQ9A 1VQEA 5JEAJ 4OO1G 4JV5L 1V9PA 4DR3Q 5IP9H 3F2BA 2R7ZH 3OTOQ 3L0OA 1J6QA 1GKHA 1RL2A 1SLJA 5LMNQ 4JI1L 2VQFL 3S1RH 1EQRA 1OTCA 1L1OA 4A3CH 3CD6A 4A3GH 2JEBI 3IRBA 2JE6I 1UE5A 5IYDG 2JA9A 1M90C 2WP8J 1VQ4A 1C9OA 3PSIA 4P73A 2R7DA 3TS0A 3AFPA 4KHPQ 2QGQA 2ASBA 1OXTA 1Y14B 4IPGA 3S15H 1L1OC 1VQLA 1IL2A 2UUAL 2MNAA 3CCMA 2GVAA 3TREA 1IZ6A 3OTOL 1P8LA 3M3YH 3I4MG 4JYAL 1UE6A 4JI3L 2WFWA 3KJPA 4GN3B 2I5HA 3I56A 2F52A 5C0XJ 3FKIH 2CKZB 3S1NH 4DV7Q 2UXCL 2Z0SA 3RN5A 3W5OA 5C4JH 4X64L 1QVFA 3JAMi 4JI6L 4P74A 4JI3Q 2PI2A 2K50A 1KHIA 1TWGH 2EIFA 1VQCA 1YNXA 1SRUA 1E1OA 4GLAC 4A3LH 4AYBE 2RHQB 4P75A 1YVCA 1QUQB 2AWOA 2K5NA 2ZJQA 4GN4B 3G4SA 4TVAB 3HOVH 1G291 2NZHA 1PH7A 2UU9Q 2UUCL 1VCIA 1PYSB 2UXDQ 2R7ZG 1N8RC 5JJKA 1AH9A 2JA8H 4BBSG 1A62A 2VZAA 1SR3A 3OYYA 1IYJB 1TWCH 5BR8Q 2ZM6Q 4DAYB 5IYBH 3GTKH 2PQAB 1PYBA 1UWVA 2AMCB 1FJGQ 1CUKA 3HKZE 3UDFA 1JT8A 1BBWA 4JBWA 4R4QA 2IX1A 3AEVA 1PH1A 1K73C 3KOJA 2E8GA 2HIVA 5C3EG 3I7FA 3STBD 2ZTDA 1N9WA 4OX9L 3HOZH 2L15A 4B3RL 4JBMA 4GKJQ 5M5YH 3TS2A 4GOPC 1PH8A 3CXCA 4B3ML 2BA1A 3STBC 3PO3H 4LFBL 5GROA 3D31A 4DV0L 2K14A 5M3MG 2Q2HA 3CCRA 1N36Q 1HZCA 4NPSA 4DV1L 3SGIA 2OWOA 1EOVA 2N3SA 2MO1A 4A3IG 1JJGA 2A1AA 1XMOL 4IJLA 2R7FA 5FJ8G 1HZBA 4IOCA 1S3OA 2N49A 1LUZA 5C4XH 5LMNW 4OX9Q 4DV2Q 3NEMA 4UP9A 4LF4L 2F4VQ 2HIXA 4HJ5A 4Y7NH 3BJUA 1JJCB 4LF6L 4WJ3M 3J81c 1X3EA 4A3JH 1IBMQ 4JI5Q 2K4KA 3I4OA 3WWVA 5GAHC 3J7ZC 1XMQQ 4HJ9A 3CC2A 4X66L 1X55A 3AQQA 4GNXB 3UE0A 4DR3L 4LUZA 1PA6A 4JCVE 1PFSA 1BVSA 2BH2A 2VNUD 2UUBL 2MQHA 1EIYB 2FXQA 4R4CA 4DAMA 2VW9A 1OXXK 1K8AC 4LFCL 4DUZL 1OXVA 1HR0W 5M3FG 4R4OA 1HNXQ 4LF8Q 2YV5A 1Q1BA 3AFQA 1PHJA 3K7AH 1A63A 5IE8A 2NZOA 2B63H 5M5WH 1QVCA 2I5MX 4A4IA 1GM5A 2OCEA 2N78A 5IYBG 1D8LA 1VQPA 2XTIA 1S72A 2ATWA 4X66Q 3KYHC 4JBJA 4A3EG 3RLOA 1UE1A 2ZJPA 2UUAQ 4JI7Q 2PNHA 4X62L 1I94L 3L2PA 2R6GA 4L5SA 3CCUA 1UEBA 2LSSA 1NY4A 3NENA 4C2MH 2RCNA 4KI0A 1X6OA 3HFZB 4DV6L 3VDYA 1N34L 1WCMG 1OXSC 4RMFA 4UP8A 4C3JH 4GOPB 1MJEA 1B70B 4YHHQ 2Q2UA 4B3TL 3HOYG 1ASZA 3PUXA 4XIGS 4IJHA 3FKIG 1WJJA 1VQ8A 2UXDL 3CCLA 3RLFA 3HOUH 5ELOA 3TRZA 5M3MH 1VQ6A 4A3CG 2E5LL 1VQIA 1N36L 1VQNA 2UXBQ 1WI5A 4HIMA 4LWCA 1CKOA 1XNQL 3KDFB 1IBML 2RHSB 4ALPA 4DR4Q 1O7IA 1OXUA 4DV6Q 3KF6A 2NN6I 2ID0A 2CFMA 4P72A 3JC66 1M1KC 4YWKA 1HNZL 2R92G 4JBKA 3K81C 2D0PA 4JI1Q 2VQFQ 2KHIA 4O0AA 1YEZA 3HOYH 4BY7G 3W1BA 3GTMH 4WJ4A 1TWHH 2JEAI 2R93G 4L5QA 3F2DA 3ERSX 2KBNA 5IP7H 4HJ8A 4HIDA 4GLXA 4A3FG 1VQKA 4DV4Q 1CKNA 4ME3A 1R9TH 4LF5Q 4O2DA 5GAGC 3I55A 3M4QA 3HOUG 4DR7L 2B3GA 3KF6B 4GS3A 4LF9Q 3A5ZB 3UDIA 1XNQQ 3ER0A 4MZ9A 1KL9A 2WAQG 4YY3Q 4LFBQ 4MTNA 4IFDJ 1A0IA 4YWLA 1YI2A 1LTLA 3PF5A 3CCEA 4LF7Q 4IFDG 1EIFA 4R1JA 4DR5Q 3U4VA 4BBRG 4JG2A 1FGUA 1K8GA 1W2BA 2VUMH 3G71A 4JI2Q 2Q2TA 1XTDA 3RNUA 5C3EH 3MXNB 5LMUQ 4BY7H 2GN5A 3M9BA 1E22A 2QA4A 4A3KH 1N34Q 5JEAG 1Z9FA 4PZ7A 1V1QA 1XNRQ 3U58A 3CP0A 4NXNL 2HT1A 1I5FA 2LXKA 1VS0A 1FVIA 4AYBG 3ICEA 2Q2IA 2C35B 1LM0A 4GOPA 4GKKQ 1YZ6A 2E2IH 1X56A 2HQLA 3ULLA 2AHOB 2JA6H 4BBSH 3NELA 4DR5L 5IYCH 2JQOA 1Z47A 3RZOH 1X3GA 4BBRH 4LFAL 5GADC 4KHPL 4JI4L 1GVPA 4DR7Q 4DR4L 2K5HA 3PGZA 3G6EA 1VQ5A 3S1QH 4EX5A 2ZTEA 4PG3A 1D7QA 1DGSA 4LFCQ 3M85A 1J5EL 4JYAQ 2Y0SE 1K9MC 4XTCS 4B3MQ 1EYGA 3A0JA 2WAQE 3HOZG 3RR5A 3S16H 3CF5A 1Y1VG 2CWPA 4BA2I 1Q7YC 1PH6A 1IBLL 2ALYB 4R4IA 3GTOH 5IWAL 4LFAQ 1SROA 1RIPA 1I50H 5FLMH 1JJ2A 1E3PA 1Q8KA 3U50C 2ZJRA 4A3IH 3GD7A 4IFDI 1SFOH 1YITA 4JOIC 1I6HH 1G6PA 1Q86C 4HIOA 3ZJYC 1EQQA 3J81j 2YTXA 2CQOA 2VS1A 5IP9G 3K80C 5LMNL 2RF4A 1VQJA 2XGTA 4X65L 4DV3Q 1YHAA 4JI6Q 1B7YB 1X54A 2OQKA 3PIOA 1TXYA 3CCJA 1A8VA 2B63G 3HKSA 3KLWA 5E7NA 4GN5A 4DV0Q 3CC7A 1IBLQ 1C0AA 1Y1VH 4OO1I 2E5LQ 2E2JH 3E0EA 4BA1I 4A3JG 1EFWA 3RLNA 2UU9L 1HJPA 1PH5A 3UE1A 4DNIA 1Q82C 1HNWL 1KRSA 4QGUA 3T1HQ 3A5UA 3HOXG 1N33Q 4OXPA 5EAYA 5GAEC 4B3TQ 1HR0L 1HZAA 1Q46A 2LXJA 3I2ZA 4DPGA 1NTGA 5HGQA 3GTJH 2UXBL 4HIKA 1NE3A 1YJNA 1K3RA 2UXCQ 2ZTCA 2GVBA 3OW2A 4NXNQ 3PV0A 3S24A 3H3VH 1QZGA 3H3VI 4JI0L 4A93H 5C44H 4JI7L 4GKKL 1UE7A 4RG1A 4DK3C 4NB3A 5FLXc 5AJ3Q 5IY0A 1Q1EA 3UDXA 2NN6G 2D0OA 4DR2Q 3PO2H 3GDEA 5IWAQ 3BU2A 1N32L 3CCQA 1W3SA 1HH2P 4DR6L 2UUCQ 3PF4A 4DV5Q 4B3SQ 1Q12A 5DLQE 3H15A 4LF9L 3J80i 2R93H 3T1YQ 3KDFA 1KXLA 4A3FH 4DR2L 2OTJA 4X6AH 2V1CC 1PH2A 2JA8G 4A3BG 3M7NA 4YCWA 2KHJA 1E7ZA 4OONA 3T1YL 1YJWA 4JI0Q 3RN2A 5JJIA 3L7ZC 4L5TA 3CCVA 4BXXG 1XMQL 2VY3A 4MNOA 1K0RA 4X64Q 1XJVA 4EQ5A 4A75A 1I3QH 2BA0A 1LYLA 1CSQA 2BH8A 1Y1WG 3FP9A 1YHBA 2Y0SG 4PMWA 5LMUL 4A3KG 3T1HL 4DUYL 1N33L 3RZDH 3HOVG 3G48A 3KFUA 1HNZQ 1U0LA 4GKJL 3PUWA 2YYZA 1S40A 1L2FA 5IT9c 3PO3G 4NXMQ 4IPCA 4TQUS 2JK8A 5J3BA 4DKAC 1VQOA 2OTLA 3I4NH 1QVGA 2H5XA 1QZHA 4OWWB 3FHWA 1MIUA 4BXXH 2JA6G 2EXDA 3H0GH 3Q8DA 1AE3A 2B29A 2EQSA 5HY6A 4HJAA 1X9NA 1C7YA 2YTYA 4C3IH 1VQ7A 2HHHL 4NXML 3UDGA 2KENA 1YIJA 4A3GG 4BY1G 2IX0A 3CQZH 3E9IA 4DR1Q 4DUYQ 5C4XG 3S14H 3J7A5 1B8AA 2VUMG 4YHHL 1TWAH 2IHEA 4GLVB 1G51A 2Z6KA 2CCZA 4LF6Q 1P16A 3DM3A
chains in the Genus database with same CATH superfamily
5JEAH 1PH4A 4L5RC 3K0XA 1DCIA 1S4ZA 3MOYA 1YBYA 2F0GA 1K83H 4A3GB 2JN4A 1SNPA 2ZQRA 1SBBB 2UUBQ 3S2DB 4LUOA 3HOWG 1Q81C 2WKCA 5IYCG 4K0KL 4IPHA 1CQFA 4DR6Q 1SN8A 1VQBA 4DA2A 2TSSA 3CPFA 1I4GA 2L5TA 2OQ0A 1JB7A 2KUMA 3MEFA 3FKIB 1EWIA 3D4WA 1XYIA 1XPRA 5EKLA 4MN3A 2N88A 2K04A 1RJTA 2AWNA 1RHPA 1EUJA 3LX0A 2FINB 4X3UA 1JOKA 1CA5A 4A3MG 1PRTF 2JA7G 4CBVA 3BDCA 2MFIA 5I9OA 1ET9A 4A3DH 4LF8L 1IXRA 3BVZA 4H02A 1SE8A 1L1OB 3CMEA 1TY2A 3E9HA 1EU4A 4KHZA 3TN2A 1WTOA 4FP5D 4ZCKA 5GQOA 4PNYA 4B3RQ 2RVLA 4JOIA 4U1AA 2AUKA 1PH3A 5KIXA 2I07B 1KIXA 4K2LA 2NVQH 2PPYA 4OWXB 4DV4L 5CGKA 1K28A 2L11A 4H44C 1S5FD 4X62Q 2KCTA 1KD1C 4JI4Q 4IPDA 2VQEQ 4RHRA 1QB5D 1EEID 3CRLC 2I5LX 1KRTA 1NJIC 2DNCA 2IY5B 3B6YA 1JE5A 3OW7A 4OHJA 5IGGA 5ISRA 4JI5L 4QY7A 3PIPA 2D62A 3GTQH 4AQYL 3S2HB 3BZDB 5BR8L 1SYCA 2JA7H 2K52A 5E3FA 1HFNA 2HCIA 4K3WA 4ZU2A 1Y1VB 4A3MH 2UZFA 1MJCA 1JWMD 1CSPA 4GNXA 1AE2A 4APVA 3NPPA 4JI8L 3ADDA 2DY8A 5KNDA 5H1SE 4RAUC 5G3LD 2L4NA 2RQXA 5ELNA 3DM1A 4P2CB 1HRJA 2MGSA 3NBIA 2NVXH 4CKCA 2K75A 3S1MB 1EY0A 2NVTH 1EL0A 3JAME 4UDUC 3F2BA 5CV8A 3L0OA 4IZDA 4I65A 4RKBA 4BY1B 5LMNQ 1SLJA 4IUPA 1OTCA 4A3CH 1EQRA 3CD6A 4FF1A 3QB3A 2K6AA 1WD0A 1U4LA 4CKEA 1HA5A 1M90C 4P73A 4CJ0B 4OIJA 4G7ZC 4K2NA 2ASBA 4ELWA 3P5MA 2F0LA 2GVAA 3OTOL 1P8LA 5BN3A 1UEAB 3I4MG 3A8KE 1EU3A 4JYAL 1X3QA 3T16A 2WFWA 2I5HA 1NR2A 4IUQA 2Z4HA 3P1HA 2UXCL 3PZKA 3W5OA 2EYHA 4X64L 5C4JH 1QVFA 1ENFA 4CJ2C 2PI2A 3K5NA 1TWGH 4I52A 1D6EC 1AEXA 1GJXA 1SRUA 1E1OA 3P75A 2NN6H 1PH7A 4WORA 3C1EA 1MSGA 3WOEA 2K05A 4QMGA 3D3RA 4FF3A 2JA8H 5LHY1 4RA8A 1A62A 2VZAA 1A2TA 1A2UA 3NSWA 3AB9A 4ZYSA 2PQAB 3BYYB 4OL7A 1SE3A 4A3FB 2NBFA 2Z8LA 3UDFA 4JK1C 5CV6A 3EROA 1Y1WB 5IT9L 3DEPA 3KOJA 1PH1A 1WTPA 2F0NA 2XRSD 4OX9L 4GOPC 2VUMB 5EBCA 2EYFA 1F9RA 1WTHA 3AJMA 1HZCA 2OWOA 2N3SA 3NQIA 4N9TA 4IJLA 3VYTA 1CTMA 1HZBA 3CRKC 3TSSA 4OX9Q 3JAML 4DV2Q 4LF4L 3OWEB 3NXWA 1VF7A 4LF6L 5E4XA 2MP1A 4FZWC 2K4KA 2F0OA 3J7ZC 1XMQQ 4HJ9A 3FPUB 4X66L 2VNUD 4G57A 5EJWA 1EIYB 1IYVA 2VW9A 4FNFA 4H0LC 3A4MA 1Z7TA 1OXVA 1HR0W 1HNXQ 3MYBA 5K5PA 1PHJA 3AFQA 2F03A 2XIWA 5KNBA 2NZOA 5M5WH 1OO9B 1QVCA 4A4IA 1GM5A 4K8JA 3SK5A 1S72A 1VQPA 2ATWA 1LTGD 1QG7A 1UE1A 3C2PA 2JXMB 2PNHA 3VYUA 4JOTA 3L2PA 2PQEA 1UEBA 2B2UC 4DV6L 3VDYA 2RCNA 1X6OA 1WCMG 1OXSC 3V2TA 4GOPB 2Q2UA 4B3TL 1QCBD 1RTNA 2B2WA 4YHHQ 3WOFA 2F4IA 4BBSB 1VQ8A 1PYWD 4KJNA 2R3ZA 1QNUA 1VQIA 1W6JA 4HIMA 1ET6A 1IBML 2F0UA 3HOUB 1Q90A 4DR4Q 1STHA 4DV6Q 3H91A 5C9GA 4K14A 3KF6A 3R8BA 2R92G 1IKLA 4JBKA 2D0PA 2IEXA 4X3TA 5J1ZA 1SYFA 4C1NK 1TWHH 2JEAI 2R93G 1D5XC 1VQKA 1R9TH 4N8FA 4ABNA 3KF6B 4GS3A 3A5ZB 2AQ1B 2WAQG 1AFPA 4IQZA 2F1MA 1WTWA 5HURA 1YI2A 1CK1A 1EIFA 1GHJA 4BBRG 2VUMH 5CC4A 3KLRA 4JI2Q 2K5WA 5C3EH 5LMUQ 1IHZA 5JEAG 4PZ7A 3D4DA 3CP0A 2HT1A 3HGBA 1YNND 4KKUA 1VS0A 4AYBG 3ICEA 1KLUD 4RGTA 2BE5C 1F77A 3ULLA 2JSOA 4OO1H 3ADCA 5IYCH 2JQOA 1X3GA 2DJGC 5CORA 5GADC 4KHPL 4DU9A 2A73B 3PGZA 4C56C 4PG3A 4V190 3M85A 2DNEA 3S16B 4KY6A 4ZAIA 4NDXA 4XYQA 3VR2A 2XWBB 2M2LA 3S16H 4LK1C 3PIO3 1PH6A 5IWAL 3J81L 1SROA 1FNVA 2K7VA 4DXFA 4F88A 3U50C 3J81E 2ZJRA 4A3IH 1JE4A 4M8AA 3FRPB 4OG1A 1IW7C 3K80C 1KDBA 4DV3Q 1EIGA 4WCZA 4JI6Q 2OQKA 2M00A 1NZYB 3PIOA 3HOXB 3D6WA 2C9OA 2DUBA 4GN5A 4DV0Q 1BF4A 1EEFD 4OO1I 2B2TC 2E5LQ 4A3JG 2RKSA 1Q82C 1WTXA 4XT1B 1A6XA 4QGUA 1N33Q 5EAYA 3I4LA 1HTPA 3MXUA 4DPGA 3URYA 5JJZA 1SEBD 2UXCQ 2ZTCA 2GVBA 1R9TB 3V05A 2E74C 3S24A 1QZGA 4JI0L 4U18A 1TWHB 5IOCA 4DK3C 4RG1A 1R4PB 3KF8A 2D0OA 2K01A 5IWAQ 3PO2H 1EQTA 1PTOH 1W3SA 1GXDC 2GA4B 2AQ3B 3PF4A 4DN4M 1PZID 2R93H 3SLLA 1TIID 4ZQ3A 4DR2L 3S15B 4Z9CB 4A3MB 2CH4W 3M7NA 4JI0Q 4OONA 5JJIA 3CCVA 3SHLA 4MNOA 4X64Q 4RKLA 2BA0A 1B3QA 1V1OA 1CQVA 1CSQA 3V96A 1Z6HA 2RA4A 4RGMA 3NBHA 4A3KG 1JICA 5KJPA 1KLGD 3HOVG 3G48A 1UAPA 3PUWA 2YYZA 1S40A 1L2FA 3PO3G 1D1KA 2F0EA 4TQUS 3GV3A 5M5YB 1Q52A 2EXDA 4NNQA 1X9NA 2EQSA 1C7YA 4DR7Q 4ODGA 2HHHL 3Q22A 4C3IH 3T8AA 1SNDA 4QUFA 2BDNA 4HCSA 4HSPA 3R9SA 4NXML 3IFTA 5C3XA 3QG1A 1FD7D 4KV6A 1AW7A 4DUYQ 1JOOA 3NQTA 5C4XG 4J8QA 2B2UA 4JWVA 4KN7C 1HTLD 3RD4A 1P16A 3O13A 3GQBA 1BXTA 3T4AC 1EWHA 5G3LF 3CMAA 3FDTA 4KLKA 2A69D 3N6RA 1XPUA 4IUTA 5M3FH 1HZ9A 3Q24A 4UY8C 2WKDA 1E24A 3DUZA 1AP0A 1E1TA 5FJ8H 2PQAA 4AYBB 2Y0SB 2QQ3A 1PV4A 1NMGA 1BBUA 4OIKA 3I8ZA 4RH6A 2L0CA 4YY3L 5EPLA 5E4WC 3PUVA 1Y1WH 1HNWQ 4K6DA 5FLMG 1KQSA 2IHFA 3H0GG 1FYCA 5JBXA 5JJLA 4MTKA 4FZWA 2PW5A 5M9OA 4DR1L 1PVOA 4A3BB 3KLSX 4DV7L 3LGJA 1TS4A 4A93G 3W8HB 5JPNC 2R61A 3QWNA 4LW1A 3BYTB 5KEEA 5CV4A 4YCUA 5D3DA 1SNQA 3EIVA 1QE6A 1WFQA 3Q1TA 1BKBA 1X32A 3M4PA 1ESRA 3ITPA 3HKZG 4QQBX 1GUOA 3S9WA 1HUNA 3NBHB 3KF8B 3X3MA 3PO2B 3U4ZA 3A7LA 2DGYA 3R2IA 1I6HB 4MOUA 2PZWA 2IT1A 3PUZA 4RCOA 1XPOA 4LNQA 4IUNA 1TU2B 4Y52H 4QJFA 4ZLTF 1HUMA 1QJOA 2ICIA 3RZDB 4FXGC 5KYIA 2Z6BA 3I4MH 2LS01 1NMFA 2WB1E 2F0VA 2EXZA 4DNTB 3Q23A 3J7YW 5DM63 3OIQA 3F1ZA 2CW0D 2NVTB 4U19A 4A76A 1HNXL 4EVOA 3S1MH 4P71A 4HEDA 1JQYD 1RJNA 2X6GA 3PUYA 4UPAA 1SMYD 3K5OA 2Z4IA 4ELXA 1O7LA 1CZGA 4JC0A 2EJ5A 3DEOA 1BQQT 3EQLC 2QEXA 1STEA 4QL5A 4FXDA 1V43A 2MO0A 3TEHB 1YHQA 3A74A 1F9SA 3AU7A 3ULJA 2QCPX 5C44B 3DLLA 4K0KQ 3FDUA 4HJ7A 3ULPA 3C1FA 5TSSA 2KEDA 1VQ9A 1VQEA 2J0TD 2NTTA 4DR3Q 3OWFA 5IP9H 3GTJB 1J6QA 3VA7A 3QJYA 1RL2A 4JI1L 3S1RH 1PZJD 3IRBA 3GTQB 1E2VA 1UE5A 1X3PA 5IYDG 5C0XH 1PFMA 1LO5D 1SNOA 1FNUA 2WP8J 4K6LA 3ZYYX 1VQ4A 1ML0D 2KVMA 3AFPA 1TR5A 2QGQA 4IPGA 1L1OC 2NUCA 2MNAA 2F0WA 3VR5A 3TREA 1B44D 2UUAL 3M3YH 2KOLA 1LTAD 5CBAE 3M4YA 4JI3L 5FO7B 4K5VA 1CHQD 4OGQC 1LABA 2F52A 2C5CA 1JB3A 2CKZB 3S1NH 4DV7Q 1II3A 2D2CC 2CQAA 3JAMi 5KYLA 4P74A 3PMFA 1J9OA 1KDAA 1KHIA 1YNXA 4AYBE 1KNEA 2QKIC 1AN8A 2BDOA 2ZJQA 3VR4A 1HZDA 3BVGA 3KBXA 1G8ZD 1PRTB 3EJIA 3MVVA 3E5SA 3K7AB 4DAPA 3S1QB 1HQRD 5D65A 1AH9A 3DHQA 3W3AA 4HCEA 1IYJB 3TZDA 5FO8B 1NR4A 2A6HC 3DMUA 4DAYB 3G7LA 1UWVA 1CUKA 2O5IC 3D6CA 2PNRC 4ELSA 5L37A 4QIIA 1SJHD 4B08A 5CV5A 1K73C 2E8GA 5C3EG 4C3IB 2H1EA 2ZTDA 3OSOA 2L15A 3C46A 4B3RL 4GKJQ 1G6ZA 3KQFA 3P20A 5M5YH 2JP1A 2E2DC 5A2QL 3GTOB 3STBC 3BVMA 1PLFA 3KUPA 4RCNA 3OHXC 4NMZA 4XQQA 3SR1A 1STYA 1ILQA 4NPSA 5C4HA 4DV1L 1EOVA 3TP7A 3TBIB 4O42A 2BE5D 3OMGA 3F2UA 1SDFA 5LMNW 5COYA 1D2BA 2F4VQ 4KK7A 3BJUA 2ZXPA 4WJ3M 5A2QE 4A3JH 3I4OA 4KHVA 3CC2A 1WD1A 1JOQA 4DR3L 1PA6A 4LUZA 3A8IE 4DAMA 1PTOB 1OXXK 1MGSA 5IIFA 1EYCA 4R4OA 4LF8Q 4IURA 1Q1BA 3K7AH 5DM73 4XQJA 5E1FA 2OCEA 3GV6A 3MA2B 3RLOA 2ZJPA 2UUAQ 1LT5D 2F0IA 4R8NA 4L5SA 3CCUA 1JORA 4IZCA 2LSSA 1EY5A 4C2MH 1N34L 3HFZB 3J7AF 1EF8A 2FMCA 3HOYG 1ASZA 4XIGS 3TLFA 5CV9A 2EJGC 3FKIG 1WJJA 1KNAA 3FPPA 5FLXL 3CCLA 5ELOA 3TRZA 4HMIA 1VQNA 1BNZA 3I72A 1CKOA 1W6KA 3KDFB 4ZK9B 1HHVA 4ALPA 1O7IA 3VR6A 2NN6I 4YWKA 1HNZL 4JFCA 4A3IB 3K81C 2VQFQ 4PV1C 2HDMA 3W1BA 1D5ZC 4NKLA 3F2DA 2KBNA 5IP7H 4HIDA 3S1RB 1CKNA 4ME3A 4DR7L 1PFBA 3UDIA 1XNQQ 4MZ9A 4YY3Q 5JBWA 1PTOC 4MTNA 4LFBQ 1PFNA 4YWLA 4IALA 3MZ5A 1F2MA 4LF7Q 1NZYA 1PRTC 2H4OA 3U4VA 1FGUA 1W2BA 2Q2TA 4BY7H 3MXNB 2GN5A 4OEMB 1CZWA 1E22A 4A3KH 1N34Q 2IPKD 1V1QA 5DEHA 1XNRQ 3U58A 5JVH3 1SNCA 1I5FA 5KGUA 1FVIA 1RKNA 2CW0C 1LM0A 2X69A 3I3CA 2K1BA 4GKKQ 2A6EC 1EOTA 2E2IH 1TWCB 5J39A 1Z47A 4OLQA 4LFAL 1IL8A 4F8MA 2OF1A 1GVPA 4DR4L 4O1NA 3TRRA 2KA7A 1CM9A 3MEHA 1EQVA 1DGSA 1YNJD 4JYAQ 1RODA 2RDGA 3MAQA 4KNPA 4B3MQ 4XTCS 3HOVB 1DM0B 4E6IA 2F3WA 4DAVA 3HOZG 1LT6D 3BDLA 3VA5A 3DWQA 3K0YA 2CWPA 1Q7YC 1BCPD 1LTTD 4JPBW 1HA6A 1I50H 2QDBA 1I6HH 2MPMA 1G6PA 1TQOA 4IFDH 1EQQA 4FXKC 2YTXA 4RHSA 5FO9B 2CH4A 5LMNL 4HAEA 1UX5A 1B7YB 1A3UA 1A8VA 1K3BC 5C4ZA 2XNAC 3KLWA 5E7NA 1FR3A 1IBLQ 1C0AA 1Y1VH 4V0BA 1SYEA 2Z1CA 2UU9L 1EFWA 3RLNA 1HJPA 1PH5A 1B3AA 4DNIA 1HNWL 1KRSA 3OMCA 4IUVA 4OXPA 5GAEC 1HZAA 1Q46A 2LXJA 1R4QB 5HGQA 3IAYA 4IZBA 1K0SA 3H3VH 1CHPD 4A93H 2B2VA 2K5QA 5I6YA 3AMUA 1UE7A 4NB3A 1U4RA 2E76C 3GP7A 3GDEA 3BU2A 2OT2A 1HH2P 2NVQB 3A54A 4DV5Q 4B3SQ 5DLQE 2PBPA 5KNCA 3KDFA 4JW0A 3A8JE 2FJ2A 1PH2A 3SE0A 2JA8G 3N52A 1SYDA 3HP3A 3MFGA 2KHJA 1SE4A 3RN2A 4L5TA 4BXXG 1XMQL 2VY3A 1K0RA 4I7AA 1I3QB 4A75A 1I3QH 3LWUA 1ONLA 2BH8A 3OOCA 3FP9A 4XQNA 1Y1WG 5LMUL 3T1HL 1EF9A 3KFUA 1U0LA 3L9AX 3CHBD 5IT9c 2B63B 2RBMA 4IPCA 5I2XA 1RTOA 1MIUA 3Q8DA 3H0GH 2B29A 2A68D 5FKAC 3M3YB 1LACA 1TY0A 3E9IA 1TS2A 2KHSA 1GHKA 4N9PA 1B8AA 1EYDA 2A68C 3KK7A 2Z6KA 2CCZA 1TS5A 1E0BA 3C3LA 3SDZA 1XNRL 4NP5A 3S2DH 1SE2A 2IWHA 5CMDA 2G5DA 3EBEA 2ES2A 3NE5B 1T5EA 3BZCA 2D9UA 4EMLA 1TWAB 3CW2C 4MIUA 4CDDC 2SEBD 2OXPA 1BO0A 1TWFB 3VYSA 3F8TA 4DV2L 1VMPA 4BS9A 4JYLA 1EY7A 4KN4C 1DCZA 3K8AA 3S17H 3TQYA 3I4NG 1TT2A 2WB1G 4AIMA 3D0FA 4IO9A 3K7UC 5KRUA 4CJ1B 1WCMH 1SMXA 3GTKB 2L9HA 2PMZE 2F4VL 2Q8IB 3J81i 5C6AA 3M4OH 1ZXTA 3J80c 4JI8Q 5JPMC 4LF7L 1L0XB 2E2HH 1F9QA 1S5CD 5AFWA 4ZUIA 3T56B 4BY1H 5CBEE 1UNSA 1LTID 1X65A 1B9NA 5CYUA 4DV3L 1ASYA 4EGVA 1GD7A 2VB2X 2NVXB 1DD2A 4DF7A 4ZRZA 3HOXH 4GEHB 3CCSA 2F0DA 4L8JA 4IOAA 1WTQA 5JVG3 1PH9A 3JAMc 1SJED 1XMOQ 5C0XG 3GTPH 3SEBA 4CHTB 2L55A 1TWFH 3NTIA 5IGFA 1CKMA 4WFN3 1RDPD 3PCOB 4HN7A 4EQNA 1YNNC 2VQEL 4DV5L 4B3SL 2Z6KC 2RDFA 5K36H 1WTRA 5IYDH 1E2WA 5T1IA 5LL6X 3S2HH 1VDZA 4F47A 5ELFA 4J15A 5C0XI 3A4NA 4OWTB 1Y69U 4ULLA 2IL8A 3QR8A 4C3HH 3FMCA 4A3BH 2PCFB 1F2ZA 3F2CA 4AQYQ 4DV1Q 2PZTA 1Q3LA 1B2TA 1VQMA 1IBKQ 1DXMA 2KCCA 4TKOB 2VL6A 2JYOA 3KJOA 5EPJA 1IBKL 3ONAB 1L0YB 2A8VA 4FDBA 4NEKA 1ICFB 4K8IA 3D8GA 3L3OC 2JA5B 1VQGA 4POFA 3J80E 1CKNB 5JEAJ 1GUNA 1V9PA 2F0FA 3OTOQ 5IGEA 2JEBI 4GZYC 3D4RA 2JA9A 3MXGA 2AQ2B 3TZUA 4DXGA 3QXIA 1Y14B 1KABA 3H3VC 3K5MA 1VQLA 1IL2A 1MBYA 4H7BA 4B9XA 1IYUA 3NP8A 1HQMC 3KJPA 3FKIH 5EBDA 4FF4A 3RN5A 4JI3Q 2EIFA 5ELCA 1VQCA 4GLAC 3TP6A 2MJ8A 4KY5A 3T13A 4P75A 1MSHA 4I42A 2AWOA 2K5NA 4GN4B 3G4SA 4TVAB 5LL6S 4Q5VA 5M5WB 2QILA 3QOLA 5JJKA 2G9HD 4BBRB 1SR3A 1BCPB 5BR8Q 5BN5A 2QDLA 2B2YA 1O7YA 1PYBA 2AMCB 1A15A 1RJMA 1CI3M 1JT8A 1BBWA 2IX1A 5I9PA 2HIVA 3I7FA 1ZEQX 2ZT9C 1N9WA 3E3XA 3STBD 3HOZH 3P7JA 4C3JG 3TS2A 1PH8A 1DZ1A 4RGNA 2BA1A 3PO3H 4LFBL 5GROA 3D31A 4DV0L 4DGZA 2B8FA 1CT1D 2XSCA 1Q8IA 2MO1A 1JR0D 2A1AA 3RSIA 5FJ8G 2R7FA 1NNXA 1S3OA 2N49A 1LUZA 4DFAA 5C4XH 3GTMB 5C5LA 4DNRB 4UP9A 2HIXA 4HJ5A 3S1NB 1DOMA 1A3VA 4MI2A 1X3EA 3BDOA 2E2IB 3WWVA 3HEJA 3ERQA 3IFDA 2A69C 3PIP3 2EZVA 1X55A 4GNXB 3NUCA 4F87A 1PFSA 1BVSA 2UUBL 2MQHA 2FXQA 2EVBA 1XXGA 5IODA 1K8AC 4LFCL 4Y7NB 5M3FG 5D14A 2EPBA 2YV5A 5IE8A 1PMRA 2I5MX 2A6HD 2N78A 1IKMA 3RQGA 1VMCA 4K5XA 5EPKA 4A3EG 1EFID 1CFMA 4X62L 2F6QA 5EQ0A 1ICWA 5F2DA 4ZKCB 3X3NA 1NY4A 5EKIA 3L8JA 4XT3B 3L8IA 2HD3A 3SK8A 4RMFA 2IW3A 4UP8A 4C3JH 1MJEA 4RWSC 4I4ZA 3OC7A 1F9PA 5M3MH 1VQ6A 3DWAA 4A3CG 2MHVA 1Q51A 1N36L 2K32A 2UXBQ 1WI5A 3R0OA 3TP8A 1V8QA 2KECA 4R9WA 4ME5A 1S5ED 1OXUA 2DJFC 4FF2A 5C3WA 2ID0A 4P72A 5C3EB 2IJ0A 5DAUA 5I4DA 4BY7G 1YEZA 3NWSA 3GTMH 5C4XB 4C2MB 4QB4A 4L5QA 4HJ8A 4A3FG 3EFXD 4GLXA 5JOBA 3I4MB 4DV4Q 3HOUG 3I55A 2D5DA 1U4PA 3HG9A 2Z9HA 3ER0A 4J1MA 1A0IA 1B50A 4J6HA 4IFDG 2P63A 2MUYA 4WRDA 3RMHA 4DR5Q 4JG2A 4NW2A 2DY7A 2EDGA 2EYPA 1XTDA 3HKZB 3RNUA 4UHVA 1Z9FA 2JA6B 5NUCA 2PYKA 3A56A 4NXNL 3MFYA 1MJ3A 1EYAA 1LTSD 2FFKB 1RD9D 1X56A 2HQLA 1WZ8A 2AHOB 3I91A 4BBSH 3NELA 2SOBA 4DR5L 2RDHA 1KTKA 2ICEC 4BBRH 4DK0A 1SFOB 1WVLA 3H6MA 4G4KA 4JI4L 2K5DA 3MXPA 4KD4A 1EY8A 1VQ5A 4EX5A 2KJXA 3T89A 2ZTEA 3I47A 4LFCQ 1JCKB 4KKSA 2Y0SE 2EE1A 1EYGA 2WAQE 4H13C 3O4XE 3A55A 3CF5A 2KCNA 1G91A 2BOSA 3MC0B 4BA2I 2ALYB 4R4IA 3GTOH 1SSOA 4LFAQ 5C5MA 1U4MA 1BBXC 3A7AB 3HOYB 2HQEA 1Q8KA 4JVZA 4TSSA 3GD7A 1SFOH 1YITA 4JOIC 2YU9B 1Q86C 4KMUC 2NB0A 3ZJYC 2F0KA 3J81j 4HIOA 2CQOA 5IP9G 4A3EB 2RF4A 5IT9E 1X54A 3CCJA 1PXUA 1TXYA 1C48A 4KJOA 2F0QA 4G7HC 3QOJA 3HZXA 1C8CA 1F2LA 5M3FB 1ZKOA 2E2JH 3QIAA 2N55A 3E0EA 4B9WA 4BA1I 1Y8OB 1WTVA 4HR7B 2NWGA 3HOXG 2TMPA 5DNFA 2BCOA 2KEEA 1DOLA 3ND8A 4CGYB 5I6WA 1HR0L 1STAA 1NE3A 2PMZB 1YJNA 1K3RA 3OW2A 3H3VI 5ELBA 1AZQA 4HSVA 4JI7L 3AM1A 3HS0C 5IY0A 3E0JA 3UDXA 1SMYC 2EY1A 2PPBC 4DR2Q 4KD3A 1STNA 4PMBA 1YNJC 3CCQA 4DR6L 3FEWX 1Q12A 4LF9L 3H15A 3K59A 1KXLA 3T1YQ 1I4RA 4A3FH 1UUPA 1Y64B 3HRXA 1EY4A 1BUVT 1JWUD 3RUZA 2OTJA 1FGBD 2V1CC 4LMQD 1O80A 2EYMA 2K03A 1UIYA 1YJWA 5ELEA 3L7ZC 1PZKD 1MD2D 1K83B 2EYJA 4EQ5A 1TKWB 1LYLA 1SYBA 3G6JB 3G64A 1YHBA 3MWYW 2K28A 3DWPA 4PMWA 2B2TA 1N33L 3IL8A 3W2DA 5J3BA 2R93B 2JK8A 4DKAC 2FMMA 3CQZB 3I4NH 1QVGA 4QIWB 3GTPB 2JA6G 3H09A 4HJAA 5HY6A 1EY3A 2LMCB 1VQ7A 1LT4D 3BS1A 1DUBA 4TRDA 3UDGA 2KENA 2FW2A 3MTSA 1EY6A 1QNKA 2IX0A 4BY1G 4DR1Q 2PO4A 3S14H 1XWEA 1SYGA 4YHHL 2IHEA 4F7XA 4IZ8A 1K8MA 1L0WA 5D3IB 1WOCA 1G2SA 2A5HA 3OPOA 2F0PA 1NAPA 2CVRA 3GTLH 5AJ3L 3J80L 1NBWA 3CPWA 1B53A 1KAWA 2I46A 2EYOA 3I70A 2F3IA 1X3FA 1WCMB 1RF2D 3W8IB 4YWMA 3S14B 4GNXC 3EN2A 1TVXA 3S17B 1YJ9A 3QK8A 1TS3A 3HOZB 3AYHB 5CV7A 4BWGB 5HGTA 4UP7A 3LWEA 2LFNA 1VQDA 4ILWA 1O7ZA 4JCSA 1MI2A 2B2WC 3HOWH 1U5KA 2NVYH 5IP7G 3U9OA 5K36G 4AH6A 3EA6A 1O78A 1EZ6A 4LF4Q 2JA5G 3GO5A 4WJWA 1QUQA 1KDCA 2AUJD 5ELDA 3U9SA 2HHHQ 1T5XD 1KAAA 3SVMA 2O2LD 5C44G 3BZKA 1N32Q 3H94A 2CWAA 1U9RA 2JJQA 3VYRA 3NTKA 3NHHA 1KC8C 2R7ZB 1FJGL 2DUDA 1WYDA 3WDNA 4X65Q 3Q0GA 1JWSD 1F2YA 4K2KA 4PZ8A 1DYQA 3RQEA 1Y8NB 3PQIA 1B9MA 3CU7A 4MHEA 1J5EQ 1QWYA 4PMCA 3IKJA 2WIIB 1STBA 1I94Q 1C4QA 1EZ8A 2KCMA 3GTGB 2HCCA 1VQFA 4QIWE 1GO3E 3T88A 2AKWB 1LLRD 2B8GA 4DK6C 1HXYD 1NSNS 4YCVA 2KQ3A 5FOBB 4IN3A 4FYDA 4R4TA 2A19A 2R92H 4DUZQ 3PO2G 3Q0AA 4IUUA 2QEJC 1H95A 2L12A 2N8NA 3NK9A 1JMCA 1VQAA 2ZM6L 4A3DB 2IX3A 3RZOB 3ADBA 2E2JB 1T9HA 1QILA 3R93A 1VF5C 2B39A 4YIJA 3FVQA 4LUVA 2K5VA 2JA5H 1B1ZA 2HUGA 1GUTA 1XX8A 1SXTA 2YTVA 3SK6A 2I0QA 3W1GA 3GTGH 4LF5L 2M9VA 1HR0Q 4A3DG 3M7GA 4A3EH 5M5XH 2VB3X 1FL0A 3R2TA 1MKHA 3CAMA 2YU9H 4ZUJA 4A3LG 4ZKBB 1ZYRD 4PZ6A 1GUSA 1VQHA 3QO2A 4JV5Q 1Y8PB 4PQXA 1D1IA 3CC4A 1B4OA 4JI2L 1DOKA 2P5ZX 4POGA 1LV9A 2PI2E 1NCVA 1H9KA 4OO1G 4JV5L 4C3IG 2R7ZH 1FNWA 1GKHA 1XTCD 2VQFL 1L1OA 4A3GH 3E6ZX 2F0HA 1HCZA 2JE6I 2RSNA 4UAIA 1C9OA 3BG3A 3PSIA 4CKBA 2R7DA 3TS0A 4KHPQ 1OXTA 3S15H 2F0TA 2NVYB 3CCMA 1IZ6A 3HOWB 3R9TA 1UE6A 2F0JA 1SAPA 5J22A 4GN3B 4X3SA 3I56A 5C0XJ 4QUCA 2Z0SA 4KY7A 4X3KA 1I50B 1ENAA 4JI6L 2K50A 4HTHA 1MHWC 1M8AA 2WV6D 3H81A 1K8OA 4A3LH 2RHQB 1YVCA 1QUQB 4CDEC 2Q8RE 4RGOS 2VXWA 3HOVH 1G291 2NZHA 2UU9Q 3TP5A 2UUCL 2NTSA 1VCIA 1EY9A 1PYSB 2UXDQ 2R7ZG 1IW7D 1STGA 1N8RC 4BBSG 1RCVD 3OYYA 3RQFA 1TWCH 2ZM6Q 5IYBH 3K5LA 4LAAA 3GTKH 2G9DA 1FJGQ 1S5BD 3HKZE 5M3MB 4JBWA 4R4QA 1J8IA 2F0SA 4C1NI 3AEVA 4KTAA 3T53B 4A3KB 4QIJA 4BY7B 2JA8B 4JBMA 5EGTA 1PDQA 4C3JB 2SNMA 3I4NB 3CXCA 4B3ML 3Q6SA 3DXJC 3SK4A 2OEOA 2K14A 2EY2A 2L1BA 5M3MG 2Q2HA 4RFBA 3CCRA 4EQPA 1N36Q 1HFGA 3SGIA 2CHBD 4A3IG 2LKVA 1JJGA 3HINA 1XMOL 3EVQA 4IOCA 4I7ZC 2XN9C 4L63B 3NEMA 5C4JB 3SXHA 3VR3A 4Y7NH 1LT3D 1JJCB 2PW7A 1BCPC 1JC7A 3J81c 3K6OA 4DAYA 1IBMQ 4JI5Q 5GAHC 1E2ZA 3K58A 4ID6A 3AQQA 1D5MC 3UE0A 2BH2A 4JCVE 4DK1A 1V1PB 4R4CA 5IGCA 5FK9C 5JAVA 1BR9A 4DUZL 3H0GB 3CKIB 2O4XA 3A4LA 2WB1B 2WAQB 1M4VA 4U673 1A63A 1BDOA 2B63H 5IYBG 1D8LA 2XTIA 4XXEA 4X66Q 3KYHC 4JBJA 3H02A 4JI7Q 2V4DA 1I94L 2R6GA 3NENA 4KI0A 1GUGA 5A35A 1B70B 2F0MA 3PUXA 2VX2A 1I4XA 3MXNA 4IJHA 4OELB 2UXDL 2EYLA 4LJZC 3RLFA 1H9JA 3HOUH 4FO2A 2E5LL 2WINB 1V1PA 2WACA 4LWCA 2EY6A 1XNQL 1LTRD 3TDQA 4K5WA 2RHSB 4A3JB 2NYZD 1UX4A 1M1KC 2CFMA 4EQOA 3JC66 2ENBA 2XVSA 4JI1Q 2KHIA 4O0AA 3HOYH 2JA7B 4WJ4A 4A93B 3Q0JA 2PZUA 3ERSX 3ND9A 1PTOD 4LF5Q 4QF4A 4O2DA 5GAGC 4G7OC 3M4QA 2B3GA 3KLSA 4LF9Q 1NUCA 2EY5A 2Q8TA 1I4PA 4R8IA 2QF7A 1KL9A 4IFDJ 1LTLA 4FVMA 3PF5A 3CCEA 5CR3A 4R1JA 1K8GA 3G71A 2HW5A 1GOZA 3M9BA 2QW7A 2QA4A 5M5XB 2ZXOA 2LXKA 1BCPF 1H9SA 2Q2IA 2C35B 4GOPA 2FHTA 1YZ6A 2JA6H 2EJMA 4M1UB 2ZXRA 3RZOH 1G2TA 3I90A 5EKKA 1PTOF 4N8X1 2K5HA 3G6EA 2XRQD 3S1QH 1DJRD 1H9SB 1CA6A 1D7QA 1JXZA 1J5EL 4QCLA 1ZYRC 2R92B 5FLXE 1K9MC 1I6VC 3A0JA 2VREA 3OIPA 4XYOA 2RSOA 3RR5A 5IGBA 1Y1VG 3J7AV 1IBLL 1ENCA 4Q0FA 1HPCA 2J7ZA 3NWTA 1RIPA 5FLMH 1JJ2A 1E3PA 1QOHA 4IFDI 1ESFA 1BOSA 4C3HG 1I4QA 1LTBD 1PRTD 4KKTA 2VS1A 3MHBA 1VQJA 2XGTA 4X65L 1YHAA 2B63G 3HKSA 2NZ1D 4FJWD 4U68A 3SWXA 2A74C 3CC7A 4HMJA 4C3HB 2DN8A 3UE1A 4CDCC 1H9MA 3A5UA 3T1HQ 4B3TQ 2EJFC 2RCFA 5I2YA 3I2ZA 3GTJH 1NTGA 3LNNA 2UXBL 4HIKA 3R3OA 3QXZA 4NXNQ 2E75C 3PV0A 2K33A 1I4HA 1TWGB 5C44H 4GKKL 5FLXc 5AJ3Q 1Q1EA 1EWCA 3TMEA 4S3SA 2NN6G 1N32L 2EOTA 2UUCQ 3J80i 2F3VA 3HRZC 4X6AH 2B2YC 4A3BG 4YCWA 1E7ZA 3T1YL 2LY7A 2SDFA 2ZQQA 4XDXA 3GTLB 1XJVA 1H9RA 1SNMA 1S5DD 2E2HB 1A3TA 2Y0SG 3T51B 2GTRA 2SNSA 1ILPA 4DUYL 3M4OB 3RZDH 1AZPA 1HNZQ 2A6ED 2HDLA 4GKJL 2J4XA 1EIHA 3PO3B 4CDFC 4NXMQ 1VQOA 2OTLA 5BN4A 2H5XA 3NTHA 1QZHA 4OWWB 2XWJB 3FHWA 4BXXH 3KBGA 1AE3A 3UI2A 3K57A 2YTYA 5IGDA 1DONA 3I73A 1YIJA 4L6TB 1GUWA 4A3GG 3CQZH 2O5JC 2B2VC 3J7A5 2VUMG 5T1GA 1TWAH 4GLVB 2X6LA 1G51A 4LF6Q 2FBMA 3DM3A
chains in the Genus database with same CATH topology
1L0WA 1PH4A 4L5RC 3K0XA 1XNRL 3S2DH 1WOCA 1YBYA 1K83H 3GTLH 3CMAA 3EBEA 5AJ3L 1NBWA 2ES2A 4LUOA 3CPWA 1KAWA 3BZCA 4KLKA 2UUBQ 3HOWG 1Q81C 1XPUA 5IYCG 4K0KL 5M3FH 1HZ9A 4IPHA 2F3IA 1X3FA 1SN8A 4UY8C 4DR6Q 1VQBA 1E24A 3CW2C 3W8IB 4YWMA 1E1TA 5FJ8H 2PQAA 4GNXC 3CPFA 2OQ0A 1JB7A 3EN2A 3F8TA 3MEFA 4DV2L 1PV4A 1EWIA 1NMGA 1YJ9A 1BBUA 1XPRA 3AYHB 3K8AA 3S17H 3TQYA 4YY3L 4UP7A 3PUVA 1Y1WH 3I4NG 2AWNA 1VQDA 5FLMG 1EUJA 2WB1G 1HNWQ 4AIMA 3HOWH 1KQSA 3D0FA 2IHFA 3H0GG 1U5KA 3K7UC 2NVYH 4IO9A 5IP7G 5K36G 5JJLA 4AH6A 1WCMH 1SMXA 2PMZE 4LF4Q 2JA5G 2F4VL 3J81i 4A3MG 3GO5A 4DR1L 3M4OH 1QUQA 1PVOA 2JA7G 3J80c 4JI8Q 2MFIA 4DV7L 4LF7L 3LGJA 4A3DH 2E2HH 4LF8L 2HHHQ 1IXRA 4H02A 4A93G 3W8HB 1SE8A 5C44G 1L1OB 4LW1A 3CMEA 3BZKA 1N32Q 3E9HA 2CWAA 2JJQA 4KHZA 4BY1H 1KC8C 5GQOA 1FJGL 1X65A 2DUDA 4YCUA 4B3RQ 3EIVA 1WYDA 4X65Q 1WFQA 4JOIA 4DV3L 1ASYA 1GD7A 1BKBA 3M4PA 4PZ8A 3HOXH 3HKZG 3RQEA 4QQBX 4GEHB 1PH3A 3CCSA 1KIXA 2NVQH 1J5EQ 4OWXB 4DV4L 3NBHB 3KF8B 3U4ZA 4IOAA 2DGYA 1I94Q 1PH9A 4X62Q 2KCTA 3JAMc 1KD1C 4JI4Q 4IPDA 5C0XG 2VQEQ 2IT1A 2KCMA 3PUZA 1VQFA 1XMOQ 1XPOA 1TWFH 3GTPH 4QIWE 4LNQA 1CKMA 1GO3E 2AKWB 4Y52H 4DK6C 3PCOB 4QJFA 2I5LX 1KRTA 2VQEL 1NJIC 4YCVA 4DV5L 4B3SL 2IY5B 2Z6KC 3B6YA 1JE5A 2A19A 4R4TA 2R92H 4JI5L 4DUZQ 3PO2G 5IYDH 4QY7A 3PIPA 3I4MH 2D62A 3GTQH 1NMFA 1H95A 3S2HH 2N8NA 4AQYL 1JMCA 2WB1E 1VQAA 5BR8L 2ZM6L 2JA7H 2K52A 4J15A 5C0XI 3A4NA 4OWTB 3ADBA 4C3HH 4A3BH 1T9HA 3F1ZA 3F2CA 4AQYQ 4A76A 4LUVA 2K5VA 4DV1Q 1HNXL 2JA5H 3S1MH 4P71A 4A3MH 1MJCA 3PUYA 4UPAA 1VQMA 2YTVA 1IBKQ 2I0QA 1CSPA 3W1GA 4GNXA 3GTGH 1AE2A 4APVA 4LF5L 1HR0Q 4A3DG 4JC0A 4A3EH 5M5XH 2QEXA 1FL0A 2VL6A 4QL5A 1MKHA 3KJOA 4JI8L 3CAMA 1V43A 2MO0A 3TEHB 3ADDA 1YHQA 5H1SE 1IBKL 2YU9H 3A74A 3ULJA 4PZ6A 1VQHA 2A8VA 4JV5Q 5ELNA 4FDBA 3DLLA 4K0KQ 4HJ7A 3ULPA 3CC4A 2NVXH 4JI2L 4POGA 2K75A 1VQGA 2PI2E 4POFA 2NVTH 1CKNB 1VQ9A 1VQEA 5JEAJ 4OO1G 4JV5L 1V9PA 4DR3Q 5IP9H 3F2BA 2R7ZH 3OTOQ 3L0OA 1J6QA 1GKHA 1RL2A 1SLJA 5LMNQ 4JI1L 2VQFL 3S1RH 1EQRA 1OTCA 1L1OA 4A3CH 3CD6A 4A3GH 2JEBI 3IRBA 2JE6I 1UE5A 5IYDG 2JA9A 1M90C 2WP8J 1VQ4A 1C9OA 3PSIA 4P73A 2R7DA 3TS0A 3AFPA 4KHPQ 2QGQA 2ASBA 1OXTA 1Y14B 4IPGA 3S15H 1L1OC 1VQLA 1IL2A 2UUAL 2MNAA 3CCMA 2GVAA 3TREA 1IZ6A 3OTOL 1P8LA 3M3YH 3I4MG 4JYAL 1UE6A 4JI3L 2WFWA 3KJPA 4GN3B 2I5HA 3I56A 2F52A 5C0XJ 3FKIH 2CKZB 3S1NH 4DV7Q 2UXCL 2Z0SA 3RN5A 3W5OA 5C4JH 4X64L 1QVFA 3JAMi 4JI6L 4P74A 4JI3Q 2PI2A 2K50A 1KHIA 1TWGH 2EIFA 1VQCA 1YNXA 1SRUA 1E1OA 4GLAC 4A3LH 4AYBE 2RHQB 4P75A 3DM3A 1QUQB 2AWOA 2K5NA 2ZJQA 4GN4B 3G4SA 4TVAB 3HOVH 1G291 2NZHA 1PH7A 2UU9Q 2UUCL 1VCIA 1PYSB 2UXDQ 2R7ZG 1N8RC 5JJKA 1AH9A 2JA8H 4BBSG 1A62A 2VZAA 1SR3A 3OYYA 3RQFA 1IYJB 1TWCH 5BR8Q 2ZM6Q 4DAYB 5IYBH 3GTKH 2PQAB 1PYBA 1UWVA 2AMCB 1FJGQ 1CUKA 1RJMA 3HKZE 3UDFA 1JT8A 1BBWA 4JBWA 4R4QA 2IX1A 3AEVA 1PH1A 1K73C 3KOJA 2E8GA 2HIVA 5C3EG 3I7FA 3STBD 2ZTDA 1N9WA 4OX9L 3HOZH 2L15A 4B3RL 4JBMA 4GKJQ 5M5YH 3TS2A 4GOPC 1PH8A 3CXCA 4B3ML 2BA1A 3STBC 3PO3H 4LFBL 5GROA 3D31A 4DV0L 2K14A 5M3MG 3AJMA 2Q2HA 3CCRA 1N36Q 1HZCA 4NPSA 4DV1L 3SGIA 2OWOA 1EOVA 2N3SA 2MO1A 4A3IG 1JJGA 2A1AA 1XMOL 4IJLA 2R7FA 5FJ8G 1HZBA 4IOCA 1S3OA 2N49A 1LUZA 5C4XH 5LMNW 4OX9Q 4DV2Q 3NEMA 4UP9A 4LF4L 2F4VQ 2HIXA 4HJ5A 4Y7NH 3BJUA 1JJCB 4LF6L 4WJ3M 3J81c 1X3EA 4A3JH 1IBMQ 4JI5Q 2K4KA 3I4OA 3WWVA 5GAHC 3J7ZC 1XMQQ 4HJ9A 3CC2A 4X66L 1X55A 3AQQA 4GNXB 3UE0A 4DR3L 4LUZA 1PA6A 4JCVE 1PFSA 1BVSA 2BH2A 2VNUD 2UUBL 2MQHA 1EIYB 2FXQA 4R4CA 4DAMA 2VW9A 1OXXK 1K8AC 4LFCL 3A4MA 4DUZL 1OXVA 1HR0W 5M3FG 3A4LA 4R4OA 1HNXQ 4LF8Q 2YV5A 1Q1BA 3AFQA 1PHJA 3K7AH 1A63A 5IE8A 2NZOA 2B63H 5M5WH 1QVCA 2I5MX 4A4IA 1GM5A 2OCEA 2N78A 5IYBG 1D8LA 1VQPA 2XTIA 1S72A 3RQGA 2ATWA 4X66Q 3KYHC 4JBJA 4A3EG 3RLOA 1UE1A 2ZJPA 2UUAQ 4JI7Q 2PNHA 4X62L 1I94L 3L2PA 2R6GA 4L5SA 3CCUA 1UEBA 2LSSA 1NY4A 3NENA 4C2MH 2RCNA 4KI0A 1X6OA 3HFZB 3L8JA 4DV6L 3L8IA 3VDYA 1WCMG 1N34L 1OXSC 4RMFA 4UP8A 4C3JH 4GOPB 1MJEA 1B70B 4YHHQ 2Q2UA 4B3TL 3HOYG 1ASZA 3PUXA 4XIGS 4IJHA 3FKIG 1WJJA 1VQ8A 2UXDL 3CCLA 3RLFA 3HOUH 5ELOA 3TRZA 5M3MH 1VQ6A 4A3CG 2E5LL 1VQIA 1N36L 1VQNA 2UXBQ 1WI5A 4HIMA 4LWCA 1CKOA 1XNQL 3KDFB 1IBML 2RHSB 4ALPA 4DR4Q 1O7IA 1OXUA 4DV6Q 3KF6A 1UX4A 2ID0A 2CFMA 2NN6I 3JC66 4P72A 4YWKA 1M1KC 1HNZL 2R92G 4JBKA 3K81C 2D0PA 4JI1Q 2VQFQ 2KHIA 4O0AA 1YEZA 3HOYH 4BY7G 3W1BA 3GTMH 4WJ4A 1TWHH 2JEAI 2R93G 4L5QA 3F2DA 3ERSX 2KBNA 5IP7H 4HJ8A 4HIDA 4GLXA 4A3FG 1VQKA 4DV4Q 1CKNA 4ME3A 1R9TH 4LF5Q 4O2DA 5GAGC 3I55A 3M4QA 3HOUG 4DR7L 2B3GA 3KF6B 4GS3A 4LF9Q 3A5ZB 3UDIA 1XNQQ 3ER0A 4MZ9A 1KL9A 2WAQG 4YY3Q 4LFBQ 4MTNA 4IFDJ 1A0IA 4YWLA 1YI2A 1LTLA 3PF5A 3CCEA 4LF7Q 4IFDG 2P63A 1EIFA 4R1JA 4DR5Q 3U4VA 4BBRG 4JG2A 1FGUA 1K8GA 1W2BA 2VUMH 3G71A 4JI2Q 2Q2TA 1XTDA 3RNUA 5C3EH 3MXNB 5LMUQ 4BY7H 2GN5A 3M9BA 1E22A 2QA4A 4A3KH 1N34Q 5JEAG 1Z9FA 4PZ7A 1V1QA 1XNRQ 3U58A 3CP0A 4NXNL 2HT1A 1I5FA 2LXKA 1VS0A 1FVIA 4AYBG 3ICEA 2Q2IA 2C35B 1LM0A 4GOPA 4GKKQ 1YZ6A 2E2IH 2HQLA 1X56A 3ULLA 2AHOB 2JA6H 4BBSH 3NELA 4DR5L 3ADCA 5IYCH 2JQOA 1Z47A 3RZOH 1X3GA 4BBRH 4LFAL 5GADC 4KHPL 4JI4L 1GVPA 4DR7Q 4DR4L 2K5HA 3PGZA 3G6EA 1VQ5A 3S1QH 4EX5A 2ZTEA 4PG3A 1D7QA 1DGSA 4LFCQ 3M85A 1J5EL 4JYAQ 2Y0SE 1K9MC 4XTCS 4B3MQ 1EYGA 3A0JA 2WAQE 3HOZG 3RR5A 3S16H 3O4XE 3CF5A 1Y1VG 2CWPA 4BA2I 1Q7YC 1PH6A 1IBLL 2ALYB 4R4IA 3GTOH 5IWAL 4LFAQ 1SROA 1RIPA 1I50H 5FLMH 1JJ2A 1E3PA 1Q8KA 3U50C 2ZJRA 4A3IH 3GD7A 4IFDI 1SFOH 1YITA 4JOIC 1I6HH 1G6PA 1Q86C 4HIOA 3ZJYC 1EQQA 3J81j 2YTXA 2CQOA 2VS1A 5IP9G 3K80C 5LMNL 2RF4A 1VQJA 2XGTA 1UX5A 4X65L 1YHAA 4DV3Q 1B7YB 1X54A 2OQKA 3PIOA 1TXYA 3CCJA 4JI6Q 1A8VA 2B63G 3HKSA 3KLWA 5E7NA 4GN5A 4DV0Q 3CC7A 1IBLQ 1C0AA 1Y1VH 4OO1I 2E5LQ 2E2JH 3E0EA 4BA1I 4A3JG 1EFWA 3RLNA 2UU9L 1HJPA 1PH5A 3UE1A 4DNIA 1Q82C 1HNWL 1KRSA 4QGUA 3T1HQ 3A5UA 3HOXG 1N33Q 4OXPA 5EAYA 5GAEC 4B3TQ 1HR0L 1HZAA 1Q46A 2LXJA 3I2ZA 4DPGA 1NTGA 5HGQA 3GTJH 2UXBL 4HIKA 1NE3A 1YJNA 1K3RA 2UXCQ 2ZTCA 2GVBA 3OW2A 4NXNQ 3PV0A 3S24A 3H3VH 1QZGA 3H3VI 4JI0L 4A93H 5C44H 4JI7L 4GKKL 3AM1A 1UE7A 4RG1A 4DK3C 4NB3A 5FLXc 5AJ3Q 5IY0A 1Q1EA 3UDXA 2NN6G 2D0OA 4DR2Q 3PO2H 3GDEA 5IWAQ 3BU2A 1N32L 3CCQA 1W3SA 1HH2P 4DR6L 2UUCQ 3PF4A 4DV5Q 4B3SQ 1Q12A 5DLQE 3H15A 4LF9L 3J80i 2R93H 3T1YQ 3KDFA 1KXLA 4A3FH 4DR2L 1Y64B 2OTJA 4X6AH 2V1CC 1PH2A 2JA8G 4A3BG 3M7NA 4YCWA 2KHJA 1E7ZA 4OONA 3T1YL 1YJWA 4JI0Q 3RN2A 5JJIA 3L7ZC 4L5TA 3CCVA 4BXXG 1XMQL 2VY3A 4MNOA 1K0RA 4X64Q 1XJVA 4EQ5A 4A75A 1I3QH 2BA0A 1LYLA 1CSQA 2BH8A 1Y1WG 3FP9A 1YHBA 2Y0SG 4PMWA 5LMUL 4A3KG 3T1HL 4DUYL 1N33L 3RZDH 3HOVG 3G48A 3KFUA 1HNZQ 1U0LA 4GKJL 3PUWA 2YYZA 1S40A 1L2FA 5IT9c 3PO3G 4NXMQ 4IPCA 4TQUS 2JK8A 5J3BA 4DKAC 1VQOA 2OTLA 3I4NH 1QVGA 2H5XA 1QZHA 4OWWB 3FHWA 1MIUA 4BXXH 2JA6G 2EXDA 4NNQA 3H0GH 1AE3A 2B29A 2EQSA 3Q8DA 5HY6A 4HJAA 1X9NA 2YTYA 4C3IH 1C7YA 1VQ7A 2HHHL 4NXML 3UDGA 2KENA 1YIJA 4A3GG 4BY1G 2IX0A 3CQZH 3E9IA 4DR1Q 4DUYQ 5C4XG 3S14H 3J7A5 1B8AA 2VUMG 4YHHL 1TWAH 4A3LG 2IHEA 4GLVB 1G51A 2Z6KA 2CCZA 4LF6Q 1P16A 1YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0W A;  1PH4 A;  4L5R C;  3K0X A;  1XNR L;  3S2D H;  1WOC A;  1YBY A;  1K83 H;  3GTL H;  3CMA A;  3EBE A;  5AJ3 L;  1NBW A;  2ES2 A;  4LUO A;  3CPW A;  1KAW A;  3BZC A;  4KLK A;  2UUB Q;  3HOW G;  1Q81 C;  1XPU A;  5IYC G;  4K0K L;  5M3F H;  1HZ9 A;  4IPH A;  2F3I A;  1X3F A;  1SN8 A;  4UY8 C;  4DR6 Q;  1VQB A;  1E24 A;  3CW2 C;  4YWM A;  1E1T A;  5FJ8 H;  2PQA A;  4GNX C;  3CPF A;  2OQ0 A;  1JB7 A;  3EN2 A;  3F8T A;  3MEF A;  4DV2 L;  1PV4 A;  1EWI A;  1NMG A;  1YJ9 A;  1BBU A;  1XPR A;  3AYH B;  3K8A A;  3S17 H;  3TQY A;  4YY3 L;  4UP7 A;  3PUV A;  1Y1W H;  3I4N G;  2AWN A;  1VQD A;  5FLM G;  1EUJ A;  2WB1 G;  1HNW Q;  4AIM A;  3HOW H;  1KQS A;  3D0F A;  2IHF A;  3H0G G;  1U5K A;  3K7U C;  2NVY H;  4IO9 A;  5IP7 G;  5K36 G;  5JJL A;  4AH6 A;  1WCM H;  1SMX A;  2PMZ E;  4LF4 Q;  2JA5 G;  2F4V L;  3J81 i;  4A3M G;  3GO5 A;  4DR1 L;  3M4O H;  1QUQ A;  1PVO A;  2JA7 G;  3J80 c;  4JI8 Q;  2MFI A;  4DV7 L;  4LF7 L;  3LGJ A;  4A3D H;  2E2H H;  4LF8 L;  2HHH Q;  1IXR A;  4H02 A;  4A93 G;  1SE8 A;  5C44 G;  1L1O B;  4LW1 A;  3CME A;  3BZK A;  1N32 Q;  3E9H A;  2CWA A;  2JJQ A;  4KHZ A;  4BY1 H;  1KC8 C;  5GQO A;  1FJG L;  1X65 A;  2DUD A;  4YCU A;  4B3R Q;  3EIV A;  1WYD A;  4X65 Q;  1WFQ A;  4JOI A;  4DV3 L;  1ASY A;  1GD7 A;  1BKB A;  3M4P A;  4PZ8 A;  3HOX H;  3HKZ G;  4QQB X;  1PH3 A;  3CCS A;  1KIX A;  2NVQ H;  1J5E Q;  4OWX B;  4DV4 L;  3NBH B;  3KF8 B;  3U4Z A;  4IOA A;  2DGY A;  1I94 Q;  1PH9 A;  4X62 Q;  2KCT A;  3JAM c;  1KD1 C;  4JI4 Q;  4IPD A;  5C0X G;  2VQE Q;  2IT1 A;  2KCM A;  3PUZ A;  1VQF A;  1XMO Q;  1XPO A;  1TWF H;  3GTP H;  4QIW E;  4LNQ A;  1CKM A;  1GO3 E;  2AKW B;  4Y52 H;  4DK6 C;  3PCO B;  4QJF A;  2I5L X;  1KRT A;  2VQE L;  1NJI C;  4YCV A;  4DV5 L;  4B3S L;  2IY5 B;  2Z6K C;  3B6Y A;  1JE5 A;  2A19 A;  4R4T A;  2R92 H;  4JI5 L;  4DUZ Q;  3PO2 G;  5IYD H;  4QY7 A;  3PIP A;  3I4M H;  2D62 A;  3GTQ H;  1NMF A;  1H95 A;  3S2H H;  2N8N A;  4AQY L;  1JMC A;  2WB1 E;  1VQA A;  5BR8 L;  2ZM6 L;  2JA7 H;  2K52 A;  4J15 A;  5C0X I;  4OWT B;  4C3H H;  4A3B H;  1T9H A;  3F1Z A;  3F2C A;  4AQY Q;  4A76 A;  4LUV A;  2K5V A;  4DV1 Q;  1HNX L;  2JA5 H;  3S1M H;  4P71 A;  4A3M H;  1MJC A;  3PUY A;  4UPA A;  1VQM A;  2YTV A;  1IBK Q;  2I0Q A;  1CSP A;  3W1G A;  4GNX A;  3GTG H;  1AE2 A;  4APV A;  4LF5 L;  1HR0 Q;  4A3D G;  4JC0 A;  4A3E H;  5M5X H;  2QEX A;  1FL0 A;  2VL6 A;  4QL5 A;  1MKH A;  3KJO A;  4JI8 L;  3CAM A;  1V43 A;  2MO0 A;  3TEH B;  1YHQ A;  1IBK L;  5H1S E;  2YU9 H;  4A3L G;  3A74 A;  3ULJ A;  4PZ6 A;  1VQH A;  2A8V A;  4JV5 Q;  5ELN A;  4FDB A;  3DLL A;  4K0K Q;  4HJ7 A;  3ULP A;  3CC4 A;  2NVX H;  4JI2 L;  4POG A;  2K75 A;  1VQG A;  2PI2 E;  4POF A;  2NVT H;  1CKN B;  1VQ9 A;  1VQE A;  5JEA J;  4OO1 G;  4JV5 L;  1V9P A;  4DR3 Q;  5IP9 H;  3F2B A;  2R7Z H;  3OTO Q;  3L0O A;  1J6Q A;  1GKH A;  1RL2 A;  1SLJ A;  5LMN Q;  4JI1 L;  2VQF L;  3S1R H;  1EQR A;  1OTC A;  1L1O A;  4A3C H;  3CD6 A;  4A3G H;  2JEB I;  3IRB A;  2JE6 I;  1UE5 A;  5IYD G;  2JA9 A;  1M90 C;  2WP8 J;  1VQ4 A;  1C9O A;  3PSI A;  4P73 A;  2R7D A;  3TS0 A;  3AFP A;  4KHP Q;  2QGQ A;  2ASB A;  1OXT A;  1Y14 B;  4IPG A;  3S15 H;  1L1O C;  1VQL A;  1IL2 A;  2UUA L;  2MNA A;  3CCM A;  2GVA A;  3TRE A;  1IZ6 A;  3OTO L;  1P8L A;  3M3Y H;  3I4M G;  4JYA L;  1UE6 A;  4JI3 L;  2WFW A;  3KJP A;  4GN3 B;  2I5H A;  3I56 A;  2F52 A;  5C0X J;  3FKI H;  2CKZ B;  3S1N H;  4DV7 Q;  2UXC L;  2Z0S A;  3RN5 A;  3W5O A;  5C4J H;  4X64 L;  1QVF A;  3JAM i;  4JI6 L;  4P74 A;  4JI3 Q;  2PI2 A;  2K50 A;  1KHI A;  1TWG H;  2EIF A;  1VQC A;  1YNX A;  1SRU A;  1E1O A;  4GLA C;  4A3L H;  4AYB E;  2RHQ B;  4P75 A;  1YVC A;  1QUQ B;  2AWO A;  2K5N A;  2ZJQ A;  4GN4 B;  3G4S A;  4TVA B;  3HOV H;  1G29 1;  2NZH A;  1PH7 A;  2UU9 Q;  2UUC L;  1VCI A;  1PYS B;  2UXD Q;  2R7Z G;  1N8R C;  5JJK A;  1AH9 A;  2JA8 H;  4BBS G;  1A62 A;  2VZA A;  1SR3 A;  3OYY A;  1IYJ B;  1TWC H;  5BR8 Q;  2ZM6 Q;  4DAY B;  5IYB H;  3GTK H;  2PQA B;  1PYB A;  1UWV A;  2AMC B;  1FJG Q;  1CUK A;  3HKZ E;  3UDF A;  1JT8 A;  1BBW A;  4JBW A;  4R4Q A;  2IX1 A;  3AEV A;  1PH1 A;  1K73 C;  3KOJ A;  2E8G A;  2HIV A;  5C3E G;  3I7F A;  3STB D;  2ZTD A;  1N9W A;  4OX9 L;  3HOZ H;  2L15 A;  4B3R L;  4JBM A;  4GKJ Q;  5M5Y H;  3TS2 A;  4GOP C;  1PH8 A;  3CXC A;  4B3M L;  2BA1 A;  3STB C;  3PO3 H;  4LFB L;  5GRO A;  3D31 A;  4DV0 L;  2K14 A;  5M3M G;  2Q2H A;  3CCR A;  1N36 Q;  1HZC A;  4NPS A;  4DV1 L;  3SGI A;  2OWO A;  1EOV A;  2N3S A;  2MO1 A;  4A3I G;  1JJG A;  2A1A A;  1XMO L;  4IJL A;  2R7F A;  5FJ8 G;  1HZB A;  4IOC A;  1S3O A;  2N49 A;  1LUZ A;  5C4X H;  5LMN W;  4OX9 Q;  4DV2 Q;  3NEM A;  4UP9 A;  4LF4 L;  2F4V Q;  2HIX A;  4HJ5 A;  4Y7N H;  3BJU A;  1JJC B;  4LF6 L;  4WJ3 M;  3J81 c;  1X3E A;  4A3J H;  1IBM Q;  4JI5 Q;  2K4K A;  3I4O A;  3WWV A;  5GAH C;  3J7Z C;  1XMQ Q;  4HJ9 A;  3CC2 A;  4X66 L;  1X55 A;  3AQQ A;  4GNX B;  3UE0 A;  4DR3 L;  4LUZ A;  1PA6 A;  4JCV E;  1PFS A;  1BVS A;  2BH2 A;  2VNU D;  2UUB L;  2MQH A;  1EIY B;  2FXQ A;  4R4C A;  4DAM A;  2VW9 A;  1OXX K;  1K8A C;  4LFC L;  4DUZ L;  1OXV A;  1HR0 W;  5M3F G;  4R4O A;  1HNX Q;  4LF8 Q;  2YV5 A;  1Q1B A;  3AFQ A;  1PHJ A;  3K7A H;  1A63 A;  5IE8 A;  2NZO A;  2B63 H;  5M5W H;  1QVC A;  2I5M X;  4A4I A;  1GM5 A;  2OCE A;  2N78 A;  5IYB G;  1D8L A;  1VQP A;  2XTI A;  1S72 A;  2ATW A;  4X66 Q;  3KYH C;  4JBJ A;  4A3E G;  3RLO A;  1UE1 A;  2ZJP A;  2UUA Q;  4JI7 Q;  2PNH A;  4X62 L;  1I94 L;  3L2P A;  2R6G A;  4L5S A;  3CCU A;  1UEB A;  2LSS A;  1NY4 A;  3NEN A;  4C2M H;  2RCN A;  4KI0 A;  1X6O A;  3HFZ B;  4DV6 L;  3VDY A;  1N34 L;  1WCM G;  1OXS C;  4RMF A;  4UP8 A;  4C3J H;  4GOP B;  1MJE A;  1B70 B;  4YHH Q;  2Q2U A;  4B3T L;  3HOY G;  1ASZ A;  3PUX A;  4XIG S;  4IJH A;  3FKI G;  1WJJ A;  1VQ8 A;  2UXD L;  3CCL A;  3RLF A;  3HOU H;  5ELO A;  3TRZ A;  5M3M H;  1VQ6 A;  4A3C G;  2E5L L;  1VQI A;  1N36 L;  1VQN A;  2UXB Q;  1WI5 A;  4HIM A;  4LWC A;  1CKO A;  1XNQ L;  3KDF B;  1IBM L;  2RHS B;  4ALP A;  4DR4 Q;  1O7I A;  1OXU A;  4DV6 Q;  3KF6 A;  2NN6 I;  2ID0 A;  2CFM A;  4P72 A;  3JC6 6;  1M1K C;  4YWK A;  1HNZ L;  2R92 G;  4JBK A;  3K81 C;  2D0P A;  4JI1 Q;  2VQF Q;  2KHI A;  4O0A A;  1YEZ A;  3HOY H;  4BY7 G;  3W1B A;  3GTM H;  4WJ4 A;  1TWH H;  2JEA I;  2R93 G;  4L5Q A;  3F2D A;  3ERS X;  2KBN A;  5IP7 H;  4HJ8 A;  4HID A;  4GLX A;  4A3F G;  1VQK A;  4DV4 Q;  1CKN A;  4ME3 A;  1R9T H;  4LF5 Q;  4O2D A;  5GAG C;  3I55 A;  3M4Q A;  3HOU G;  4DR7 L;  2B3G A;  3KF6 B;  4GS3 A;  4LF9 Q;  3A5Z B;  3UDI A;  1XNQ Q;  3ER0 A;  4MZ9 A;  1KL9 A;  2WAQ G;  4YY3 Q;  4LFB Q;  4MTN A;  4IFD J;  1A0I A;  4YWL A;  1YI2 A;  1LTL A;  3PF5 A;  3CCE A;  4LF7 Q;  4IFD G;  1EIF A;  4R1J A;  4DR5 Q;  3U4V A;  4BBR G;  4JG2 A;  1FGU A;  1K8G A;  1W2B A;  2VUM H;  3G71 A;  4JI2 Q;  2Q2T A;  1XTD A;  3RNU A;  5C3E H;  3MXN B;  5LMU Q;  4BY7 H;  2GN5 A;  3M9B A;  1E22 A;  2QA4 A;  4A3K H;  1N34 Q;  5JEA G;  1Z9F A;  4PZ7 A;  1V1Q A;  1XNR Q;  3U58 A;  3CP0 A;  4NXN L;  2HT1 A;  1I5F A;  2LXK A;  1VS0 A;  1FVI A;  4AYB G;  3ICE A;  2Q2I A;  2C35 B;  1LM0 A;  4GOP A;  4GKK Q;  1YZ6 A;  2E2I H;  1X56 A;  2HQL A;  3ULL A;  2AHO B;  2JA6 H;  4BBS H;  3NEL A;  4DR5 L;  5IYC H;  2JQO A;  1Z47 A;  3RZO H;  1X3G A;  4BBR H;  4LFA L;  5GAD C;  4KHP L;  4JI4 L;  1GVP A;  4DR7 Q;  4DR4 L;  2K5H A;  3PGZ A;  3G6E A;  1VQ5 A;  3S1Q H;  4EX5 A;  2ZTE A;  4PG3 A;  1D7Q A;  1DGS A;  4LFC Q;  3M85 A;  1J5E L;  4JYA Q;  2Y0S E;  1K9M C;  4XTC S;  4B3M Q;  1EYG A;  3A0J A;  2WAQ E;  3HOZ G;  3RR5 A;  3S16 H;  3CF5 A;  1Y1V G;  2CWP A;  4BA2 I;  1Q7Y C;  1PH6 A;  1IBL L;  2ALY B;  4R4I A;  3GTO H;  5IWA L;  4LFA Q;  1SRO A;  1RIP A;  1I50 H;  5FLM H;  1JJ2 A;  1E3P A;  1Q8K A;  3U50 C;  2ZJR A;  4A3I H;  3GD7 A;  4IFD I;  1SFO H;  1YIT A;  4JOI C;  1I6H H;  1G6P A;  1Q86 C;  4HIO A;  3ZJY C;  1EQQ A;  3J81 j;  2YTX A;  2CQO A;  2VS1 A;  5IP9 G;  3K80 C;  5LMN L;  2RF4 A;  1VQJ A;  2XGT A;  4X65 L;  4DV3 Q;  1YHA A;  4JI6 Q;  1B7Y B;  1X54 A;  2OQK A;  3PIO A;  1TXY A;  3CCJ A;  1A8V A;  2B63 G;  3HKS A;  3KLW A;  5E7N A;  4GN5 A;  4DV0 Q;  3CC7 A;  1IBL Q;  1C0A A;  1Y1V H;  4OO1 I;  2E5L Q;  2E2J H;  3E0E A;  4BA1 I;  4A3J G;  1EFW A;  3RLN A;  2UU9 L;  1HJP A;  1PH5 A;  3UE1 A;  4DNI A;  1Q82 C;  1HNW L;  1KRS A;  4QGU A;  3T1H Q;  3A5U A;  3HOX G;  1N33 Q;  4OXP A;  5EAY A;  5GAE C;  4B3T Q;  1HR0 L;  1HZA A;  1Q46 A;  2LXJ A;  3I2Z A;  4DPG A;  1NTG A;  5HGQ A;  3GTJ H;  2UXB L;  4HIK A;  1NE3 A;  1YJN A;  1K3R A;  2UXC Q;  2ZTC A;  2GVB A;  3OW2 A;  4NXN Q;  3PV0 A;  3S24 A;  3H3V H;  1QZG A;  3H3V I;  4JI0 L;  4A93 H;  5C44 H;  4JI7 L;  4GKK L;  1UE7 A;  4RG1 A;  4DK3 C;  4NB3 A;  5FLX c;  5AJ3 Q;  5IY0 A;  1Q1E A;  3UDX A;  2NN6 G;  2D0O A;  4DR2 Q;  3PO2 H;  3GDE A;  5IWA Q;  3BU2 A;  1N32 L;  3CCQ A;  1W3S A;  1HH2 P;  4DR6 L;  2UUC Q;  3PF4 A;  4DV5 Q;  4B3S Q;  1Q12 A;  5DLQ E;  3H15 A;  4LF9 L;  3J80 i;  2R93 H;  3T1Y Q;  3KDF A;  1KXL A;  4A3F H;  4DR2 L;  2OTJ A;  4X6A H;  2V1C C;  1PH2 A;  2JA8 G;  4A3B G;  3M7N A;  4YCW A;  2KHJ A;  1E7Z A;  4OON A;  3T1Y L;  1YJW A;  4JI0 Q;  3RN2 A;  5JJI A;  3L7Z C;  4L5T A;  3CCV A;  4BXX G;  1XMQ L;  2VY3 A;  4MNO A;  1K0R A;  4X64 Q;  1XJV A;  4EQ5 A;  4A75 A;  1I3Q H;  2BA0 A;  1LYL A;  1CSQ A;  2BH8 A;  1Y1W G;  3FP9 A;  1YHB A;  2Y0S G;  4PMW A;  5LMU L;  4A3K G;  3T1H L;  4DUY L;  1N33 L;  3RZD H;  3HOV G;  3G48 A;  3KFU A;  1HNZ Q;  1U0L A;  4GKJ L;  3PUW A;  2YYZ A;  1S40 A;  1L2F A;  5IT9 c;  3PO3 G;  4NXM Q;  4IPC A;  4TQU S;  2JK8 A;  5J3B A;  4DKA C;  1VQO A;  2OTL A;  3I4N H;  1QVG A;  2H5X A;  1QZH A;  4OWW B;  3FHW A;  1MIU A;  4BXX H;  2JA6 G;  2EXD A;  3H0G H;  3Q8D A;  1AE3 A;  2B29 A;  2EQS A;  5HY6 A;  4HJA A;  1X9N A;  1C7Y A;  2YTY A;  4C3I H;  1VQ7 A;  2HHH L;  4NXM L;  3UDG A;  2KEN A;  1YIJ A;  4A3G G;  4BY1 G;  2IX0 A;  3CQZ H;  3E9I A;  4DR1 Q;  4DUY Q;  5C4X G;  3S14 H;  3J7A 5;  1B8A A;  2VUM G;  4YHH L;  1TWA H;  2IHE A;  4GLV B;  1G51 A;  2Z6K A;  2CCZ A;  4LF6 Q;  1P16 A;  3DM3 A; 
#chains in the Genus database with same CATH topology
 5JEA H;  1PH4 A;  4L5R C;  3K0X A;  1DCI A;  1S4Z A;  3MOY A;  1YBY A;  2F0G A;  1K83 H;  4A3G B;  2JN4 A;  1SNP A;  2ZQR A;  1SBB B;  2UUB Q;  3S2D B;  4LUO A;  3HOW G;  1Q81 C;  2WKC A;  5IYC G;  4K0K L;  4IPH A;  1CQF A;  4DR6 Q;  1SN8 A;  1VQB A;  4DA2 A;  2TSS A;  3CPF A;  1I4G A;  2L5T A;  2OQ0 A;  1JB7 A;  2KUM A;  3MEF A;  3FKI B;  1EWI A;  3D4W A;  1XYI A;  1XPR A;  5EKL A;  4MN3 A;  2N88 A;  2K04 A;  1RJT A;  2AWN A;  1RHP A;  1EUJ A;  3LX0 A;  2FIN B;  4X3U A;  1JOK A;  1CA5 A;  4A3M G;  1PRT F;  2JA7 G;  4CBV A;  3BDC A;  2MFI A;  5I9O A;  1ET9 A;  4A3D H;  4LF8 L;  1IXR A;  3BVZ A;  4H02 A;  1SE8 A;  1L1O B;  3CME A;  1TY2 A;  3E9H A;  1EU4 A;  4KHZ A;  3TN2 A;  1WTO A;  4FP5 D;  4ZCK A;  5GQO A;  4PNY A;  4B3R Q;  2RVL A;  4JOI A;  4U1A A;  2AUK A;  1PH3 A;  5KIX A;  2I07 B;  1KIX A;  4K2L A;  2NVQ H;  2PPY A;  4OWX B;  4DV4 L;  5CGK A;  1K28 A;  2L11 A;  4H44 C;  1S5F D;  4X62 Q;  2KCT A;  1KD1 C;  4JI4 Q;  4IPD A;  2VQE Q;  4RHR A;  1QB5 D;  1EEI D;  3CRL C;  2I5L X;  1KRT A;  1NJI C;  2DNC A;  2IY5 B;  3B6Y A;  1JE5 A;  3OW7 A;  4OHJ A;  5IGG A;  5ISR A;  4JI5 L;  4QY7 A;  3PIP A;  2D62 A;  3GTQ H;  4AQY L;  3S2H B;  3BZD B;  5BR8 L;  1SYC A;  2JA7 H;  2K52 A;  5E3F A;  1HFN A;  2HCI A;  4K3W A;  4ZU2 A;  1Y1V B;  4A3M H;  2UZF A;  1MJC A;  1JWM D;  1CSP A;  4GNX A;  1AE2 A;  4APV A;  3NPP A;  4JI8 L;  3ADD A;  2DY8 A;  5KND A;  5H1S E;  4RAU C;  5G3L D;  2L4N A;  2RQX A;  5ELN A;  3DM1 A;  4P2C B;  1HRJ A;  2MGS A;  3NBI A;  2NVX H;  4CKC A;  2K75 A;  3S1M B;  1EY0 A;  2NVT H;  1EL0 A;  3JAM E;  4UDU C;  3F2B A;  5CV8 A;  3L0O A;  4IZD A;  4I65 A;  4RKB A;  4BY1 B;  5LMN Q;  1SLJ A;  4IUP A;  1OTC A;  4A3C H;  1EQR A;  3CD6 A;  4FF1 A;  3QB3 A;  2K6A A;  1WD0 A;  1U4L A;  4CKE A;  1HA5 A;  1M90 C;  4P73 A;  4CJ0 B;  4OIJ A;  4G7Z C;  4K2N A;  2ASB A;  4ELW A;  3P5M A;  2F0L A;  2GVA A;  3OTO L;  1P8L A;  5BN3 A;  1UEA B;  3I4M G;  3A8K E;  1EU3 A;  4JYA L;  1X3Q A;  3T16 A;  2WFW A;  2I5H A;  1NR2 A;  4IUQ A;  2Z4H A;  3P1H A;  2UXC L;  3PZK A;  3W5O A;  2EYH A;  4X64 L;  5C4J H;  1QVF A;  1ENF A;  4CJ2 C;  2PI2 A;  3K5N A;  1TWG H;  4I52 A;  1D6E C;  1AEX A;  1GJX A;  1SRU A;  1E1O A;  3P75 A;  2NN6 H;  1PH7 A;  4WOR A;  3C1E A;  1MSG A;  3WOE A;  2K05 A;  4QMG A;  3D3R A;  4FF3 A;  2JA8 H;  5LHY 1;  4RA8 A;  1A62 A;  2VZA A;  1A2T A;  1A2U A;  3NSW A;  3AB9 A;  4ZYS A;  2PQA B;  3BYY B;  4OL7 A;  1SE3 A;  4A3F B;  2NBF A;  2Z8L A;  3UDF A;  4JK1 C;  5CV6 A;  3ERO A;  1Y1W B;  5IT9 L;  3DEP A;  3KOJ A;  1PH1 A;  1WTP A;  2F0N A;  2XRS D;  4OX9 L;  4GOP C;  2VUM B;  5EBC A;  2EYF A;  1F9R A;  1WTH A;  3AJM A;  1HZC A;  2OWO A;  2N3S A;  3NQI A;  4N9T A;  4IJL A;  3VYT A;  1CTM A;  1HZB A;  3CRK C;  3TSS A;  4OX9 Q;  3JAM L;  4DV2 Q;  4LF4 L;  3OWE B;  3NXW A;  1VF7 A;  4LF6 L;  5E4X A;  2MP1 A;  4FZW C;  2K4K A;  2F0O A;  3J7Z C;  1XMQ Q;  4HJ9 A;  3FPU B;  4X66 L;  2VNU D;  4G57 A;  5EJW A;  1EIY B;  1IYV A;  2VW9 A;  4FNF A;  4H0L C;  3A4M A;  1Z7T A;  1OXV A;  1HR0 W;  1HNX Q;  3MYB A;  5K5P A;  1PHJ A;  3AFQ A;  2F03 A;  2XIW A;  5KNB A;  2NZO A;  5M5W H;  1OO9 B;  1QVC A;  4A4I A;  1GM5 A;  4K8J A;  3SK5 A;  1S72 A;  1VQP A;  2ATW A;  1LTG D;  1QG7 A;  1UE1 A;  3C2P A;  2JXM B;  2PNH A;  3VYU A;  4JOT A;  3L2P A;  2PQE A;  1UEB A;  2B2U C;  4DV6 L;  3VDY A;  2RCN A;  1X6O A;  1WCM G;  1OXS C;  3V2T A;  4GOP B;  2Q2U A;  4B3T L;  1QCB D;  1RTN A;  2B2W A;  4YHH Q;  3WOF A;  2F4I A;  4BBS B;  1VQ8 A;  1PYW D;  4KJN A;  2R3Z A;  1QNU A;  1VQI A;  1W6J A;  4HIM A;  1ET6 A;  1IBM L;  2F0U A;  3HOU B;  1Q90 A;  4DR4 Q;  1STH A;  4DV6 Q;  3H91 A;  5C9G A;  4K14 A;  3KF6 A;  3R8B A;  2R92 G;  1IKL A;  4JBK A;  2D0P A;  2IEX A;  4X3T A;  5J1Z A;  1SYF A;  4C1N K;  1TWH H;  2JEA I;  2R93 G;  1D5X C;  1VQK A;  1R9T H;  4N8F A;  4ABN A;  3KF6 B;  4GS3 A;  3A5Z B;  2AQ1 B;  2WAQ G;  1AFP A;  4IQZ A;  2F1M A;  1WTW A;  5HUR A;  1YI2 A;  1CK1 A;  1EIF A;  1GHJ A;  4BBR G;  2VUM H;  5CC4 A;  3KLR A;  4JI2 Q;  2K5W A;  5C3E H;  5LMU Q;  1IHZ A;  5JEA G;  4PZ7 A;  3D4D A;  3CP0 A;  2HT1 A;  3HGB A;  1YNN D;  4KKU A;  1VS0 A;  4AYB G;  3ICE A;  1KLU D;  4RGT A;  2BE5 C;  1F77 A;  3ULL A;  2JSO A;  4OO1 H;  3ADC A;  5IYC H;  2JQO A;  1X3G A;  2DJG C;  5COR A;  5GAD C;  4KHP L;  4DU9 A;  2A73 B;  3PGZ A;  4C56 C;  4PG3 A;  4V19 0;  3M85 A;  2DNE A;  3S16 B;  4KY6 A;  4ZAI A;  4NDX A;  4XYQ A;  3VR2 A;  2XWB B;  2M2L A;  3S16 H;  4LK1 C;  3PIO 3;  1PH6 A;  5IWA L;  3J81 L;  1SRO A;  1FNV A;  2K7V A;  4DXF A;  4F88 A;  3U50 C;  3J81 E;  2ZJR A;  4A3I H;  1JE4 A;  4M8A A;  3FRP B;  4OG1 A;  1IW7 C;  3K80 C;  1KDB A;  4DV3 Q;  1EIG A;  4WCZ A;  4JI6 Q;  2OQK A;  2M00 A;  1NZY B;  3PIO A;  3HOX B;  3D6W A;  2C9O A;  2DUB A;  4GN5 A;  4DV0 Q;  1BF4 A;  1EEF D;  4OO1 I;  2B2T C;  2E5L Q;  4A3J G;  2RKS A;  1Q82 C;  1WTX A;  4XT1 B;  1A6X A;  4QGU A;  1N33 Q;  5EAY A;  3I4L A;  1HTP A;  3MXU A;  4DPG A;  3URY A;  5JJZ A;  1SEB D;  2UXC Q;  2ZTC A;  2GVB A;  1R9T B;  3V05 A;  2E74 C;  3S24 A;  1QZG A;  4JI0 L;  4U18 A;  1TWH B;  5IOC A;  4DK3 C;  4RG1 A;  1R4P B;  3KF8 A;  2D0O A;  2K01 A;  5IWA Q;  3PO2 H;  1EQT A;  1PTO H;  1W3S A;  1GXD C;  2GA4 B;  2AQ3 B;  3PF4 A;  4DN4 M;  1PZI D;  2R93 H;  3SLL A;  1TII D;  4ZQ3 A;  4DR2 L;  3S15 B;  4Z9C B;  4A3M B;  2CH4 W;  3M7N A;  4JI0 Q;  4OON A;  5JJI A;  3CCV A;  3SHL A;  4MNO A;  4X64 Q;  4RKL A;  2BA0 A;  1B3Q A;  1V1O A;  1CQV A;  1CSQ A;  3V96 A;  1Z6H A;  2RA4 A;  4RGM A;  3NBH A;  4A3K G;  1JIC A;  5KJP A;  1KLG D;  3HOV G;  3G48 A;  1UAP A;  3PUW A;  2YYZ A;  1S40 A;  1L2F A;  3PO3 G;  1D1K A;  2F0E A;  4TQU S;  3GV3 A;  5M5Y B;  1Q52 A;  2EXD A;  4NNQ A;  1X9N A;  2EQS A;  1C7Y A;  4DR7 Q;  4ODG A;  2HHH L;  3Q22 A;  4C3I H;  3T8A A;  1SND A;  4QUF A;  2BDN A;  4HCS A;  4HSP A;  3R9S A;  4NXM L;  3IFT A;  5C3X A;  3QG1 A;  1FD7 D;  4KV6 A;  1AW7 A;  4DUY Q;  1JOO A;  3NQT A;  5C4X G;  4J8Q A;  2B2U A;  4JWV A;  4KN7 C;  1HTL D;  3RD4 A;  1P16 A;  3O13 A;  3GQB A;  1BXT A;  3T4A C;  1EWH A;  5G3L F;  3CMA A;  3FDT A;  4KLK A;  2A69 D;  3N6R A;  1XPU A;  4IUT A;  5M3F H;  1HZ9 A;  3Q24 A;  4UY8 C;  2WKD A;  1E24 A;  3DUZ A;  1AP0 A;  1E1T A;  5FJ8 H;  2PQA A;  4AYB B;  2Y0S B;  2QQ3 A;  1PV4 A;  1NMG A;  1BBU A;  4OIK A;  3I8Z A;  4RH6 A;  2L0C A;  4YY3 L;  5EPL A;  5E4W C;  3PUV A;  1Y1W H;  1HNW Q;  4K6D A;  5FLM G;  1KQS A;  2IHF A;  3H0G G;  1FYC A;  5JBX A;  5JJL A;  4MTK A;  4FZW A;  2PW5 A;  5M9O A;  4DR1 L;  1PVO A;  4A3B B;  3KLS X;  4DV7 L;  3LGJ A;  1TS4 A;  4A93 G;  3W8H B;  5JPN C;  2R61 A;  3QWN A;  4LW1 A;  3BYT B;  5KEE A;  5CV4 A;  4YCU A;  5D3D A;  1SNQ A;  3EIV A;  1QE6 A;  1WFQ A;  3Q1T A;  1BKB A;  1X32 A;  3M4P A;  1ESR A;  3ITP A;  3HKZ G;  4QQB X;  1GUO A;  3S9W A;  1HUN A;  3NBH B;  3KF8 B;  3X3M A;  3PO2 B;  3U4Z A;  3A7L A;  2DGY A;  3R2I A;  1I6H B;  4MOU A;  2PZW A;  2IT1 A;  3PUZ A;  4RCO A;  1XPO A;  4LNQ A;  4IUN A;  1TU2 B;  4Y52 H;  4QJF A;  4ZLT F;  1HUM A;  1QJO A;  2ICI A;  3RZD B;  4FXG C;  5KYI A;  2Z6B A;  3I4M H;  2LS0 1;  1NMF A;  2WB1 E;  2F0V A;  2EXZ A;  4DNT B;  3Q23 A;  3J7Y W;  5DM6 3;  3OIQ A;  3F1Z A;  2CW0 D;  2NVT B;  4U19 A;  4A76 A;  1HNX L;  4EVO A;  3S1M H;  4P71 A;  4HED A;  1JQY D;  1RJN A;  2X6G A;  3PUY A;  4UPA A;  1SMY D;  3K5O A;  2Z4I A;  4ELX A;  1O7L A;  1CZG A;  4JC0 A;  2EJ5 A;  3DEO A;  1BQQ T;  3EQL C;  2QEX A;  1STE A;  4QL5 A;  4FXD A;  1V43 A;  2MO0 A;  3TEH B;  1YHQ A;  3A74 A;  1F9S A;  3AU7 A;  3ULJ A;  2QCP X;  5C44 B;  3DLL A;  4K0K Q;  3FDU A;  4HJ7 A;  3ULP A;  3C1F A;  5TSS A;  2KED A;  1VQ9 A;  1VQE A;  2J0T D;  2NTT A;  4DR3 Q;  3OWF A;  5IP9 H;  3GTJ B;  1J6Q A;  3VA7 A;  3QJY A;  1RL2 A;  4JI1 L;  3S1R H;  1PZJ D;  3IRB A;  3GTQ B;  1E2V A;  1UE5 A;  1X3P A;  5IYD G;  5C0X H;  1PFM A;  1LO5 D;  1SNO A;  1FNU A;  2WP8 J;  4K6L A;  3ZYY X;  1VQ4 A;  1ML0 D;  2KVM A;  3AFP A;  1TR5 A;  2QGQ A;  4IPG A;  1L1O C;  2NUC A;  2MNA A;  2F0W A;  3VR5 A;  3TRE A;  1B44 D;  2UUA L;  3M3Y H;  2KOL A;  1LTA D;  5CBA E;  3M4Y A;  4JI3 L;  5FO7 B;  4K5V A;  1CHQ D;  4OGQ C;  1LAB A;  2F52 A;  2C5C A;  1JB3 A;  2CKZ B;  3S1N H;  4DV7 Q;  1II3 A;  2D2C C;  2CQA A;  3JAM i;  5KYL A;  4P74 A;  3PMF A;  1J9O A;  1KDA A;  1KHI A;  1YNX A;  4AYB E;  1KNE A;  2QKI C;  1AN8 A;  2BDO A;  2ZJQ A;  3VR4 A;  1HZD A;  3BVG A;  3KBX A;  1G8Z D;  1PRT B;  3EJI A;  3MVV A;  3E5S A;  3K7A B;  4DAP A;  3S1Q B;  1HQR D;  5D65 A;  1AH9 A;  3DHQ A;  3W3A A;  4HCE A;  1IYJ B;  3TZD A;  5FO8 B;  1NR4 A;  2A6H C;  3DMU A;  4DAY B;  3G7L A;  1UWV A;  1CUK A;  2O5I C;  3D6C A;  2PNR C;  4ELS A;  5L37 A;  4QII A;  1SJH D;  4B08 A;  5CV5 A;  1K73 C;  2E8G A;  5C3E G;  4C3I B;  2H1E A;  2ZTD A;  3OSO A;  2L15 A;  3C46 A;  4B3R L;  4GKJ Q;  1G6Z A;  3KQF A;  3P20 A;  5M5Y H;  2JP1 A;  2E2D C;  5A2Q L;  3GTO B;  3STB C;  3BVM A;  1PLF A;  3KUP A;  4RCN A;  3OHX C;  4NMZ A;  4XQQ A;  3SR1 A;  1STY A;  1ILQ A;  4NPS A;  5C4H A;  4DV1 L;  1EOV A;  3TP7 A;  3TBI B;  4O42 A;  2BE5 D;  3OMG A;  3F2U A;  1SDF A;  5LMN W;  5COY A;  1D2B A;  2F4V Q;  4KK7 A;  3BJU A;  2ZXP A;  4WJ3 M;  5A2Q E;  4A3J H;  3I4O A;  4KHV A;  3CC2 A;  1WD1 A;  1JOQ A;  4DR3 L;  1PA6 A;  4LUZ A;  3A8I E;  4DAM A;  1PTO B;  1OXX K;  1MGS A;  5IIF A;  1EYC A;  4R4O A;  4LF8 Q;  4IUR A;  1Q1B A;  3K7A H;  5DM7 3;  4XQJ A;  5E1F A;  2OCE A;  3GV6 A;  3MA2 B;  3RLO A;  2ZJP A;  2UUA Q;  1LT5 D;  2F0I A;  4R8N A;  4L5S A;  3CCU A;  1JOR A;  4IZC A;  2LSS A;  1EY5 A;  4C2M H;  1N34 L;  3HFZ B;  3J7A F;  1EF8 A;  2FMC A;  3HOY G;  1ASZ A;  4XIG S;  3TLF A;  5CV9 A;  2EJG C;  3FKI G;  1WJJ A;  1KNA A;  3FPP A;  5FLX L;  3CCL A;  5ELO A;  3TRZ A;  4HMI A;  1VQN A;  1BNZ A;  3I72 A;  1CKO A;  1W6K A;  3KDF B;  4ZK9 B;  1HHV A;  4ALP A;  1O7I A;  3VR6 A;  2NN6 I;  4YWK A;  1HNZ L;  4JFC A;  4A3I B;  3K81 C;  2VQF Q;  4PV1 C;  2HDM A;  3W1B A;  1D5Z C;  4NKL A;  3F2D A;  2KBN A;  5IP7 H;  4HID A;  3S1R B;  1CKN A;  4ME3 A;  4DR7 L;  1PFB A;  3UDI A;  1XNQ Q;  4MZ9 A;  4YY3 Q;  5JBW A;  1PTO C;  4MTN A;  4LFB Q;  1PFN A;  4YWL A;  4IAL A;  3MZ5 A;  1F2M A;  4LF7 Q;  1NZY A;  1PRT C;  2H4O A;  3U4V A;  1FGU A;  1W2B A;  2Q2T A;  4BY7 H;  3MXN B;  2GN5 A;  4OEM B;  1CZW A;  1E22 A;  4A3K H;  1N34 Q;  2IPK D;  1V1Q A;  5DEH A;  1XNR Q;  3U58 A;  5JVH 3;  1SNC A;  1I5F A;  5KGU A;  1FVI A;  1RKN A;  2CW0 C;  1LM0 A;  2X69 A;  3I3C A;  2K1B A;  4GKK Q;  2A6E C;  1EOT A;  2E2I H;  1TWC B;  5J39 A;  1Z47 A;  4OLQ A;  4LFA L;  1IL8 A;  4F8M A;  2OF1 A;  1GVP A;  4DR4 L;  4O1N A;  3TRR A;  2KA7 A;  1CM9 A;  3MEH A;  1EQV A;  1DGS A;  1YNJ D;  4JYA Q;  1ROD A;  2RDG A;  3MAQ A;  4KNP A;  4B3M Q;  4XTC S;  3HOV B;  1DM0 B;  4E6I A;  2F3W A;  4DAV A;  3HOZ G;  1LT6 D;  3BDL A;  3VA5 A;  3DWQ A;  3K0Y A;  2CWP A;  1Q7Y C;  1BCP D;  1LTT D;  4JPB W;  1HA6 A;  1I50 H;  2QDB A;  1I6H H;  2MPM A;  1G6P A;  1TQO A;  4IFD H;  1EQQ A;  4FXK C;  2YTX A;  4RHS A;  5FO9 B;  2CH4 A;  5LMN L;  4HAE A;  1UX5 A;  1B7Y B;  1A3U A;  1A8V A;  1K3B C;  5C4Z A;  2XNA C;  3KLW A;  5E7N A;  1FR3 A;  1IBL Q;  1C0A A;  1Y1V H;  4V0B A;  1SYE A;  2Z1C A;  2UU9 L;  1EFW A;  3RLN A;  1HJP A;  1PH5 A;  1B3A A;  4DNI A;  1HNW L;  1KRS A;  3OMC A;  4IUV A;  4OXP A;  5GAE C;  1HZA A;  1Q46 A;  2LXJ A;  1R4Q B;  5HGQ A;  3IAY A;  4IZB A;  1K0S A;  3H3V H;  1CHP D;  4A93 H;  2B2V A;  2K5Q A;  5I6Y A;  3AMU A;  1UE7 A;  4NB3 A;  1U4R A;  2E76 C;  3GP7 A;  3GDE A;  3BU2 A;  2OT2 A;  1HH2 P;  2NVQ B;  3A54 A;  4DV5 Q;  4B3S Q;  5DLQ E;  2PBP A;  5KNC A;  3KDF A;  4JW0 A;  3A8J E;  2FJ2 A;  1PH2 A;  3SE0 A;  2JA8 G;  3N52 A;  1SYD A;  3HP3 A;  3MFG A;  2KHJ A;  1SE4 A;  3RN2 A;  4L5T A;  4BXX G;  1XMQ L;  2VY3 A;  1K0R A;  4I7A A;  1I3Q B;  4A75 A;  1I3Q H;  3LWU A;  1ONL A;  2BH8 A;  3OOC A;  3FP9 A;  4XQN A;  1Y1W G;  5LMU L;  3T1H L;  1EF9 A;  3KFU A;  1U0L A;  3L9A X;  3CHB D;  5IT9 c;  2B63 B;  2RBM A;  4IPC A;  5I2X A;  1RTO A;  1MIU A;  3Q8D A;  3H0G H;  2B29 A;  2A68 D;  5FKA C;  3M3Y B;  1LAC A;  1TY0 A;  3E9I A;  1TS2 A;  2KHS A;  1GHK A;  4N9P A;  1B8A A;  1EYD A;  2A68 C;  3KK7 A;  2Z6K A;  2CCZ A;  1TS5 A;  1E0B A;  3C3L A;  3SDZ A;  1XNR L;  4NP5 A;  3S2D H;  1SE2 A;  2IWH A;  5CMD A;  2G5D A;  3EBE A;  2ES2 A;  3NE5 B;  1T5E A;  3BZC A;  2D9U A;  4EML A;  1TWA B;  3CW2 C;  4MIU A;  4CDD C;  2SEB D;  2OXP A;  1BO0 A;  1TWF B;  3VYS A;  3F8T A;  4DV2 L;  1VMP A;  4BS9 A;  4JYL A;  1EY7 A;  4KN4 C;  1DCZ A;  3K8A A;  3S17 H;  3TQY A;  3I4N G;  1TT2 A;  2WB1 G;  4AIM A;  3D0F A;  4IO9 A;  3K7U C;  5KRU A;  4CJ1 B;  1WCM H;  1SMX A;  3GTK B;  2L9H A;  2PMZ E;  2F4V L;  2Q8I B;  3J81 i;  5C6A A;  3M4O H;  1ZXT A;  3J80 c;  4JI8 Q;  5JPM C;  4LF7 L;  1L0X B;  2E2H H;  1F9Q A;  1S5C D;  5AFW A;  4ZUI A;  3T56 B;  4BY1 H;  5CBE E;  1UNS A;  1LTI D;  1X65 A;  1B9N A;  5CYU A;  4DV3 L;  1ASY A;  4EGV A;  1GD7 A;  2VB2 X;  2NVX B;  1DD2 A;  4DF7 A;  4ZRZ A;  3HOX H;  4GEH B;  3CCS A;  2F0D A;  4L8J A;  4IOA A;  1WTQ A;  5JVG 3;  1PH9 A;  3JAM c;  1SJE D;  1XMO Q;  5C0X G;  3GTP H;  3SEB A;  4CHT B;  2L55 A;  1TWF H;  3NTI A;  5IGF A;  1CKM A;  4WFN 3;  1RDP D;  3PCO B;  4HN7 A;  4EQN A;  1YNN C;  2VQE L;  4DV5 L;  4B3S L;  2Z6K C;  2RDF A;  5K36 H;  1WTR A;  5IYD H;  1E2W A;  5T1I A;  5LL6 X;  3S2H H;  1VDZ A;  4F47 A;  5ELF A;  4J15 A;  5C0X I;  3A4N A;  4OWT B;  1Y69 U;  4ULL A;  2IL8 A;  3QR8 A;  4C3H H;  3FMC A;  4A3B H;  2PCF B;  1F2Z A;  3F2C A;  4AQY Q;  4DV1 Q;  2PZT A;  1Q3L A;  1B2T A;  1VQM A;  1IBK Q;  1DXM A;  2KCC A;  4TKO B;  2VL6 A;  2JYO A;  3KJO A;  5EPJ A;  1IBK L;  3ONA B;  1L0Y B;  2A8V A;  4FDB A;  4NEK A;  1ICF B;  4K8I A;  3D8G A;  3L3O C;  2JA5 B;  1VQG A;  4POF A;  3J80 E;  1CKN B;  5JEA J;  1GUN A;  1V9P A;  2F0F A;  3OTO Q;  5IGE A;  2JEB I;  4GZY C;  3D4R A;  2JA9 A;  3MXG A;  2AQ2 B;  3TZU A;  4DXG A;  3QXI A;  1Y14 B;  1KAB A;  3H3V C;  3K5M A;  1VQL A;  1IL2 A;  1MBY A;  4H7B A;  4B9X A;  1IYU A;  3NP8 A;  1HQM C;  3KJP A;  3FKI H;  5EBD A;  4FF4 A;  3RN5 A;  4JI3 Q;  2EIF A;  5ELC A;  1VQC A;  4GLA C;  3TP6 A;  2MJ8 A;  4KY5 A;  3T13 A;  4P75 A;  1MSH A;  4I42 A;  2AWO A;  2K5N A;  4GN4 B;  3G4S A;  4TVA B;  5LL6 S;  4Q5V A;  5M5W B;  2QIL A;  3QOL A;  5JJK A;  2G9H D;  4BBR B;  1SR3 A;  1BCP B;  5BR8 Q;  5BN5 A;  2QDL A;  2B2Y A;  1O7Y A;  1PYB A;  2AMC B;  1A15 A;  1RJM A;  1CI3 M;  1JT8 A;  1BBW A;  2IX1 A;  5I9P A;  2HIV A;  3I7F A;  1ZEQ X;  2ZT9 C;  1N9W A;  3E3X A;  3STB D;  3HOZ H;  3P7J A;  4C3J G;  3TS2 A;  1PH8 A;  1DZ1 A;  4RGN A;  2BA1 A;  3PO3 H;  4LFB L;  5GRO A;  3D31 A;  4DV0 L;  4DGZ A;  2B8F A;  1CT1 D;  2XSC A;  1Q8I A;  2MO1 A;  1JR0 D;  2A1A A;  3RSI A;  5FJ8 G;  2R7F A;  1NNX A;  1S3O A;  2N49 A;  1LUZ A;  4DFA A;  5C4X H;  3GTM B;  5C5L A;  4DNR B;  4UP9 A;  2HIX A;  4HJ5 A;  3S1N B;  1DOM A;  1A3V A;  4MI2 A;  1X3E A;  3BDO A;  2E2I B;  3WWV A;  3HEJ A;  3ERQ A;  3IFD A;  2A69 C;  3PIP 3;  2EZV A;  1X55 A;  4GNX B;  3NUC A;  4F87 A;  1PFS A;  1BVS A;  2UUB L;  2MQH A;  2FXQ A;  2EVB A;  1XXG A;  5IOD A;  1K8A C;  4LFC L;  4Y7N B;  5M3F G;  5D14 A;  2EPB A;  2YV5 A;  5IE8 A;  1PMR A;  2I5M X;  2A6H D;  2N78 A;  1IKM A;  3RQG A;  1VMC A;  4K5X A;  5EPK A;  4A3E G;  1EFI D;  1CFM A;  4X62 L;  2F6Q A;  5EQ0 A;  1ICW A;  5F2D A;  4ZKC B;  3X3N A;  1NY4 A;  5EKI A;  3L8J A;  4XT3 B;  3L8I A;  2HD3 A;  3SK8 A;  4RMF A;  2IW3 A;  4UP8 A;  4C3J H;  1MJE A;  4RWS C;  4I4Z A;  3OC7 A;  1F9P A;  5M3M H;  1VQ6 A;  3DWA A;  4A3C G;  2MHV A;  1Q51 A;  1N36 L;  2K32 A;  2UXB Q;  1WI5 A;  3R0O A;  3TP8 A;  1V8Q A;  2KEC A;  4R9W A;  4ME5 A;  1S5E D;  1OXU A;  2DJF C;  4FF2 A;  5C3W A;  2ID0 A;  4P72 A;  5C3E B;  2IJ0 A;  5DAU A;  5I4D A;  4BY7 G;  1YEZ A;  3NWS A;  3GTM H;  5C4X B;  4C2M B;  4QB4 A;  4L5Q A;  4HJ8 A;  4A3F G;  3EFX D;  4GLX A;  5JOB A;  3I4M B;  4DV4 Q;  3HOU G;  3I55 A;  2D5D A;  1U4P A;  3HG9 A;  2Z9H A;  3ER0 A;  4J1M A;  1A0I A;  1B50 A;  4J6H A;  4IFD G;  2P63 A;  2MUY A;  4WRD A;  3RMH A;  4DR5 Q;  4JG2 A;  4NW2 A;  2DY7 A;  2EDG A;  2EYP A;  1XTD A;  3HKZ B;  3RNU A;  4UHV A;  1Z9F A;  2JA6 B;  5NUC A;  2PYK A;  3A56 A;  4NXN L;  3MFY A;  1MJ3 A;  1EYA A;  1LTS D;  2FFK B;  1RD9 D;  1X56 A;  2HQL A;  1WZ8 A;  2AHO B;  3I91 A;  4BBS H;  3NEL A;  2SOB A;  4DR5 L;  2RDH A;  1KTK A;  2ICE C;  4BBR H;  4DK0 A;  1SFO B;  1WVL A;  3H6M A;  4G4K A;  4JI4 L;  2K5D A;  3MXP A;  4KD4 A;  1EY8 A;  1VQ5 A;  4EX5 A;  2KJX A;  3T89 A;  2ZTE A;  3I47 A;  4LFC Q;  1JCK B;  4KKS A;  2Y0S E;  2EE1 A;  1EYG A;  2WAQ E;  4H13 C;  3O4X E;  3A55 A;  3CF5 A;  2KCN A;  1G91 A;  2BOS A;  3MC0 B;  4BA2 I;  2ALY B;  4R4I A;  3GTO H;  1SSO A;  4LFA Q;  5C5M A;  1U4M A;  1BBX C;  3A7A B;  3HOY B;  2HQE A;  1Q8K A;  4JVZ A;  4TSS A;  3GD7 A;  1SFO H;  1YIT A;  4JOI C;  2YU9 B;  1Q86 C;  4KMU C;  2NB0 A;  3ZJY C;  2F0K A;  3J81 j;  4HIO A;  2CQO A;  5IP9 G;  4A3E B;  2RF4 A;  5IT9 E;  1X54 A;  3CCJ A;  1PXU A;  1TXY A;  1C48 A;  4KJO A;  2F0Q A;  4G7H C;  3QOJ A;  3HZX A;  1C8C A;  1F2L A;  5M3F B;  1ZKO A;  2E2J H;  3QIA A;  2N55 A;  3E0E A;  4B9W A;  4BA1 I;  1Y8O B;  1WTV A;  4HR7 B;  2NWG A;  3HOX G;  2TMP A;  5DNF A;  2BCO A;  2KEE A;  1DOL A;  3ND8 A;  4CGY B;  5I6W A;  1HR0 L;  1STA A;  1NE3 A;  2PMZ B;  1YJN A;  1K3R A;  3OW2 A;  3H3V I;  5ELB A;  1AZQ A;  4HSV A;  4JI7 L;  3AM1 A;  3HS0 C;  5IY0 A;  3E0J A;  3UDX A;  1SMY C;  2EY1 A;  2PPB C;  4DR2 Q;  4KD3 A;  1STN A;  4PMB A;  1YNJ C;  3CCQ A;  4DR6 L;  3FEW X;  1Q12 A;  4LF9 L;  3H15 A;  3K59 A;  1KXL A;  3T1Y Q;  1I4R A;  4A3F H;  1UUP A;  1Y64 B;  3HRX A;  1EY4 A;  1BUV T;  1JWU D;  3RUZ A;  2OTJ A;  1FGB D;  2V1C C;  4LMQ D;  1O80 A;  2EYM A;  2K03 A;  1UIY A;  1YJW A;  5ELE A;  3L7Z C;  1PZK D;  1MD2 D;  1K83 B;  2EYJ A;  4EQ5 A;  1TKW B;  1LYL A;  1SYB A;  3G6J B;  3G64 A;  1YHB A;  3MWY W;  2K28 A;  3DWP A;  4PMW A;  2B2T A;  1N33 L;  3IL8 A;  3W2D A;  5J3B A;  2R93 B;  2JK8 A;  4DKA C;  2FMM A;  3CQZ B;  3I4N H;  1QVG A;  4QIW B;  3GTP B;  2JA6 G;  3H09 A;  4HJA A;  5HY6 A;  1EY3 A;  2LMC B;  1VQ7 A;  1LT4 D;  3BS1 A;  1DUB A;  4TRD A;  3UDG A;  2KEN A;  2FW2 A;  3MTS A;  1EY6 A;  1QNK A;  2IX0 A;  4BY1 G;  4DR1 Q;  2PO4 A;  3S14 H;  1XWE A;  1SYG A;  4YHH L;  2IHE A;  4F7X A;  4IZ8 A;  1K8M A;  1L0W A;  5D3I B;  1WOC A;  1G2S A;  2A5H A;  3OPO A;  2F0P A;  1NAP A;  2CVR A;  3GTL H;  5AJ3 L;  3J80 L;  1NBW A;  3CPW A;  1B53 A;  1KAW A;  2I46 A;  2EYO A;  3I70 A;  2F3I A;  1X3F A;  1WCM B;  1RF2 D;  3W8I B;  4YWM A;  3S14 B;  4GNX C;  3EN2 A;  1TVX A;  3S17 B;  1YJ9 A;  3QK8 A;  1TS3 A;  3HOZ B;  3AYH B;  5CV7 A;  4BWG B;  5HGT A;  4UP7 A;  3LWE A;  2LFN A;  1VQD A;  4ILW A;  1O7Z A;  4JCS A;  1MI2 A;  2B2W C;  3HOW H;  1U5K A;  2NVY H;  5IP7 G;  3U9O A;  5K36 G;  4AH6 A;  3EA6 A;  1O78 A;  1EZ6 A;  4LF4 Q;  2JA5 G;  3GO5 A;  4WJW A;  1QUQ A;  1KDC A;  2AUJ D;  5ELD A;  3U9S A;  2HHH Q;  1T5X D;  1KAA A;  3SVM A;  2O2L D;  5C44 G;  3BZK A;  1N32 Q;  3H94 A;  2CWA A;  1U9R A;  2JJQ A;  3VYR A;  3NTK A;  3NHH A;  1KC8 C;  2R7Z B;  1FJG L;  2DUD A;  1WYD A;  3WDN A;  4X65 Q;  3Q0G A;  1JWS D;  1F2Y A;  4K2K A;  4PZ8 A;  1DYQ A;  3RQE A;  1Y8N B;  3PQI A;  1B9M A;  3CU7 A;  4MHE A;  1J5E Q;  1QWY A;  4PMC A;  3IKJ A;  2WII B;  1STB A;  1I94 Q;  1C4Q A;  1EZ8 A;  2KCM A;  3GTG B;  2HCC A;  1VQF A;  4QIW E;  1GO3 E;  3T88 A;  2AKW B;  1LLR D;  2B8G A;  4DK6 C;  1HXY D;  1NSN S;  4YCV A;  2KQ3 A;  5FOB B;  4IN3 A;  4FYD A;  4R4T A;  2A19 A;  2R92 H;  4DUZ Q;  3PO2 G;  3Q0A A;  4IUU A;  2QEJ C;  1H95 A;  2L12 A;  2N8N A;  3NK9 A;  1JMC A;  1VQA A;  2ZM6 L;  4A3D B;  2IX3 A;  3RZO B;  3ADB A;  2E2J B;  1T9H A;  1QIL A;  3R93 A;  1VF5 C;  2B39 A;  4YIJ A;  3FVQ A;  4LUV A;  2K5V A;  2JA5 H;  1B1Z A;  2HUG A;  1GUT A;  1XX8 A;  1SXT A;  2YTV A;  3SK6 A;  2I0Q A;  3W1G A;  3GTG H;  4LF5 L;  2M9V A;  1HR0 Q;  4A3D G;  3M7G A;  4A3E H;  5M5X H;  2VB3 X;  1FL0 A;  3R2T A;  1MKH A;  3CAM A;  2YU9 H;  4ZUJ A;  4A3L G;  4ZKB B;  1ZYR D;  4PZ6 A;  1GUS A;  1VQH A;  3QO2 A;  4JV5 Q;  1Y8P B;  4PQX A;  1D1I A;  3CC4 A;  1B4O A;  4JI2 L;  1DOK A;  2P5Z X;  4POG A;  1LV9 A;  2PI2 E;  1NCV A;  1H9K A;  4OO1 G;  4JV5 L;  4C3I G;  2R7Z H;  1FNW A;  1GKH A;  1XTC D;  2VQF L;  1L1O A;  4A3G H;  3E6Z X;  2F0H A;  1HCZ A;  2JE6 I;  2RSN A;  4UAI A;  1C9O A;  3BG3 A;  3PSI A;  4CKB A;  2R7D A;  3TS0 A;  4KHP Q;  1OXT A;  3S15 H;  2F0T A;  2NVY B;  3CCM A;  1IZ6 A;  3HOW B;  3R9T A;  1UE6 A;  2F0J A;  1SAP A;  5J22 A;  4GN3 B;  4X3S A;  3I56 A;  5C0X J;  4QUC A;  2Z0S A;  4KY7 A;  4X3K A;  1I50 B;  1ENA A;  4JI6 L;  2K50 A;  4HTH A;  1MHW C;  1M8A A;  2WV6 D;  3H81 A;  1K8O A;  4A3L H;  2RHQ B;  1YVC A;  1QUQ B;  4CDE C;  2Q8R E;  4RGO S;  2VXW A;  3HOV H;  1G29 1;  2NZH A;  2UU9 Q;  3TP5 A;  2UUC L;  2NTS A;  1VCI A;  1EY9 A;  1PYS B;  2UXD Q;  2R7Z G;  1IW7 D;  1STG A;  1N8R C;  4BBS G;  1RCV D;  3OYY A;  3RQF A;  1TWC H;  2ZM6 Q;  5IYB H;  3K5L A;  4LAA A;  3GTK H;  2G9D A;  1FJG Q;  1S5B D;  3HKZ E;  5M3M B;  4JBW A;  4R4Q A;  1J8I A;  2F0S A;  4C1N I;  3AEV A;  4KTA A;  3T53 B;  4A3K B;  4QIJ A;  4BY7 B;  2JA8 B;  4JBM A;  5EGT A;  1PDQ A;  4C3J B;  2SNM A;  3I4N B;  3CXC A;  4B3M L;  3Q6S A;  3DXJ C;  3SK4 A;  2OEO A;  2K14 A;  2EY2 A;  2L1B A;  5M3M G;  2Q2H A;  4RFB A;  3CCR A;  4EQP A;  1N36 Q;  1HFG A;  3SGI A;  2CHB D;  4A3I G;  2LKV A;  1JJG A;  3HIN A;  1XMO L;  3EVQ A;  4IOC A;  4I7Z C;  2XN9 C;  4L63 B;  3NEM A;  5C4J B;  3SXH A;  3VR3 A;  4Y7N H;  1LT3 D;  1JJC B;  2PW7 A;  1BCP C;  1JC7 A;  3J81 c;  3K6O A;  4DAY A;  1IBM Q;  4JI5 Q;  5GAH C;  1E2Z A;  3K58 A;  4ID6 A;  3AQQ A;  1D5M C;  3UE0 A;  2BH2 A;  4JCV E;  4DK1 A;  1V1P B;  4R4C A;  5IGC A;  5FK9 C;  5JAV A;  1BR9 A;  4DUZ L;  3H0G B;  3CKI B;  2O4X A;  3A4L A;  2WB1 B;  2WAQ B;  1M4V A;  4U67 3;  1A63 A;  1BDO A;  2B63 H;  5IYB G;  1D8L A;  2XTI A;  4XXE A;  4X66 Q;  3KYH C;  4JBJ A;  3H02 A;  4JI7 Q;  2V4D A;  1I94 L;  2R6G A;  3NEN A;  4KI0 A;  1GUG A;  5A35 A;  1B70 B;  2F0M A;  3PUX A;  2VX2 A;  1I4X A;  3MXN A;  4IJH A;  4OEL B;  2UXD L;  2EYL A;  4LJZ C;  3RLF A;  1H9J A;  3HOU H;  4FO2 A;  2E5L L;  2WIN B;  1V1P A;  2WAC A;  4LWC A;  2EY6 A;  1XNQ L;  1LTR D;  3TDQ A;  4K5W A;  2RHS B;  4A3J B;  2NYZ D;  1UX4 A;  1M1K C;  2CFM A;  4EQO A;  3JC6 6;  2ENB A;  2XVS A;  4JI1 Q;  2KHI A;  4O0A A;  3HOY H;  2JA7 B;  4WJ4 A;  4A93 B;  3Q0J A;  2PZU A;  3ERS X;  3ND9 A;  1PTO D;  4LF5 Q;  4QF4 A;  4O2D A;  5GAG C;  4G7O C;  3M4Q A;  2B3G A;  3KLS A;  4LF9 Q;  1NUC A;  2EY5 A;  2Q8T A;  1I4P A;  4R8I A;  2QF7 A;  1KL9 A;  4IFD J;  1LTL A;  4FVM A;  3PF5 A;  3CCE A;  5CR3 A;  4R1J A;  1K8G A;  3G71 A;  2HW5 A;  1GOZ A;  3M9B A;  2QW7 A;  2QA4 A;  5M5X B;  2ZXO A;  2LXK A;  1BCP F;  1H9S A;  2Q2I A;  2C35 B;  4GOP A;  2FHT A;  1YZ6 A;  2JA6 H;  2EJM A;  4M1U B;  2ZXR A;  3RZO H;  1G2T A;  3I90 A;  5EKK A;  1PTO F;  4N8X 1;  2K5H A;  3G6E A;  2XRQ D;  3S1Q H;  1DJR D;  1H9S B;  1CA6 A;  1D7Q A;  1JXZ A;  1J5E L;  4QCL A;  1ZYR C;  2R92 B;  5FLX E;  1K9M C;  1I6V C;  3A0J A;  2VRE A;  3OIP A;  4XYO A;  2RSO A;  3RR5 A;  5IGB A;  1Y1V G;  3J7A V;  1IBL L;  1ENC A;  4Q0F A;  1HPC A;  2J7Z A;  3NWT A;  1RIP A;  5FLM H;  1JJ2 A;  1E3P A;  1QOH A;  4IFD I;  1ESF A;  1BOS A;  4C3H G;  1I4Q A;  1LTB D;  1PRT D;  4KKT A;  2VS1 A;  3MHB A;  1VQJ A;  2XGT A;  4X65 L;  1YHA A;  2B63 G;  3HKS A;  2NZ1 D;  4FJW D;  4U68 A;  3SWX A;  2A74 C;  3CC7 A;  4HMJ A;  4C3H B;  2DN8 A;  3UE1 A;  4CDC C;  1H9M A;  3A5U A;  3T1H Q;  4B3T Q;  2EJF C;  2RCF A;  5I2Y A;  3I2Z A;  3GTJ H;  1NTG A;  3LNN A;  2UXB L;  4HIK A;  3R3O A;  3QXZ A;  4NXN Q;  2E75 C;  3PV0 A;  2K33 A;  1I4H A;  1TWG B;  5C44 H;  4GKK L;  5FLX c;  5AJ3 Q;  1Q1E A;  1EWC A;  3TME A;  4S3S A;  2NN6 G;  1N32 L;  2EOT A;  2UUC Q;  3J80 i;  2F3V A;  3HRZ C;  4X6A H;  2B2Y C;  4A3B G;  4YCW A;  1E7Z A;  3T1Y L;  2LY7 A;  2SDF A;  2ZQQ A;  4XDX A;  3GTL B;  1XJV A;  1H9R A;  1SNM A;  1S5D D;  2E2H B;  1A3T A;  2Y0S G;  3T51 B;  2GTR A;  2SNS A;  1ILP A;  4DUY L;  3M4O B;  3RZD H;  1AZP A;  1HNZ Q;  2A6E D;  2HDL A;  4GKJ L;  2J4X A;  1EIH A;  3PO3 B;  4CDF C;  4NXM Q;  1VQO A;  2OTL A;  5BN4 A;  2H5X A;  3NTH A;  1QZH A;  4OWW B;  2XWJ B;  3FHW A;  4BXX H;  3KBG A;  1AE3 A;  3UI2 A;  3K57 A;  2YTY A;  5IGD A;  1DON A;  3I73 A;  1YIJ A;  4L6T B;  1GUW A;  4A3G G;  3CQZ H;  2O5J C;  2B2V C;  3J7A 5;  2VUM G;  5T1G A;  1TWA H;  4GLV B;  2X6L A;  1G51 A;  4LF6 Q;  2FBM A;  3DM3 A; 
#chains in the Genus database with same CATH homology
 1L0W A;  1PH4 A;  4L5R C;  3K0X A;  1XNR L;  3S2D H;  1WOC A;  1YBY A;  1K83 H;  3GTL H;  3CMA A;  3EBE A;  5AJ3 L;  1NBW A;  2ES2 A;  4LUO A;  3CPW A;  1KAW A;  3BZC A;  4KLK A;  2UUB Q;  3HOW G;  1Q81 C;  1XPU A;  5IYC G;  4K0K L;  5M3F H;  1HZ9 A;  4IPH A;  2F3I A;  1X3F A;  1SN8 A;  4UY8 C;  4DR6 Q;  1VQB A;  1E24 A;  3CW2 C;  3W8I B;  4YWM A;  1E1T A;  5FJ8 H;  2PQA A;  4GNX C;  3CPF A;  2OQ0 A;  1JB7 A;  3EN2 A;  3F8T A;  3MEF A;  4DV2 L;  1PV4 A;  1EWI A;  1NMG A;  1YJ9 A;  1BBU A;  1XPR A;  3AYH B;  3K8A A;  3S17 H;  3TQY A;  4YY3 L;  4UP7 A;  3PUV A;  1Y1W H;  3I4N G;  2AWN A;  1VQD A;  5FLM G;  1EUJ A;  2WB1 G;  1HNW Q;  4AIM A;  3HOW H;  1KQS A;  3D0F A;  2IHF A;  3H0G G;  1U5K A;  3K7U C;  2NVY H;  4IO9 A;  5IP7 G;  5K36 G;  5JJL A;  4AH6 A;  1WCM H;  1SMX A;  2PMZ E;  4LF4 Q;  2JA5 G;  2F4V L;  3J81 i;  4A3M G;  3GO5 A;  4DR1 L;  3M4O H;  1QUQ A;  1PVO A;  2JA7 G;  3J80 c;  4JI8 Q;  2MFI A;  4DV7 L;  4LF7 L;  3LGJ A;  4A3D H;  2E2H H;  4LF8 L;  2HHH Q;  1IXR A;  4H02 A;  4A93 G;  3W8H B;  1SE8 A;  5C44 G;  1L1O B;  4LW1 A;  3CME A;  3BZK A;  1N32 Q;  3E9H A;  2CWA A;  2JJQ A;  4KHZ A;  4BY1 H;  1KC8 C;  5GQO A;  1FJG L;  1X65 A;  2DUD A;  4YCU A;  4B3R Q;  3EIV A;  1WYD A;  4X65 Q;  1WFQ A;  4JOI A;  4DV3 L;  1ASY A;  1GD7 A;  1BKB A;  3M4P A;  4PZ8 A;  3HOX H;  3HKZ G;  3RQE A;  4QQB X;  4GEH B;  1PH3 A;  3CCS A;  1KIX A;  2NVQ H;  1J5E Q;  4OWX B;  4DV4 L;  3NBH B;  3KF8 B;  3U4Z A;  4IOA A;  2DGY A;  1I94 Q;  1PH9 A;  4X62 Q;  2KCT A;  3JAM c;  1KD1 C;  4JI4 Q;  4IPD A;  5C0X G;  2VQE Q;  2IT1 A;  2KCM A;  3PUZ A;  1VQF A;  1XMO Q;  1XPO A;  1TWF H;  3GTP H;  4QIW E;  4LNQ A;  1CKM A;  1GO3 E;  2AKW B;  4Y52 H;  4DK6 C;  3PCO B;  4QJF A;  2I5L X;  1KRT A;  2VQE L;  1NJI C;  4YCV A;  4DV5 L;  4B3S L;  2IY5 B;  2Z6K C;  3B6Y A;  1JE5 A;  2A19 A;  4R4T A;  2R92 H;  4JI5 L;  4DUZ Q;  3PO2 G;  5IYD H;  4QY7 A;  3PIP A;  3I4M H;  2D62 A;  3GTQ H;  1NMF A;  1H95 A;  3S2H H;  2N8N A;  4AQY L;  1JMC A;  2WB1 E;  1VQA A;  5BR8 L;  2ZM6 L;  2JA7 H;  2K52 A;  4J15 A;  5C0X I;  3A4N A;  4OWT B;  3ADB A;  4C3H H;  4A3B H;  1T9H A;  3F1Z A;  3F2C A;  4AQY Q;  4A76 A;  4LUV A;  2K5V A;  4DV1 Q;  1HNX L;  2JA5 H;  3S1M H;  4P71 A;  4A3M H;  1MJC A;  3PUY A;  4UPA A;  1VQM A;  2YTV A;  1IBK Q;  2I0Q A;  1CSP A;  3W1G A;  4GNX A;  3GTG H;  1AE2 A;  4APV A;  4LF5 L;  1HR0 Q;  4A3D G;  4JC0 A;  4A3E H;  5M5X H;  2QEX A;  1FL0 A;  2VL6 A;  4QL5 A;  1MKH A;  3KJO A;  4JI8 L;  3CAM A;  1V43 A;  2MO0 A;  3TEH B;  3ADD A;  1YHQ A;  5H1S E;  1IBK L;  2YU9 H;  3A74 A;  3ULJ A;  4PZ6 A;  1VQH A;  2A8V A;  4JV5 Q;  5ELN A;  4FDB A;  3DLL A;  4K0K Q;  4HJ7 A;  3ULP A;  3CC4 A;  2NVX H;  4JI2 L;  4POG A;  2K75 A;  1VQG A;  2PI2 E;  4POF A;  2NVT H;  1CKN B;  1VQ9 A;  1VQE A;  5JEA J;  4OO1 G;  4JV5 L;  1V9P A;  4DR3 Q;  5IP9 H;  3F2B A;  2R7Z H;  3OTO Q;  3L0O A;  1J6Q A;  1GKH A;  1RL2 A;  1SLJ A;  5LMN Q;  4JI1 L;  2VQF L;  3S1R H;  1EQR A;  1OTC A;  1L1O A;  4A3C H;  3CD6 A;  4A3G H;  2JEB I;  3IRB A;  2JE6 I;  1UE5 A;  5IYD G;  2JA9 A;  1M90 C;  2WP8 J;  1VQ4 A;  1C9O A;  3PSI A;  4P73 A;  2R7D A;  3TS0 A;  3AFP A;  4KHP Q;  2QGQ A;  2ASB A;  1OXT A;  1Y14 B;  4IPG A;  3S15 H;  1L1O C;  1VQL A;  1IL2 A;  2UUA L;  2MNA A;  3CCM A;  2GVA A;  3TRE A;  1IZ6 A;  3OTO L;  1P8L A;  3M3Y H;  3I4M G;  4JYA L;  1UE6 A;  4JI3 L;  2WFW A;  3KJP A;  4GN3 B;  2I5H A;  3I56 A;  2F52 A;  5C0X J;  3FKI H;  2CKZ B;  3S1N H;  4DV7 Q;  2UXC L;  2Z0S A;  3RN5 A;  3W5O A;  5C4J H;  4X64 L;  1QVF A;  3JAM i;  4JI6 L;  4P74 A;  4JI3 Q;  2PI2 A;  2K50 A;  1KHI A;  1TWG H;  2EIF A;  1VQC A;  1YNX A;  1SRU A;  1E1O A;  4GLA C;  4A3L H;  4AYB E;  2RHQ B;  4P75 A;  3DM3 A;  1QUQ B;  2AWO A;  2K5N A;  2ZJQ A;  4GN4 B;  3G4S A;  4TVA B;  3HOV H;  1G29 1;  2NZH A;  1PH7 A;  2UU9 Q;  2UUC L;  1VCI A;  1PYS B;  2UXD Q;  2R7Z G;  1N8R C;  5JJK A;  1AH9 A;  2JA8 H;  4BBS G;  1A62 A;  2VZA A;  1SR3 A;  3OYY A;  3RQF A;  1IYJ B;  1TWC H;  5BR8 Q;  2ZM6 Q;  4DAY B;  5IYB H;  3GTK H;  2PQA B;  1PYB A;  1UWV A;  2AMC B;  1FJG Q;  1CUK A;  1RJM A;  3HKZ E;  3UDF A;  1JT8 A;  1BBW A;  4JBW A;  4R4Q A;  2IX1 A;  3AEV A;  1PH1 A;  1K73 C;  3KOJ A;  2E8G A;  2HIV A;  5C3E G;  3I7F A;  3STB D;  2ZTD A;  1N9W A;  4OX9 L;  3HOZ H;  2L15 A;  4B3R L;  4JBM A;  4GKJ Q;  5M5Y H;  3TS2 A;  4GOP C;  1PH8 A;  3CXC A;  4B3M L;  2BA1 A;  3STB C;  3PO3 H;  4LFB L;  5GRO A;  3D31 A;  4DV0 L;  2K14 A;  5M3M G;  3AJM A;  2Q2H A;  3CCR A;  1N36 Q;  1HZC A;  4NPS A;  4DV1 L;  3SGI A;  2OWO A;  1EOV A;  2N3S A;  2MO1 A;  4A3I G;  1JJG A;  2A1A A;  1XMO L;  4IJL A;  2R7F A;  5FJ8 G;  1HZB A;  4IOC A;  1S3O A;  2N49 A;  1LUZ A;  5C4X H;  5LMN W;  4OX9 Q;  4DV2 Q;  3NEM A;  4UP9 A;  4LF4 L;  2F4V Q;  2HIX A;  4HJ5 A;  4Y7N H;  3BJU A;  1JJC B;  4LF6 L;  4WJ3 M;  3J81 c;  1X3E A;  4A3J H;  1IBM Q;  4JI5 Q;  2K4K A;  3I4O A;  3WWV A;  5GAH C;  3J7Z C;  1XMQ Q;  4HJ9 A;  3CC2 A;  4X66 L;  1X55 A;  3AQQ A;  4GNX B;  3UE0 A;  4DR3 L;  4LUZ A;  1PA6 A;  4JCV E;  1PFS A;  1BVS A;  2BH2 A;  2VNU D;  2UUB L;  2MQH A;  1EIY B;  2FXQ A;  4R4C A;  4DAM A;  2VW9 A;  1OXX K;  1K8A C;  4LFC L;  3A4M A;  4DUZ L;  1OXV A;  1HR0 W;  5M3F G;  3A4L A;  4R4O A;  1HNX Q;  4LF8 Q;  2YV5 A;  1Q1B A;  3AFQ A;  1PHJ A;  3K7A H;  1A63 A;  5IE8 A;  2NZO A;  2B63 H;  5M5W H;  1QVC A;  2I5M X;  4A4I A;  1GM5 A;  2OCE A;  2N78 A;  5IYB G;  1D8L A;  1VQP A;  2XTI A;  1S72 A;  3RQG A;  2ATW A;  4X66 Q;  3KYH C;  4JBJ A;  4A3E G;  3RLO A;  1UE1 A;  2ZJP A;  2UUA Q;  4JI7 Q;  2PNH A;  4X62 L;  1I94 L;  3L2P A;  2R6G A;  4L5S A;  3CCU A;  1UEB A;  2LSS A;  1NY4 A;  3NEN A;  4C2M H;  2RCN A;  4KI0 A;  1X6O A;  3HFZ B;  3L8J A;  4DV6 L;  3L8I A;  3VDY A;  1WCM G;  1N34 L;  1OXS C;  4RMF A;  4UP8 A;  4C3J H;  4GOP B;  1MJE A;  1B70 B;  4YHH Q;  2Q2U A;  4B3T L;  3HOY G;  1ASZ A;  3PUX A;  4XIG S;  4IJH A;  3FKI G;  1WJJ A;  1VQ8 A;  2UXD L;  3CCL A;  3RLF A;  3HOU H;  5ELO A;  3TRZ A;  5M3M H;  1VQ6 A;  4A3C G;  2E5L L;  1VQI A;  1N36 L;  1VQN A;  2UXB Q;  1WI5 A;  4HIM A;  4LWC A;  1CKO A;  1XNQ L;  3KDF B;  1IBM L;  2RHS B;  4ALP A;  4DR4 Q;  1O7I A;  1OXU A;  4DV6 Q;  3KF6 A;  1UX4 A;  2ID0 A;  2CFM A;  2NN6 I;  3JC6 6;  4P72 A;  4YWK A;  1M1K C;  1HNZ L;  2R92 G;  4JBK A;  3K81 C;  2D0P A;  4JI1 Q;  2VQF Q;  2KHI A;  4O0A A;  1YEZ A;  3HOY H;  4BY7 G;  3W1B A;  3GTM H;  4WJ4 A;  1TWH H;  2JEA I;  2R93 G;  4L5Q A;  3F2D A;  3ERS X;  2KBN A;  5IP7 H;  4HJ8 A;  4HID A;  4GLX A;  4A3F G;  1VQK A;  4DV4 Q;  1CKN A;  4ME3 A;  1R9T H;  4LF5 Q;  4O2D A;  5GAG C;  3I55 A;  3M4Q A;  3HOU G;  4DR7 L;  2B3G A;  3KF6 B;  4GS3 A;  4LF9 Q;  3A5Z B;  3UDI A;  1XNQ Q;  3ER0 A;  4MZ9 A;  1KL9 A;  2WAQ G;  4YY3 Q;  4LFB Q;  4MTN A;  4IFD J;  1A0I A;  4YWL A;  1YI2 A;  1LTL A;  3PF5 A;  3CCE A;  4LF7 Q;  4IFD G;  2P63 A;  1EIF A;  4R1J A;  4DR5 Q;  3U4V A;  4BBR G;  4JG2 A;  1FGU A;  1K8G A;  1W2B A;  2VUM H;  3G71 A;  4JI2 Q;  2Q2T A;  1XTD A;  3RNU A;  5C3E H;  3MXN B;  5LMU Q;  4BY7 H;  2GN5 A;  3M9B A;  1E22 A;  2QA4 A;  4A3K H;  1N34 Q;  5JEA G;  1Z9F A;  4PZ7 A;  1V1Q A;  1XNR Q;  3U58 A;  3CP0 A;  4NXN L;  2HT1 A;  1I5F A;  2LXK A;  1VS0 A;  1FVI A;  4AYB G;  3ICE A;  2Q2I A;  2C35 B;  1LM0 A;  4GOP A;  4GKK Q;  1YZ6 A;  2E2I H;  2HQL A;  1X56 A;  3ULL A;  2AHO B;  2JA6 H;  4BBS H;  3NEL A;  4DR5 L;  3ADC A;  5IYC H;  2JQO A;  1Z47 A;  3RZO H;  1X3G A;  4BBR H;  4LFA L;  5GAD C;  4KHP L;  4JI4 L;  1GVP A;  4DR7 Q;  4DR4 L;  2K5H A;  3PGZ A;  3G6E A;  1VQ5 A;  3S1Q H;  4EX5 A;  2ZTE A;  4PG3 A;  1D7Q A;  1DGS A;  4LFC Q;  3M85 A;  1J5E L;  4JYA Q;  2Y0S E;  1K9M C;  4XTC S;  4B3M Q;  1EYG A;  3A0J A;  2WAQ E;  3HOZ G;  3RR5 A;  3S16 H;  3O4X E;  3CF5 A;  1Y1V G;  2CWP A;  4BA2 I;  1Q7Y C;  1PH6 A;  1IBL L;  2ALY B;  4R4I A;  3GTO H;  5IWA L;  4LFA Q;  1SRO A;  1RIP A;  1I50 H;  5FLM H;  1JJ2 A;  1E3P A;  1Q8K A;  3U50 C;  2ZJR A;  4A3I H;  3GD7 A;  4IFD I;  1SFO H;  1YIT A;  4JOI C;  1I6H H;  1G6P A;  1Q86 C;  4HIO A;  3ZJY C;  1EQQ A;  3J81 j;  2YTX A;  2CQO A;  2VS1 A;  5IP9 G;  3K80 C;  5LMN L;  2RF4 A;  1VQJ A;  2XGT A;  1UX5 A;  4X65 L;  1YHA A;  4DV3 Q;  1B7Y B;  1X54 A;  2OQK A;  3PIO A;  1TXY A;  3CCJ A;  4JI6 Q;  1A8V A;  2B63 G;  3HKS A;  3KLW A;  5E7N A;  4GN5 A;  4DV0 Q;  3CC7 A;  1IBL Q;  1C0A A;  1Y1V H;  4OO1 I;  2E5L Q;  2E2J H;  3E0E A;  4BA1 I;  4A3J G;  1EFW A;  3RLN A;  2UU9 L;  1HJP A;  1PH5 A;  3UE1 A;  4DNI A;  1Q82 C;  1HNW L;  1KRS A;  4QGU A;  3T1H Q;  3A5U A;  3HOX G;  1N33 Q;  4OXP A;  5EAY A;  5GAE C;  4B3T Q;  1HR0 L;  1HZA A;  1Q46 A;  2LXJ A;  3I2Z A;  4DPG A;  1NTG A;  5HGQ A;  3GTJ H;  2UXB L;  4HIK A;  1NE3 A;  1YJN A;  1K3R A;  2UXC Q;  2ZTC A;  2GVB A;  3OW2 A;  4NXN Q;  3PV0 A;  3S24 A;  3H3V H;  1QZG A;  3H3V I;  4JI0 L;  4A93 H;  5C44 H;  4JI7 L;  4GKK L;  3AM1 A;  1UE7 A;  4RG1 A;  4DK3 C;  4NB3 A;  5FLX c;  5AJ3 Q;  5IY0 A;  1Q1E A;  3UDX A;  2NN6 G;  2D0O A;  4DR2 Q;  3PO2 H;  3GDE A;  5IWA Q;  3BU2 A;  1N32 L;  3CCQ A;  1W3S A;  1HH2 P;  4DR6 L;  2UUC Q;  3PF4 A;  4DV5 Q;  4B3S Q;  1Q12 A;  5DLQ E;  3H15 A;  4LF9 L;  3J80 i;  2R93 H;  3T1Y Q;  3KDF A;  1KXL A;  4A3F H;  4DR2 L;  1Y64 B;  2OTJ A;  4X6A H;  2V1C C;  1PH2 A;  2JA8 G;  4A3B G;  3M7N A;  4YCW A;  2KHJ A;  1E7Z A;  4OON A;  3T1Y L;  1YJW A;  4JI0 Q;  3RN2 A;  5JJI A;  3L7Z C;  4L5T A;  3CCV A;  4BXX G;  1XMQ L;  2VY3 A;  4MNO A;  1K0R A;  4X64 Q;  1XJV A;  4EQ5 A;  4A75 A;  1I3Q H;  2BA0 A;  1LYL A;  1CSQ A;  2BH8 A;  1Y1W G;  3FP9 A;  1YHB A;  2Y0S G;  4PMW A;  5LMU L;  4A3K G;  3T1H L;  4DUY L;  1N33 L;  3RZD H;  3HOV G;  3G48 A;  3KFU A;  1HNZ Q;  1U0L A;  4GKJ L;  3PUW A;  2YYZ A;  1S40 A;  1L2F A;  5IT9 c;  3PO3 G;  4NXM Q;  4IPC A;  4TQU S;  2JK8 A;  5J3B A;  4DKA C;  1VQO A;  2OTL A;  3I4N H;  1QVG A;  2H5X A;  1QZH A;  4OWW B;  3FHW A;  1MIU A;  4BXX H;  2JA6 G;  2EXD A;  4NNQ A;  3H0G H;  1AE3 A;  2B29 A;  2EQS A;  3Q8D A;  5HY6 A;  4HJA A;  1X9N A;  2YTY A;  4C3I H;  1C7Y A;  1VQ7 A;  2HHH L;  4NXM L;  3UDG A;  2KEN A;  1YIJ A;  4A3G G;  4BY1 G;  2IX0 A;  3CQZ H;  3E9I A;  4DR1 Q;  4DUY Q;  5C4X G;  3S14 H;  3J7A 5;  1B8A A;  2VUM G;  4YHH L;  1TWA H;  4A3L G;  2IHE A;  4GLV B;  1G51 A;  2Z6K A;  2CCZ A;  4LF6 Q;  1P16 A;  1YVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...