3IRBA

Crystal structure of protein with unknown function from duf35 family (13815350) from sulfolobus solfataricus at 1.80 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
KEGSLLRWYDVMEAERYEYTVGPAGEQFFNGLKQNKIIGSKCSKCGRIFVPARSYCEHCFVKIENYVEINKDEAYVDSYTIIYNDDEGNKLAQPVYIALIRFPNIEGGLLCYAEGNVKVGAKAKILSFQWPLRVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Acyl-coa binding protein
molecule keywords uncharacterized protein from DUF35 family
total genus 27
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01796 OB_aCoA_assoc DUF35 OB-fold domain, acyl-CoA-associated
A PF12172 DUF35_N Rubredoxin-like zinc ribbon domain (DUF35_N)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.20 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3irbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3irbA02
2WAQE 3STBD 4BA1I 4B3TQ 2Z6KC 1Q1BA 5M3FH 1D7QA 1YI2A 4LFCL 5JJKA 1XNQQ 3BZKA 1NMFA 3PCOB 1UE7A 4OONA 1L1OC 4R4CA 4AYBG 3CCUA 4A3IH 4AYBE 4QJFA 4OWWB 2N8NA 2QEXA 2WB1G 4QIWE 1E7ZA 3GTQH 1QUQB 2L15A 1SFOH 4LF6L 3HOWG 4A76A 4GN5A 3ULJA 2RCNA 2NZOA 2K52A 2Q2UA 1I94L 1YHAA 2PQAA 4DK6C 2KHIA 3AYHB 3OW2A 2NVXH 5LMNW 1LM0A 3CCVA 4DV2L 5M3MG 3KDFB 3ULPA 1K73C 3HOZH 5BR8L 5C0XG 1AE2A 3I56A 3K0XA 1CKNB 3UDGA 3PIPA 3CCQA 1N34Q 2PQAB 2ZTCA 4IPHA 4IPCA 3H3VH 4DR5L 1JMCA 5K36G 5GAGC 1S3OA 2JA9A 1V43A 1IZ6A 1I94Q 3KYHC 1N33L 1AE3A 2JA5G 1HR0L 5H1SE 3UE0A 3PO3G 2MFIA 1RL2A 2K5HA 3STBC 1NE3A 4NXML 4DV0L 1IYJB 4JBWA 4YCVA 2K50A 1N8RC 3M3YH 2UU9L 3HOYH 2IHFA 1VQMA 2JA6G 1YHBA 2NVTH 3NENA 1SR3A 5M5YH 4JI8L 5LMNL 2D62A 3E0EA 1C9OA 2R7ZH 4QL5A 1YJWA 1ASZA 1LTLA 4JI6L 2ES2A 1JT8A 3FKIH 4DV7Q 4Y52H 4B3TL 4A3FG 1OXUA 3E9HA 4DR4L 1A62A 2YV5A 3K7AH 3G71A 1VCIA 1IBKQ 4DV0Q 4B3SQ 4XTCS 2HT1A 5IWAQ 2HQLA 4YHHL 1KD1C 1J5EQ 4MZ9A 3JC66 3CW2C 4XIGS 1G6PA 2Y0SG 4A3JG 4BA2I 2B63G 3BU2A 1N36L 2E8GA 3CC2A 4GKJQ 4OO1I 4NXNL 3KOJA 3FP9A 3RLFA 4LF6Q 4B3RL 2D0PA 1SROA 3AQQA 1Q7YC 4DR6Q 4B3SL 2IT1A 1N32L 3PF5A 1WOCA 4OXPA 1I6HH 1HZ9A 3CXCA 4X6AH 1GO3E 2KCMA 3GDEA 3W1GA 4JI1L 1GM5A 5ELOA 4BY1G 5C4XH 1FGUA 2N3SA 1GKHA 4B3RQ 1PA6A 2VQFL 1PH3A 5JJIA 4LUZA 4HIOA 5AJ3L 3PIOA 5GAHC 4DV1Q 1YZ6A 4HJ5A 1KC8C 4A3KH 4GN3B 4JV5L 2IY5B 1EUJA 4C2MH 4JI0L 3GTLH 5IT9c 5JEAG 4AQYL 1XNQL 4A3LG 4IJLA 4IOCA 4A3CH 3M7NA 3F1ZA 1QUQA 3PSIA 1HNXQ 4YWLA 5C3EH 4A3EG 4A3BG 2D0OA 2GVAA 4YWKA 3UDIA 3PO2H 3CP0A 4A93H 4P71A 1E1TA 2PI2A 2Z6KA 5IE8A 1A0IA 3S1NH 1FVIA 2WAQG 1A63A 1VQGA 3UDFA 1TWHH 4BBRH 4YY3Q 2Y0SE 3J80c 4L5RC 4DR1Q 2N78A 1JE5A 1FJGL 4B3MQ 4DAMA 4PMWA 2R93G 2UUBL 5C44H 2OCEA 3U50C 1PH9A 4HJAA 4NPSA 4LF5Q 5FLMG 5IP7G 2EQSA 4MTNA 1VQIA 3RZOH 1VQ7A 4A3DH 1UE1A 2H5XA 1IBML 3GTMH 1MJCA 1GD7A 1N34L 1K0RA 1SMXA 4BY7G 3A74A 5IP9G 2OTJA 2MO1A 2B29A 4OX9Q 2VQEQ 4QGUA 3T1HL 3JAMi 2VUMG 1AH9A 1IXRA 1YIJA 1Y14B 2OQ0A 4O2DA 3TQYA 1EIFA 4JYAL 1X3GA 3CCLA 2UXBQ 4JC0A 1Y1VG 2RHSB 4P72A 4DV4L 5J3BA 4HIKA 4GNXA 1OTCA 2N49A 1VQFA 4IPGA 3F2DA 3CCSA 3T1HQ 1MJEA 1Q1EA 2K5NA 2UXCQ 1L2FA 3GTJH 2ZJPA 3NBHB 1VQ6A 2YTYA 1IBKL 4DR7L 4JBJA 4RG1A 5M3FG 4DR4Q 1CSPA 2UXDL 1PYBA 5IYCG 3A0JA 1HZAA 4QY7A 4HJ7A 5IYDG 4DR2L 1YJ9A 4LF4L 3S2DH 4GKJL 1BBWA 1K83H 1TWFH 4A3IG 5FJ8G 3RZDH 2JEAI 3TEHB 1YJNA 3HOVH 1C7YA 1KRSA 1YEZA 3EIVA 4LF8Q 1FJGQ 1SRUA 2VL6A 3DM3A 3U4VA 2EXDA 1Q81C 4YCUA 1TXYA 2KCTA 4P73A 4FDBA 3K8AA 1CSQA 3PGZA 4JI1Q 4LF7L 3H3VI 3S14H 3M85A 2ZJQA 5M3MH 1UE5A 4LW1A 3ZJYC 2I5HA 3T1YL 2JEBI 5C0XJ 2JE6I 3H0GG 1QZHA 2CCZA 1QVCA 4A3MG 4LF8L 3J80i 3CD6A 3BJUA 2F4VQ 5IY0A 1C0AA 1NMGA 1QZGA 1TWGH 3L7ZC 4HJ9A 5GAEC 4GNXC 4C3IH 4DUZQ 3U4ZA 4JBKA 2YU9H 1KL9A 4K0KQ 5IWAL 2IHEA 2WB1E 4UP9A 2DGYA 4YHHQ 3HOYG 1EQQA 1WCMG 4GLXA 1HZCA 2RHQB 5EAYA 3DLLA 4YY3L 4DR5Q 1R9TH 1VQLA 5GADC 2I0QA 3S2HH 4QQBX 3HOUH 2KENA 1BKBA 3FKIG 4O0AA 3TS2A 2AHOB 1KHIA 2K4KA 3HKZG 2LSSA 4A3FH 4PZ6A 3EBEA 1YVCA 1IBLQ 1S40A 4LF5L 3S1RH 4JCVE 2UUBQ 1XJVA 5LMUL 4JG2A 4OO1G 1M90C 4DUYQ 1SN8A 2BA1A 4GNXB 1EQRA 1UEBA 2ALYB 4YWMA 1KRTA 2UUCQ 3CC4A 2B63H 2R92H 3SGIA 4DNIA 2IX1A 2JA7G 4GLAC 1JJ2A 1VQPA 3KJOA 3F2CA 4A3GH 1CKMA 1OXSC 1UWVA 4IFDI 4JI2Q 1MKHA 4DV7L 1IBLL 3AEVA 3PF4A 1V9PA 2QGQA 3CQZH 4OX9L 4GOPB 2NN6G 3K7UC 4JI7Q 3W5OA 5BR8Q 4AH6A 2MNAA 2OWOA 3TS0A 3RLNA 1X55A 1PH1A 4C3JH 2MO0A 2VNUD 1JB7A 1DGSA 2OQKA 3UE1A 2VS1A 2AMCB 4A75A 3MXNB 4JI5Q 3D31A 4R4OA 4B3ML 3VDYA 2CWAA 3Q8DA 4LWCA 5JEAJ 4DR2Q 1WFQA 4X65Q 3CCEA 1KAWA 2UXDQ 4R4IA 3KF8B 1U0LA 4DR3Q 5C3EG 2NVQH 4A3BH 4A4IA 3I2ZA 2WFWA 4DV3L 4IJHA 2Z0SA 1XPRA 3HFZB 2ZTEA 4A93G 3J7ZC 5GROA 1E1OA 1P8LA 1Q82C 2UU9Q 1VQHA 3KFUA 2R7DA 5AJ3Q 1OXXK 1VQ9A 4JI0Q 4LNQA 2PNHA 2ASBA 2PMZE 1QVFA 4JV5Q 2R93H 3OYYA 5C44G 1PH7A 1JJCB 5FLXc 1B7YB 3I55A 1K8AC 2F3IA 4IPDA 3PUWA 3KDFA 4EX5A 5IYBG 1G291 4BY7H 1G51A 3HOXH 1TWCH 3K80C 4JI2L 4NXNQ 4PZ8A 1D8LA 1YITA 1HNZL 1PH8A 1T9HA 3CPFA 3HKZE 4OWTB 2VUMH 2JQOA 4Y7NH 3EN2A 1L1OB 3ULLA 2XGTA 4DUZL 3RNUA 4R4TA 2YTVA 4PZ7A 1HR0Q 4ME3A 4TQUS 3U58A 4KI0A 1Y1VH 1O7IA 3J81c 4JI4L 1YNXA 4PG3A 5HY6A 3TRZA 2CWPA 1SLJA 2CFMA 1KIXA 4MNOA 4IO9A 1HNZQ 4BXXH 3AFQA 4R4QA 1HR0W 3KF6A 1X9NA 1PH5A 1Q86C 4X66Q 4DV5L 4KHZA 4HIMA 1IL2A 1H95A 5IYCH 3KF6B 1NY4A 4J15A 1X56A 2ZM6Q 3I4MG 4EQ5A 5IYDH 4JI4Q 1VQ4A 1EIYB 2K75A 2UXBL 5FJ8H 1E3PA 4DUYL 2E2JH 1HNWQ 2F52A 4LFAQ 2AKWB 4DV4Q 3HOVG 1KQSA 2BH2A 2JA8H 4LFBQ 1XNRQ 4JOIC 2UUAL 3L2PA 1Y1WH 1GVPA 1L1OA 1PH2A 3S1MH 2A8VA 1CUKA 2RF4A 1A8VA 2C35B 4X66L 4X62Q 1NBWA 1PH4A 2AWOA 4JI7L 3I4NG 4BBSG 3CPWA 1S72A 1ASYA 3GTOH 3G48A 3H0GH 1CKNA 4JI3L 3ICEA 4A3MH 4POFA 2BH8A 2K5VA 3HKSA 4DV6Q 5DLQE 2BA0A 4JI5L 1PYSB 1M1KC 5GQOA 1I5FA 1N9WA 4KLKA 2HHHL 2VQEL 3RR5A 2WP8J 1JJGA 4DR3L 1VQDA 3GD7A 3T1YQ 1YBYA 1LUZA 5C4JH 4IOAA 4WJ3M 1WCMH 3W1BA 1I3QH 1OXVA 3CC7A 1J6QA 4RMFA 3F8TA 2DUDA 1Q12A 3HOUG 1HH2P 3HOWH 3TREA 2VW9A 4HJ8A 4DR1L 1RIPA 1XMOQ 3HOZG 3KLWA 3J81i 2V1CC 1FL0A 1TWAH 2B3GA 2NZHA 2ZM6L 3GTPH 1XTDA 5C0XI 2HIXA 1VQOA 4LFAL 2R92G 3JAMc 2VQFQ 1PH6A 4LF4Q 2JA7H 4WJ4A 1VQEA 2KBNA 4A3GG 1PHJA 3CCJA 2CKZB 3F2BA 4X64L 1W2BA 5M5WH 4JI8Q 2VY3A 2E5LQ 3AFPA 4X65L 4GOPA 4YCWA 4X62L 4UY8C 2JA5H 4JI6Q 1EYGA 1EOVA 2AWNA 1VQ5A 1SE8A 5M5XH 3PO3H 5E7NA 2K14A 5LMUQ 4AQYQ 1EFWA 1XPUA 3K81C 1WI5A 1XMOL 1X6OA 4JI3Q 3D0FA 2JA6H 2QA4A 3CCMA 4DKAC 1OXTA 3A5ZB 1U5KA 1N36Q 2CQOA 2R7ZG 1VS0A 4GKKQ 3NELA 3GO5A 2F4VL 4DR7Q 4GN4B 4DR6L 1N33Q 3CMAA 2FXQA 4DV5Q 3M9BA 4ALPA 4POGA 2YYZA 2GVBA 2A19A 3M4PA 4TVAB 3J7A5 1VQKA 1QVGA 4LF9L 1Z47A 2ZJRA 3LGJA 3KJPA 4NXMQ 1WYDA 1LYLA 1BVSA 2Q2IA 3I7FA 4A3JH 3J81j 1XNRL 2ID0A 1VQ8A 2NVYH 1HNWL 4LFBL 1NTGA 2R6GA 3OTOL 1X54A 4DAYB 4JBMA 4L5QA 4LUVA 2E2HH 3UDXA 3G6EA 2XTIA 4JYAQ 4DV3Q 1PFSA 2JK8A 1VQJA 1YHQA 4LF7Q 3NEMA 4LF9Q 2LXJA 3S15H 4LUOA 4UP8A 4BY1H 5C4XG 1KXLA 5IYBH 1P16A 3M4QA 3HOXG 3FHWA 1WJJA 2KHJA 1X65A 4DPGA 1E24A 3S1QH 3GTKH 3OTOQ 2HHHQ 2UXCL 3CCRA 3M4OH 1CKOA 1VQAA 2MQHA 2LXKA 4A3KG 1PV4A 4AIMA 4KHPQ 2YTXA 5JJLA 4A3LH 1W3SA 4OWXB 4A3CG 2ZTDA 4L5TA 1HZBA 4A3EH 4UPAA 1EWIA 4UP7A 3PO2G 2HIVA 4GKKL 4P75A 1I50H 3RN5A 4H02A 3PUYA 4C3HH 3ER0A 1Z9FA 4BXXG 3L0OA 3PUXA 4BBRG 1UE6A 5LMNQ 2NN6I 1V1QA 2I5MX 5HGQA 2UUAQ 1K9MC 4GS3A 4DV2Q 4DK3C 1E22A 4HIDA 1HNXL 2Q2TA 3B6YA 3I4MH 4KHPL 3RN2A 4IFDJ 4JOIA 4IFDG 2JJQA 1Q8KA 3PUVA 1XMQQ 3I4OA 2EIFA 2PI2E 5FLMH 5IP7H 1K8GA 3WWVA 2Q2HA 3IRBA 1J5EL 3MEFA 2UUCL 1L0WA 4A3DG 3H15A 4DV6L 1HJPA 3CMEA 3E9IA 2JA8G 4X64Q 1X3FA 3CAMA 1BBUA 5IP9H 5ELNA 2OTLA 3S16H 4P74A 4NB3A 3S24A 1Y1WG 2IX0A 2E5LL 3GTGH 2E2IH 1N32Q 4APVA 3S17H 2VZAA 1PVOA 4LFCQ 4K0KL 4R1JA 3PV0A 4L5SA 3G4SA 3I4NH 4BBSH 1VQBA 1IBMQ 1XMQL 2I5LX 1B8AA 1Q46A 3BZCA 1K3RA 1X3EA 2R7FA 3CF5A 4GOPC 2ATWA 1NJIC 3A5UA 3PUZA 4GLVB 1MIUA 3ERSX 4DV1L 2A1AA 3RLOA 1B70B 2GN5A 1VQCA 1XPOA 1VQNA
chains in the Genus database with same CATH superfamily
4BA1I 5CORA 3STBD 3RZDB 2Z6KC 2HUGA 1H9MA 1X3PA 3H02A 3BZKA 1G2TA 1UE7A 4R4CA 3CCUA 4AYBG 1RCVD 2Q8RE 3EFXD 2QEXA 1TWHB 1S5FD 4QIWE 1E2WA 4ZUIA 3GTQH 4ZKCB 1IKMA 4GN5A 1QOHA 4UHVA 3WOFA 3FMCA 5JPNC 4FF2A 4HR7B 2ZXPA 4DK6C 2NVXH 2VREA 3E0JA 2HDMA 4XQJA 3KDFB 4DV2L 5BR8L 3J80E 1A6XA 1AE2A 2B8GA 3NPPA 3Q6SA 4RH6A 3FKIB 3UDGA 4ELXA 5KNDA 3PIPA 3C2PA 4ABNA 2R7ZB 2A69D 4DR5L 4U1AA 1S3OA 4Z9CB 5GAGC 5M9OA 5ISRA 1I94Q 3KYHC 1HR0L 4G7ZC 3HRXA 1OO9B 4C3IG 1NE3A 2KHSA 4NXML 1IYJB 1H9SA 3M3YH 2IHFA 3R3OA 2JA6G 4HMIA 1YHBA 4K2KA 5IT9L 2F0SA 5LMNL 4BS9A 2D62A 3KBXA 4JI6L 2ES2A 1JT8A 3FKIH 1L0XB 1SBBB 2Y0SB 3K7AH 3EQLC 1BDOA 1KD1C 1HA6A 1BCPD 3CW2C 1G6PA 3K5LA 1EY3A 1A3UA 2Q8IB 4GKJQ 1X32A 4FXGC 5M5YB 3RLFA 4DAPA 3S15B 4H7BA 1T5XD 1GO3E 4CHTB 1D5XC 1SYGA 4B3RQ 2VXWA 3S1NB 1PA6A 5E4XA 2VQFL 5JJIA 5I9PA 1K3BC 4HIOA 4JV5L 4A3KH 4QB4A 3IKJA 2A73B 4C2MH 3QJYA 2OT2A 3HRZC 1YNJD 2OEOA 3GV3A 1EYDA 3OWEB 1HNXQ 4PMCA 1F9RA 4CKBA 5I6YA 2PI2A 5IE8A 2R93B 5D65A 2ZQRA 1X3QA 1CI3M 2EPBA 2F0OA 2Y0SE 1JE5A 4B3MQ 4DAMA 2LS01 2UUBL 1PH9A 3HINA 4LF5Q 1HHVA 1XX8A 2FHTA 2QILA 2XRSD 1SAPA 2F4IA 3MXNA 4IFDH 1QE6A 2G9DA 1TVXA 2H5XA 3C46A 1AW7A 2JXMB 3T4AC 2K33A 1SMXA 3H0GB 1O7ZA 2B2YC 4EQOA 4A3MB 2MO1A 2B29A 3MEHA 4OX9Q 2VQEQ 1LACA 1RODA 2VUMG 2IJ0A 4ZQ3A 1AH9A 1T5EA 2SNMA 4O2DA 4KD4A 3TQYA 4JYAL 3E6ZX 3CCLA 3R2TA 1DM0B 4HIKA 1TS5A 2F0WA 4KY5A 1SNDA 2B2UC 3JAML 4IPGA 3T1HQ 1Q1EA 2UXCQ 1S5DD 5KYLA 3GTJH 3SLLA 1IBKL 4JBJA 5M3FG 4DR4Q 2UXDL 3OW7A 1ZEQX 1QWYA 5IYDG 5T1GA 2EY1A 3S2DH 4HTHA 1TWFH 4A3IG 1TWGB 3VR2A 1HQMC 2JA7B 2F0VA 4DA2A 4CBVA 4FZWA 2WIIB 4FO2A 1SRUA 2VL6A 4RKLA 4CGYB 1Q81C 4ZLTF 2E2DC 1VDZA 4MTKA 1CSQA 3PGZA 1F9SA 4JI1Q 4LF7L 1EIHA 3M85A 5M3MH 1UE5A 3ZJYC 1J8IA 3A4LA 2CW0C 5M5XB 5C0XH 3OMGA 4O1NA 2CCZA 1DOKA 5IY0A 1C0AA 4HN7A 2JP1A 1NMGA 1PDQA 2WKDA 5A2QL 1TWGH 1HTLD 3L7ZC 4QIWB 4IUUA 5E1FA 4U18A 1IW7C 3Q23A 1A3TA 1KL9A 4UP9A 4WFN3 1CHPD 1WCMG 1HZCA 1QVFA 1STBA 4YY3L 5KEEA 1STHA 1O78A 2UZFA 2AQ3B 1EOTA 3D4RA 2KENA 3TS2A 2A74C 4A3FH 4PZ6A 3EBEA 1YVCA 2K5QA 4N8FA 1PTOD 2B39A 2UUBQ 5C4HA 1WTWA 4JG2A 4FF3A 2J0TD 2BA1A 2MJ8A 4WJWA 2F6QA 4K8IA 1BF4A 2UUCQ 3CC4A 3PO3B 2B63H 1RTNA 1JJ2A 3HS0C 1VQPA 1U4MA 4DV7L 2F0JA 1R9TB 2QGQA 3DWQA 2NN6G 3K7UC 3W5OA 3S1RB 5BR8Q 3TS0A 4XYQA 1BCPB 3PQIA 3RLNA 1WD0A 5EPLA 1MGSA 3R93A 4C3JH 1JB7A 1DGSA 1BOSA 2O2LD 3K6OA 3MYBA 2CWAA 2L4NA 1AP0A 3TN2A 3CCEA 4DNTB 2UXDQ 1U0LA 4A3BH 4A4IA 5ELEA 2WFWA 2XWJB 2JYOA 2EXZA 3KFUA 1P8LA 3DEOA 1Q82C 2R7DA 1DXMA 2NB0A 1VQ9A 2PNHA 5IGDA 2ASBA 2PMZE 1EZ6A 2R93H 3Q24A 3PO2B 3I55A 3SE0A 1QNUA 5CV8A 3G7LA 4EX5A 5IYBG 4BY7H 3K5OA 1TWCH 2NBFA 1A15A 4NXNQ 1D8LA 1B2TA 1T9HA 2EJFC 3CPFA 5A35A 4Y7NH 3EN2A 1L1OB 4DUZL 1PTOH 4R4TA 3BG3A 4ME3A 2C9OA 1Y1VH 2K32A 3J81c 3VYTA 2CWPA 4XQNA 2A68C 1SFOB 1JE4A 1KIXA 1WZ8A 4C3HG 5DM63 3AFQA 4BXXH 3S2DB 2NUCA 4HSPA 3KF6B 1NY4A 1TY0A 4JW0A 4JI4Q 4ELWA 4DUYL 4N9PA 3VR6A 4LFAQ 4ELSA 3HOVG 5ELBA 5IGFA 2JA8H 1XNRQ 2UUAL 2F0MA 1STYA 1Y1WH 1YNND 1PH2A 2A8VA 1CUKA 4NDXA 1Y69U 4RGNA 1PH4A 4H0LC 1GOZA 4V190 3I4NG 1CQVA 1SE3A 1CKNA 4RHRA 3J81E 1DOLA 3ICEA 2ENBA 4CJ1B 4ILWA 3T56B 1PYSB 1M1KC 5CV9A 1M8AA 3QK8A 2M9VA 3RR5A 1Q52A 4IOAA 1YBYA 1I3QH 1J6QA 1HH2P 4X3KA 2K28A 4HJ8A 3HZXA 1SXTA 1BXTA 3GTPH 2V1CC 2A6HC 2VQFQ 1PRTD 4WJ4A 3R9SA 4DXFA 4A3GG 1SYCA 4XT3B 1PHJA 2CKZB 4K5WA 3VYRA 2QF7A 1F9PA 1V1PB 3AFPA 3KUPA 4YCWA 5IODA 2JA5H 2RQXA 2ZXOA 1XPUA 1XMOL 2L12A 4OGQC 4JI3Q 3TP8A 4NNQA 1H9KA 4HSVA 2CQOA 3FVQA 1XWEA 3L8IA 1RTOA 3A54A 3NELA 3GO5A 1PFBA 4R8NA 2F4VL 3TSSA 3ND9A 3QOJA 4GN4B 1N33Q 3AMUA 4ALPA 2GVBA 1EQVA 2Z9HA 1VMCA 5EKLA 5C3WA 1WYDA 1MHWC 1LYLA 1BVSA 4A3JH 3J81j 2ID0A 2XN9C 4RCNA 3GTKB 3D6WA 1JQYD 4JBMA 4A3EB 3VYSA 1BR9A 4JYAQ 2B2YA 4QUFA 3DUZA 1PYWD 3M4QA 2FMMA 3HOXG 3SHLA 1ML0D 4XYOA 3OTOQ 4I7AA 3Q0JA 3CCRA 1U4PA 1VQAA 4A3KG 2B8FA 2RVLA 1HPCA 2YTXA 3NUCA 1W3SA 2F0HA 4OWXB 2ZTDA 2Z1CA 3M4YA 3NTIA 4P75A 3MXUA 4H02A 3PUYA 3PUXA 4BBRG 1B9NA 4L63B 1V1QA 3SK6A 5HGQA 1K9MC 5IGBA 3RN2A 4IFDG 2JJQA 3FRPB 2PI2E 2NVTH 3WWVA 3IRBA 2HCCA 1KNAA 4B9XA 4DV6L 1HJPA 1X3FA 3CAMA 1BBUA 2OTLA 1NNXA 4I4ZA 4P74A 2WAQB 4NB3A 3S17H 1PVOA 3KK7A 4BBSH 1B8AA 5DAUA 5JBWA 1F77A 2PCFB 3HOUB 3ERSX 2ICEC 4DV1L 2A1AA 1RHPA 3K58A 1B70B 3S2HB 4K5VA 1XPOA 3CKIB 1K83B 5CBAE 4LFCL 3DWAA 4OIKA 1NMFA 4OONA 2PZUA 4AYBE 1JOKA 4WORA 4OWWB 3V96A 2WB1G 4TSSA 1E7ZA 1TT2A 2R61A 2KEDA 4PNYA 3SDZA 3D4DA 1SFOH 1TWAB 3CRLC 4Q0FA 3ULJA 4KTAA 1XTCD 2Q2UA 1YHAA 1QB5D 3OW2A 5LMNW 3HOZH 4EQPA 3HOWB 1K73C 3I91A 3I56A 2EYMA 1CKNB 4KK7A 4OIJA 3CCQA 2ZTCA 4IPHA 4IPCA 3H3VH 3X3MA 2L1BA 3D8GA 3Q0AA 3UE0A 1PFNA 4CJ2C 3STBC 4JPBW 1DONA 3BS1A 2EYOA 3PMFA 1VQMA 1DCZA 4K2LA 1FGBD 5M5YH 1NZYB 4CKEA 2KCNA 2R7ZH 1K28A 4DV7Q 1OXUA 4OELB 1UEAB 4B3SQ 3G71A 1IBKQ 1VCIA 5C9GA 1D5MC 1Q51A 1J5EQ 4MZ9A 3JC66 4OO1H 1NZYA 3N52A 4BA2I 2B63G 3OC7A 2E8GA 2X6LA 3FP9A 4LF6Q 3M7GA 1SROA 1Q7YC 3LWUA 4HMJA 1UUPA 3MZ5A 4K8JA 1WOCA 3PF5A 1N32L 2OF1A 4ZUJA 3CXCA 4X6AH 4KJOA 4QIJA 1GM5A 1SNQA 4BY1G 2R3ZA 1FGUA 2N3SA 1GKHA 1C48A 5M5WB 1SJHD 1PH3A 2PMZB 4LUZA 4LAAA 1NCVA 5GAHC 4DV1Q 1YZ6A 2IY5B 4N9TA 1UX5A 4IZ8A 5JEAG 1XNQL 4A3LG 1EY0A 1I6HB 1B3QA 1DJRD 2PYKA 1PTOC 3RD4A 3PSIA 2D0OA 1HCZA 1O7YA 3UDIA 3PO2H 4P71A 4IALA 2Z6KA 3S1NH 1A63A 1TWHH 4IUNA 5FKAC 4HCSA 3VR5A 2RSNA 1CZGA 1ZYRC 3ONAB 5C44H 2OCEA 3U50C 1GHJA 2A5HA 1SNCA 5I2YA 4PMBA 5IP7G 1M4VA 3EA6A 5BN5A 5LL6X 4A3DH 1DZ1A 1ZXTA 5KRUA 1DOMA 5FO7B 2EOTA 1N34L 4BY7G 2OTJA 2NVYB 1EEID 3T16A 1BNZA 3SVMA 4QGUA 5EJWA 3JAMi 1IXRA 5CV6A 5EBDA 2L55A 1Y14B 1EIFA 3WDNA 1X3GA 1PLFA 1Y1VG 2LKVA 5CMDA 4GNXA 1MJEA 2K5NA 2HDLA 1Y64B 1EF8A 1GUOA 3RUZA 2E2JB 1PYBA 5M3MB 5IYCG 3A0JA 1HZAA 4DR2L 1YJ9A 4GKJL 1K83H 1TS2A 5FJ8G 3PIP3 3K57A 1YJNA 4OLQA 1YEZA 4ZRZA 1I4RA 3G6JB 4YCUA 4JFCA 4FDBA 5I9OA 4DK0A 3MTSA 3H3VI 2F0DA 2ZJQA 1CA5A 2JEBI 5AFWA 2IWHA 1TWCB 2ZQQA 3C3LA 3FEWX 3J80i 2K7VA 2F4VQ 2NTTA 3H81A 3TZDA 4AYBB 4KN4C 3BZDB 1ENCA 3LWEA 4HJ9A 3ND8A 5GAEC 4GNXC 3SXHA 4C3IH 5C5LA 3U4ZA 3S17B 3EROA 2YU9H 1ET6A 5IWAL 4YHHQ 2DGYA 4GLXA 5EAYA 3DLLA 2EJMA 1B53A 2N88A 1HUNA 2NWGA 2MHVA 2RCFA 2AQ2B 3HOUH 3FKIG 4O0AA 2AHOB 2KVMA 4MOUA 3LX0A 3A4NA 2RDHA 4IUPA 3H09A 2VNUD 2FBMA 1EQRA 4YWMA 1KRTA 3SGIA 2IX1A 1U4RA 3QXIA 4A3GH 3NTKA 1UWVA 4IFDI 5KIXA 2JA6B 3PF4A 4OX9L 1PRTF 1EYAA 1RJTA 4JI7Q 2OWOA 2MNAA 3RSIA 4QCLA 1X55A 1PH1A 3I72A 3FPPA 1ZYRD 2OQKA 3NWSA 2QKIC 4A75A 1FNUA 1JWSD 1D2BA 2EY2A 2N55A 1PMRA 5ELFA 3VDYA 2LFNA 3GP7A 3ZYYX 3P20A 2BDNA 1KAWA 4ZKBB 1F2LA 1NR4A 3KF8B 2NVQH 1H9JA 2WKCA 1EIGA 4KKTA 1XPRA 1H9SB 2ZTEA 3J7ZC 3ADCA 3HKZB 1OXXK 5CGKA 5I4DA 2Z8LA 4JV5Q 1E0BA 1PH7A 1JJCB 4LK1C 5J22A 1B7YB 4IPDA 5C44B 2EYJA 1WTQA 1PZKD 2PO4A 1KABA 1SNPA 1EFID 5E4WC 2IL8A 2K05A 3HP3A 3BDLA 1LO5D 2JN4A 1JORA 1FR3A 3BVGA 3RNUA 2L5TA 4PZ7A 3U58A 4FXDA 1YNNC 3TMEA 1TQOA 5HY6A 3TRZA 1SLJA 2CFMA 5G3LD 4OHJA 5IGGA 1HR0W 3KF6A 4X66Q 1EWCA 3L3OC 5C3EB 4IURA 1X56A 2AQ1B 4J15A 4EQ5A 2E2IB 5IYDH 1ESFA 3NQTA 1E3PA 2E2JH 1ICFB 3GTGB 1WTPA 3R0OA 1PTOF 4DV4Q 2BH2A 4GZYC 2CVRA 2A69C 1RD9D 1ILQA 4JOIC 2M00A 2F0NA 2RF4A 2C35B 4X66L 4X62Q 3I73A 4JI7L 3SEBA 4BBSG 4RKBA 1F2ZA 1ASYA 3G48A 3H0GH 4G57A 2XNAC 4A3MH 1XXGA 2JA8B 4DV6Q 5DLQE 4JI5L 5C3XA 5CBEE 4JOTA 3DXJC 1SJED 1N9WA 1HRJA 2HHHL 4ODGA 1JJGA 1JCKB 1VQDA 1QILA 3VR4A 3PIO3 1K0SA 3T1YQ 4WJ3M 1LUZA 5JVH3 1WCMH 4FP5D 2RDGA 3W1BA 3CC7A 5JPMC 4RMFA 2X69A 3TREA 2VW9A 1CFMA 1RIPA 3HEJA 1EEFD 1XMOQ 3FPUB 3DHQA 3KQFA 1CZWA 1FL0A 1XTDA 2R92G 2HIXA 2B2WA 1V8QA 2JA7H 2F0GA 1U9RA 1FNVA 5M5WH 5KNBA 4ZAIA 1D1IA 2VY3A 3M3YB 4X65L 1ENFA 1RJMA 1C4QA 5D3IB 4JI6Q 3S14B 1EYGA 1EOVA 2PNRC 1VQ5A 4E6IA 1SE8A 3K5MA 5E7NA 4Y7NB 3OIPA 1EFWA 3CQZB 1X6OA 1U5KA 2R7ZG 1VS0A 4GKKQ 5J39A 3ADBA 1Y8NB 3TP7A 4DR6L 4JVZA 4DV5Q 2YYZA 2A19A 3J7A5 4C3IB 1CHQD 4LF9L 1GUWA 1Z47A 2ZJRA 2B2TC 4NXMQ 4O42A 2A6ED 3M4OB 1XNRL 4LFBL 3OTOL 4A3DB 4C56C 2QDLA 4ID6A 2B2WC 4A3BB 1MI2A 3UDXA 1R4PB 3D3RA 3G6EA 3HOZB 4DV3Q 2JK8A 4LJZC 2VB2X 2B2UA 1K8OA 2E75C 2O5JC 5C4XG 2QDBA 5IYBH 4JYLA 3FHWA 1WJJA 1W6KA 1C8CA 2UXCL 4KY6A 1GUNA 1CKOA 3AU7A 5JOBA 4AIMA 4A3LH 4A3CG 2FFKB 5D14A 3K5NA 4L8JA 2EY5A 1EWIA 4UP7A 3PO2G 2P63A 3O4XE 3W3AA 2WACA 3RMHA 3AJMA 2X6GA 1UE6A 5LMNQ 4KV6A 2NN6I 3JAME 4F7XA 4QF4A 4GS3A 3I4MH 3QR8A 4KHPL 1H9RA 3DM1A 3SK4A 2VX2A 2EIFA 5FLMH 5IP7H 1K8GA 2Q2HA 2P5ZX 1V1OA 3C1FA 3L9AX 4CDEC 3CMEA 3TP5A 1SE2A 3IFDA 2IX0A 2E5LL 4LFCQ 1MJ3A 1SDFA 4R1JA 3PV0A 1LLRD 1BCPC 5EQ0A 1BO0A 1XMQL 3K59A 1X3EA 2R7FA 1BUVT 4IUQA 3T13A 1LTBD 3A5UA 4V0BA 4U19A 2EYFA 5ELDA 1VQNA 3T89A 2WAQE 4B3TQ 1Q1BA 1WTRA 5JJKA 3PCOB 3V05A 2RKSA 4QUCA 3EJIA 1SMYD 4RGOS 1AN8A 2RBMA 1QUQB 2L15A 3HOWG 2PBPA 2RCNA 2NZOA 3R2IA 2K52A 4ZCKA 2KHIA 5M3FB 2F0KA 1LM0A 4Q5VA 4P2CB 2CQAA 2G5DA 1N34Q 2PQAB 1Y1WB 2KA7A 5K36G 4RGTA 2JA9A 1TY2A 1LT6D 1AE3A 2JA5G 3S9WA 2MFIA 2K5HA 5KNCA 4S3SA 1JWMD 1N8RC 4JBWA 4OEMB 2K50A 2HW5A 4XDXA 2KUMA 1JB3A 5KGUA 4QL5A 2GTRA 1YJWA 1LTLA 1EF9A 1GUTA 1UX4A 5IT9E 1A62A 1AZPA 1LTID 2HT1A 2HQLA 1EU4A 4XIGS 4A3FB 3KLRA 4A3JG 1BQQT 3BU2A 3P7JA 2F0QA 4OO1I 4NXNL 4EGVA 5EKIA 3KOJA 3UI2A 2F1MA 3AQQA 3Q0GA 2E76C 4DR6Q 4B3SL 2IT1A 2CH4A 1I6HH 1HZ9A 2J4XA 3GDEA 2XRQD 1I4QA 4JI1L 5ELOA 1D5ZC 1PRTB 2F0LA 1IHZA 5AJ3L 1CT1D 2XIWA 4K2NA 2ZT9C 1DUBA 2AUKA 2FJ2A 4HJ5A 1KC8C 4C3JB 3GTLH 5IT9c 4AQYL 4FF4A 4IOCA 3M7NA 2H4OA 5C3EH 4A3EG 5BN4A 1EY5A 2TSSA 2I46A 4IN3A 4YWKA 4X3TA 3CP0A 1E1TA 1A3VA 3ITPA 1A0IA 3V2TA 1FVIA 3KF8A 4BBRH 4YY3Q 2Z4IA 1JXZA 1O7LA 2N78A 1FJGL 1TU2B 4G7OC 4PMWA 4HJAA 1G6ZA 3MC0B 3RQEA 4A3KB 3T8AA 3F2UA 2EQSA 3MXPA 1VQIA 4MTNA 3P5MA 1UE1A 3VR3A 1IBML 3GTMH 1MJCA 1K0RA 4JK1C 4OL7A 5IP9G 4ME5A 1D1KA 1ESRA 1KLUD 2IX3A 2Q8TA 4I42A 1Y1VB 1Q3LA 2IPKD 1F9QA 2UXBQ 2RHSB 2V4DA 3W2DA 4F8MA 2PW7A 2RA4A 1OTCA 1LTAD 1VQFA 2DNEA 2N49A 2ICIA 3F2DA 2F03A 1Y8OB 1VQ6A 4DR7L 3TBIB 4RG1A 1RJNA 4HJ7A 3A56A 4KNPA 3RZDH 2JEAI 3TEHB 1CM9A 1C7YA 1KRSA 3EIVA 1EWHA 2F0FA 2DUBA 1WTXA 5J1ZA 4C3HB 3U4VA 1TXYA 2KCTA 3K8AA 4K14A 3S14H 4EMLA 2I5HA 4BWGB 3T1YL 1LT5D 4X3SA 5C0XJ 4RWSC 3H0GG 3NQIA 1QZHA 4A3MG 3CD6A 3J7YW 1SEBD 1HFGA 1KLGD 5EGTA 4DUZQ 4R9WA 4K0KQ 2M2LA 3HOYG 2LY7A 2F0UA 1R9TH 4DR5Q 1VQLA 2I0QA 5NUCA 1EQTA 3S2HH 3T88A 4LMQD 1DD2A 1BCPF 1G8ZD 1F2YA 1BKBA 4KMUC 4RGMA 5LHY1 2D5DA 1IBLQ 1S40A 4LF5L 4G7HC 1XJVA 5LMUL 4KD3A 4OO1G 1M90C 2ALYB 2R92H 3OPOA 2JA7G 2EDGA 3F2CA 3J81L 4FYDA 3FDUA 2MPMA 4JI2Q 3AEVA 1V9PA 2FW2A 3KLSX 3GQBA 3U9OA 1HTPA 2NVQB 3W8IB 4AH6A 2QEJC 1WTVA 3NXWA 4KHVA 5COYA 1EY9A 2MO0A 1I4GA 3QO2A 3TP6A 2VS1A 2AMCB 1A2UA 4QIIA 4GEHB 2EYLA 3MXNB 5FK9C 4JI5Q 4R4OA 3VYUA 2B63B 1EY8A 5JEAJ 4HCEA 5JEAH 4R4IA 2Z4HA 2KQ3A 3I2ZA 4DV3L 2PPBC 4IJHA 3GTLB 3P75A 3OHXC 4A93G 2UU9Q 3A8IE 5AJ3Q 2KOLA 3I4LA 1UAPA 4JI0Q 4BY1B 3HOVB 2F3VA 2XSCA 4ZK9B 3AM1A 1A2TA 5C44G 2WINB 3MFYA 3DMUA 3P1HA 3QB3A 1K8AC 4I52A 1KAAA 3C1EA 3H6MA 1TR5A 3KDFA 1G291 3K80C 1VF7A 3OWFA 1YITA 1HNZL 1JC7A 3T51B 4OWTB 3HKZE 2OXPA 2JQOA 2ZXRA 1F2MA 2XGTA 3ULLA 3WOEA 1HR0Q 2YTVA 1KDCA 2D2CC 1QG7A 4KI0A 1O7IA 3EVQA 1YNXA 4PG3A 3NBIA 1WTHA 4IUTA 1BBXC 4MNOA 4IO9A 2PQEA 3IAYA 3BVZA 1PH5A 3MWYW 2XWBB 2KJXA 3GTOB 1JWUD 4HIMA 5IYCH 2ZM6Q 3I4MG 2NVXB 1VQ4A 2FMCA 5FJ8H 1HNWQ 2DN8A 3O13A 4KY7A 4LFBQ 4RHSA 1L1OA 2K5DA 4BBSB 3BVMA 5C4JB 1A8VA 4UAIA 1NBWA 1D6EC 2AWOA 1LT3D 2VB3X 2O5IC 3TRRA 3CPWA 1S72A 3GTOH 3A7LA 4JI3L 1B50A 2DJGC 3S1QB 4POFA 3HG9A 2BH8A 3I8ZA 2K5VA 3HKSA 2BA0A 4TRDA 5GQOA 3GTPB 5FOBB 1ZKOA 2EJGC 1CTMA 5L37A 2WP8J 4DR3L 3GD7A 5C4JH 1IYUA 1OXVA 4RA8A 3TDQA 1Q12A 4U673 3HOUG 3HOWH 4DR1L 2R92B 2K5WA 2QCPX 5D3DA 2EE1A 3BDCA 3KLWA 1TWAH 5A2QE 1PTOB 5C0XI 1VQOA 4LFAL 3JAMc 4LF4Q 1PFMA 3CCJA 2SDFA 1W2BA 3HOXB 1I3QB 4B08A 4GOPA 5G3LF 3I4NB 4AQYQ 3K81C 3D0FA 2JA6H 3KBGA 1SYEA 5EBCA 4DKAC 4FVMA 3RQGA 3SK5A 1S4ZA 3GV6A 2PZWA 4N8X1 4DR7Q 1ICWA 3M9BA 2YU9B 4C1NI 4IUVA 1B1ZA 1EY4A 5F2DA 1QVGA 4MHEA 3I7FA 1HNWL 2MUYA 4FXKC 2NVYH 3GTQB 4RFBA 1X54A 1CA6A 1GXDC 2XVSA 4B9WA 4XT1B 2E2HH 1STAA 1PFSA 1VQJA 1YHQA 2DJFC 3NEMA 4LF9Q 1IW7D 2LXJA 1KXLA 4DNRB 3MA2B 1L0YB 4DPGA 1E24A 4RCOA 2LXKA 3G64A 3Q1TA 4KHPQ 5JJLA 1B44D 5FO8B 1KTKA 3SR1A 1HZBA 4DAVA 4A3EH 3NSWA 1PZJD 1R4QB 4CDCC 1EZ8A 4KN7C 2K1BA 2HIVA 4GKKL 2BE5D 3ER0A 1Z9FA 1AEXA 3L0OA 2Z6BA 5CV7A 3GTMB 1QCBD 3ADDA 2I5MX 2UUAQ 1MBYA 4DV2Q 4DK3C 1E22A 4HIDA 4J6HA 2WV6D 3B6YA 1HNXL 4JOIA 3T53B 1Q8KA 3PUVA 3I4OA 3OMCA 2UUCL 1J5EL 3MEFA 3DEPA 3E9IA 1RDPD 2JSOA 3I90A 5IP9H 1I50B 5ELNA 4X64Q 3S16H 3S24A 2E2IH 4APVA 4A3IB 3G4SA 4K3WA 2I5LX 1XYIA 1Q46A 1K3RA 4F88A 4GOPC 1NJIC 3CRKC 1SNMA 1EYCA 1PXUA 4BY7B 1MIUA 3RLOA 2GN5A 2PW5A 5IGEA 4L6TB 2PZTA 4CDFC 5M3FH 1D7QA 1YI2A 1XNQQ 2MGSA 1L1OC 4A3IH 4H44C 2HQEA 4QJFA 2A68D 2N8NA 4BBRB 1AFPA 1PZID 1JR0D 4M8AA 4LF6L 4A76A 3HGBA 1E2VA 1GUSA 1HUMA 1I94L 2PQAA 3AYHB 1WCMB 3CCVA 3ULPA 1FYCA 1Z7TA 5M3MG 1IYVA 1STGA 5C0XG 3K0XA 4XXEA 4NEKA 4IZCA 1NSNS 3I3CA 1CK1A 1JMCA 3J80L 4CDDC 1V43A 1IZ6A 1N33L 1VMPA 4DU9A 5H1SE 2K04A 3PO3G 3QG1A 1RL2A 4DV0L 2O4XA 2CHBD 3E3XA 4YCVA 2UU9L 3HOYH 5IGCA 3NENA 1SR3A 4JI8L 3E0EA 1C9OA 1SYFA 1ASZA 3BDOA 4Y52H 4B3TL 4A3FG 1II3A 3E9HA 4DR4L 2CW0D 2YV5A 4A3JB 4DV0Q 4XTCS 5IWAQ 4YHHL 5C5MA 2Y0SG 1O80A 2SNSA 1N36L 2E2HB 2L9HA 1LTGD 5JJZA 3OOCA 3CC2A 2F0IA 4B3RL 3J7AF 2D0PA 1DCIA 3LNNA 4OXPA 5HURA 2NN6H 4NP5A 5DM73 2KCMA 4JWVA 3W1GA 3SK8A 3QOLA 5C4XH 4C3JG 3KLSA 1LTSD 1U4LA 3PIOA 3H3VC 5BN3A 4GN3B 1EUJA 5E3FA 4JI0L 4MI2A 2DNCA 4IJLA 5I6WA 4A3CH 3F1ZA 1QUQA 3OIQA 4YWLA 4A3BG 4K6LA 2GVAA 1Q8IA 1JICA 4A93H 4I65A 1ONLA 2HCIA 4UDUC 3A8KE 2WAQG 3X3NA 1VQGA 1NUCA 5I2XA 3UDFA 3J80c 5C4XB 4L5RC 4DR1Q 2NVTB 2TMPA 2R93G 1QNKA 2BCOA 4NPSA 4ZU2A 5FLMG 2QW7A 4RAUC 3RZOH 1IL8A 1VQ7A 1GD7A 1UNSA 4HAEA 1CQFA 3A74A 3QXZA 1GJXA 3T1HL 3FDTA 3Q22A 1MSHA 3QIAA 1YIJA 5CC4A 3H94A 2DY8A 2OQ0A 3TLFA 2EJ5A 4JC0A 2VUMB 4P72A 4DV4L 5J3BA 2WB1B 1HFNA 3URYA 3CCSA 2BOSA 3RZOB 1L2FA 2ZJPA 3NBHB 2YTYA 1KNEA 3I70A 1CSPA 4QY7A 4QMGA 4LF4L 1BBWA 2K01A 1I4XA 3S1MB 4EVOA 3HOVH 4NW2A 4LF8Q 1FJGQ 3DM3A 2EXDA 4F47A 1TS3A 4WRDA 4U68A 3BYTB 4P73A 1RF2D 2B2VC 1SNOA 3D6CA 2GA4B 4DF7A 1GHKA 4LW1A 1TIID 3QWNA 3R9TA 1KDBA 2NZ1D 2JE6I 4I7ZC 1QVCA 4LF8L 3BJUA 1Q90A 3K0YA 3NP8A 4ULLA 5K36H 2IW3A 1QZGA 5KJPA 2MP1A 3HOYB 2IEXA 3IL8A 4ZYSA 4C2MB 3E5SA 1VF5C 4M1UB 4JBKA 3RQFA 2IHEA 2WB1E 1EQQA 2RHQB 5GADC 3NE5B 2F0EA 4QQBX 1B3AA 2K4KA 1KHIA 3HKZG 2LSSA 3S1RH 4JCVE 1LABA 3BYYB 1YNJC 3CU7A 4K5XA 3TZUA 1LV9A 4DUYQ 1JOOA 1SN8A 4GNXB 1UEBA 4HEDA 4JCSA 4DNIA 2B2VA 4GLAC 3KJOA 1CKMA 1OXSC 1MKHA 1IBLL 5ELCA 4EQNA 3CQZH 3NK9A 4GOPB 4FNFA 2E74C 2EYHA 2F0TA 2PPYA 5CYUA 4DFAA 1ILPA 3VA5A 1W6JA 3UE1A 3MVVA 1JOQA 1PRTC 2KCCA 2D9UA 3D31A 4KKUA 4B3ML 1E2ZA 3W8HB 3Q8DA 4LWCA 5FLXL 4DR2Q 1EY6A 1WFQA 4X65Q 1WVLA 1IKLA 1KDAA 3OSOA 5C3EG 4DR3Q 3MOYA 1NR2A 2EY6A 2Z0SA 5CR3A 3HFZB 1SYBA 3A4MA 5GROA 1E1OA 1VQHA 1B9MA 4LNQA 3A55A 3NHHA 1EY7A 3OYYA 5C4ZA 5FLXc 1G91A 3MXGA 2F3IA 3PUWA 4FF1A 1WD1A 3IFTA 1G51A 3HOXH 1I6VC 1QJOA 1RKNA 4J8QA 4JI2L 4PZ8A 5JAVA 1PH8A 3ERQA 2FINB 2VUMH 2C5CA 5CV5A 4TQUS 5HGTA 1K8MA 4NMZA 4R8IA 4JI4L 2L11A 1ENAA 1HQRD 1SMYC 4F87A 1HNZQ 4R4QA 4DN4M 3SWXA 3L8JA 1X9NA 2LMCB 4DK1A 1Q86C 4DV5L 4KHZA 1IL2A 2NTSA 1H95A 5FLXE 3I47A 4FZWC 4X3UA 1EIYB 2K75A 2UXBL 5EPJA 2F52A 2J7ZA 3VA7A 2AKWB 3GTJB 3J7AV 1NAPA 1KQSA 1S5BD 3L2PA 2K6AA 1GVPA 4YIJA 3S1MH 4K6DA 1TKWB 1S5CD 5LL6S 2I07B 1WTOA 1STNA 5C6AA 3MFGA 1Y8PB 1Z6HA 2B2TA 1I5FA 2F3WA 2RSOA 4KLKA 4XQQA 2VQEL 2EZVA 1EU3A 4H13C 1G2SA 5CV4A 4TKOB 4KKSA 1STEA 3F8TA 5EPKA 2DUDA 1HXYD 4FJWD 5JBXA 1GUGA 1ET9A 4KJNA 5T1IA 2QQ3A 1TWFB 3HOZG 3U9SA 3J81i 2B3GA 2NZHA 2ZM6L 1PH6A 1VQEA 1SE4A 2KBNA 5EKKA 1DYQA 1AZQA 2K03A 3F2BA 4X64L 4JI8Q 4DGZA 2E5LQ 4UY8C 4PV1C 4X62L 4A3GB 3D4WA 2AWNA 3PO3H 5M5XH 1UIYA 2K14A 5LMUQ 1WI5A 4CJ0B 2QA4A 1LTTD 3CCMA 1N36Q 1OXTA 3A5ZB 3NWTA 3NBHA 4MIUA 5TSSA 2F0PA 3CMAA 2FXQA 4POGA 2JA5B 3M4PA 4TVAB 1VQKA 1FNWA 1LT4D 2AUJD 3LGJA 5DEHA 3KJPA 2Q2IA 3K7AB 1TS4A 1VQ8A 4OG1A 1NTGA 2R6GA 4IQZA 4DAYB 1V1PA 4L5QA 4DXGA 4IZBA 4LUVA 2CH4W 2H1EA 2XTIA 2DY7A 1I4PA 1SYDA 4LF7Q 1MSGA 5IOCA 5IIFA 3S15H 4LUOA 4UP8A 3H91A 4BY1H 1HZDA 1FD7D 1P16A 2G9HD 2KHJA 2NYZD 1MD2D 1X65A 1S5ED 2SOBA 4NKLA 3GTKH 3S1QH 1B4OA 4MN3A 2HHHQ 4A93B 4C1NK 2L0CA 3M4OH 2MQHA 4PQXA 2A6EC 1PV4A 2RDFA 2KEEA 3NTHA 4L5TA 4DAYA 2EYPA 2KECA 5JVG3 4UPAA 3DWPA 1I50H 3S16B 3RN5A 4C3HH 4BXXG 5K5PA 1SSOA 2BDOA 2HD3A 4IZDA 3N6RA 2Q2TA 4J1MA 4IFDJ 2EVBA 1J9OA 1I4HA 1XMQQ 1HA5A 4A3DG 1L0WA 3H15A 2JA8G 2BE5C 4G4KA 3PZKA 3GTGH 1Y1WG 5FO9B 1N32Q 2SEBD 3A8JE 2VZAA 4K0KL 2A6HD 3MHBA 4L5SA 3I4NH 4WCZA 1VQBA 1IBMQ 1EL0A 3BZCA 3CF5A 3I4MB 2ATWA 3CHBD 3R8BA 3A7AB 4CKCA 3PUZA 4GLVB 5KYIA 3MAQA 5DNFA 1VQCA 1LTRD 3AB9A
chains in the Genus database with same CATH topology
2WAQE 3STBD 4BA1I 4B3TQ 2Z6KC 1Q1BA 5M3FH 1D7QA 1YI2A 4LFCL 5JJKA 1XNQQ 3BZKA 1NMFA 3PCOB 1UE7A 4OONA 1L1OC 4R4CA 4AYBG 3CCUA 4A3IH 4AYBE 4QJFA 4OWWB 2N8NA 2QEXA 2WB1G 4QIWE 1E7ZA 3GTQH 1QUQB 2L15A 1SFOH 4LF6L 3HOWG 4A76A 4GN5A 3ULJA 2RCNA 2NZOA 2K52A 2Q2UA 1I94L 1YHAA 2PQAA 4DK6C 2KHIA 3AYHB 3OW2A 2NVXH 5LMNW 1LM0A 3CCVA 4DV2L 5M3MG 3KDFB 3ULPA 1K73C 3HOZH 5BR8L 5C0XG 1AE2A 3I56A 3K0XA 1CKNB 3UDGA 3PIPA 3CCQA 1N34Q 2PQAB 2ZTCA 4IPHA 4IPCA 3H3VH 4DR5L 1JMCA 5K36G 5GAGC 1S3OA 2JA9A 1V43A 1IZ6A 1I94Q 3KYHC 1N33L 1AE3A 2JA5G 1HR0L 5H1SE 3UE0A 3PO3G 2MFIA 1RL2A 2K5HA 3STBC 1NE3A 4NXML 4DV0L 1IYJB 4JBWA 4YCVA 2K50A 1N8RC 3M3YH 2UU9L 3HOYH 2IHFA 1VQMA 2JA6G 1YHBA 2NVTH 3NENA 1SR3A 5M5YH 4JI8L 5LMNL 2D62A 3E0EA 1C9OA 2R7ZH 4QL5A 1YJWA 1ASZA 1LTLA 4JI6L 2ES2A 1JT8A 3FKIH 4DV7Q 4Y52H 4B3TL 4A3FG 1OXUA 3E9HA 1UX4A 4DR4L 1A62A 2YV5A 3K7AH 3G71A 1VCIA 1IBKQ 4DV0Q 4B3SQ 4XTCS 2HT1A 5IWAQ 2HQLA 4YHHL 1KD1C 1J5EQ 4MZ9A 3JC66 3CW2C 4XIGS 1G6PA 2Y0SG 4A3JG 4BA2I 2B63G 3BU2A 1N36L 2E8GA 3CC2A 4GKJQ 4OO1I 4NXNL 3KOJA 3FP9A 3RLFA 4LF6Q 4B3RL 2D0PA 1SROA 3AQQA 1Q7YC 4DR6Q 4B3SL 2IT1A 1N32L 3PF5A 1WOCA 4OXPA 1I6HH 1HZ9A 3CXCA 4X6AH 1GO3E 2KCMA 3GDEA 3W1GA 4JI1L 1GM5A 5ELOA 4BY1G 5C4XH 1FGUA 2N3SA 1GKHA 4B3RQ 1PA6A 2VQFL 1PH3A 5JJIA 4LUZA 4HIOA 5AJ3L 3PIOA 5GAHC 4DV1Q 1YZ6A 4HJ5A 1KC8C 4A3KH 1UX5A 4GN3B 4JV5L 2IY5B 1EUJA 4C2MH 4JI0L 3GTLH 5IT9c 5JEAG 4AQYL 1XNQL 4A3LG 4IJLA 4IOCA 4A3CH 3M7NA 3F1ZA 1QUQA 3PSIA 1HNXQ 4YWLA 5C3EH 4A3EG 4A3BG 2D0OA 2GVAA 4YWKA 3UDIA 3PO2H 3CP0A 4A93H 4P71A 1E1TA 2PI2A 2Z6KA 5IE8A 1A0IA 3S1NH 1FVIA 2WAQG 1A63A 1VQGA 3UDFA 1TWHH 4BBRH 4YY3Q 2Y0SE 3J80c 4L5RC 4DR1Q 2N78A 1JE5A 1FJGL 4B3MQ 4DAMA 4PMWA 2R93G 2UUBL 5C44H 2OCEA 3U50C 1PH9A 4HJAA 4NPSA 4LF5Q 3RQEA 5FLMG 5IP7G 2EQSA 4MTNA 1VQIA 3RZOH 1VQ7A 4A3DH 1UE1A 2H5XA 1IBML 3GTMH 1MJCA 1GD7A 1N34L 1K0RA 1SMXA 4BY7G 3A74A 5IP9G 2OTJA 2MO1A 2B29A 4OX9Q 2VQEQ 4QGUA 3T1HL 3JAMi 2VUMG 1AH9A 1IXRA 1YIJA 1Y14B 2OQ0A 4O2DA 3TQYA 1EIFA 4JYAL 1X3GA 3CCLA 2UXBQ 4JC0A 1Y1VG 2RHSB 4P72A 4DV4L 5J3BA 4HIKA 4GNXA 1OTCA 2N49A 1VQFA 4IPGA 3F2DA 3CCSA 3T1HQ 1MJEA 1Q1EA 2K5NA 2UXCQ 1L2FA 3GTJH 2ZJPA 3NBHB 1VQ6A 2YTYA 1IBKL 4DR7L 4JBJA 1Y64B 4RG1A 5M3FG 1CSPA 4DR4Q 2UXDL 1PYBA 5IYCG 3A0JA 1HZAA 4QY7A 4HJ7A 5IYDG 4DR2L 1YJ9A 4LF4L 3S2DH 4GKJL 1BBWA 1K83H 1TWFH 4A3IG 5FJ8G 3RZDH 2JEAI 3TEHB 1YJNA 3HOVH 1C7YA 1KRSA 1YEZA 3EIVA 4LF8Q 1FJGQ 1SRUA 2VL6A 3DM3A 3U4VA 2EXDA 1Q81C 4YCUA 1TXYA 2KCTA 4P73A 4FDBA 3K8AA 1CSQA 3PGZA 4JI1Q 4LF7L 3H3VI 3S14H 3M85A 2ZJQA 5M3MH 1UE5A 4LW1A 3ZJYC 3A4LA 2I5HA 3T1YL 2JEBI 5C0XJ 2JE6I 3H0GG 1QZHA 2CCZA 1QVCA 4A3MG 4LF8L 3J80i 3CD6A 3BJUA 2F4VQ 5IY0A 1C0AA 1NMGA 1QZGA 1TWGH 3L7ZC 4HJ9A 5GAEC 4GNXC 4C3IH 4DUZQ 3U4ZA 4JBKA 2YU9H 1KL9A 4K0KQ 5IWAL 3RQFA 2IHEA 2WB1E 2DGYA 4UP9A 4YHHQ 3HOYG 1EQQA 1WCMG 4GLXA 1HZCA 2RHQB 5EAYA 3DLLA 4YY3L 4DR5Q 1R9TH 1VQLA 5GADC 2I0QA 3S2HH 4QQBX 3HOUH 2KENA 1BKBA 3FKIG 4O0AA 3TS2A 2AHOB 1KHIA 2K4KA 3HKZG 2LSSA 4A3FH 4PZ6A 3EBEA 1YVCA 1IBLQ 3A4NA 1S40A 4LF5L 3S1RH 4JCVE 2UUBQ 1XJVA 5LMUL 4JG2A 4OO1G 1M90C 4DUYQ 1SN8A 2BA1A 4GNXB 1EQRA 1UEBA 2ALYB 4YWMA 1KRTA 2UUCQ 3CC4A 2B63H 2R92H 3SGIA 4DNIA 2IX1A 2JA7G 4GLAC 1JJ2A 1VQPA 3KJOA 3F2CA 4A3GH 1CKMA 1OXSC 1UWVA 4IFDI 4JI2Q 1MKHA 4DV7L 1IBLL 3AEVA 3PF4A 1V9PA 2QGQA 3CQZH 4OX9L 4GOPB 2NN6G 3K7UC 4JI7Q 3W5OA 3W8IB 5BR8Q 4AH6A 2MNAA 2OWOA 3TS0A 3RLNA 1X55A 1PH1A 4C3JH 2MO0A 2VNUD 1JB7A 1DGSA 2OQKA 3UE1A 2VS1A 2AMCB 4A75A 4GEHB 3MXNB 4JI5Q 3D31A 4R4OA 4B3ML 3W8HB 3VDYA 2CWAA 3Q8DA 4LWCA 5JEAJ 4DR2Q 1WFQA 4X65Q 3CCEA 1KAWA 2UXDQ 4R4IA 3KF8B 1U0LA 4DR3Q 5C3EG 2NVQH 4A3BH 4A4IA 3I2ZA 2WFWA 4DV3L 4IJHA 2Z0SA 1XPRA 3HFZB 2ZTEA 4A93G 3A4MA 3J7ZC 5GROA 1E1OA 1P8LA 1Q82C 2UU9Q 1VQHA 3KFUA 2R7DA 5AJ3Q 3ADCA 1OXXK 1VQ9A 4JI0Q 4LNQA 2PNHA 2ASBA 2PMZE 1QVFA 4JV5Q 3AM1A 2R93H 3OYYA 5C44G 1PH7A 1JJCB 5FLXc 1B7YB 3I55A 1K8AC 2F3IA 4IPDA 3PUWA 3KDFA 4EX5A 5IYBG 1G291 4BY7H 1G51A 3HOXH 1TWCH 3K80C 4JI2L 4NXNQ 4PZ8A 1D8LA 1YITA 1HNZL 1PH8A 1T9HA 3CPFA 3HKZE 4OWTB 2VUMH 2JQOA 4Y7NH 3EN2A 1L1OB 3ULLA 2XGTA 4DUZL 3RNUA 4R4TA 2YTVA 4PZ7A 1HR0Q 4ME3A 4TQUS 3U58A 4KI0A 1Y1VH 1O7IA 3J81c 4JI4L 1YNXA 4PG3A 5HY6A 3TRZA 2CWPA 1SLJA 2CFMA 1KIXA 4MNOA 4IO9A 1HNZQ 4BXXH 3AFQA 4R4QA 1HR0W 3L8JA 3KF6A 1X9NA 1PH5A 1Q86C 4X66Q 4DV5L 4KHZA 4HIMA 1IL2A 1H95A 5IYCH 3KF6B 1NY4A 4J15A 1X56A 2ZM6Q 3I4MG 4EQ5A 5IYDH 4JI4Q 1VQ4A 1EIYB 2K75A 2UXBL 5FJ8H 1E3PA 4DUYL 2E2JH 1HNWQ 2F52A 4LFAQ 2AKWB 4DV4Q 3HOVG 1KQSA 2BH2A 2JA8H 4LFBQ 1XNRQ 4JOIC 2UUAL 3L2PA 1Y1WH 1GVPA 1L1OA 1PH2A 3S1MH 2A8VA 1CUKA 2RF4A 1A8VA 2C35B 4X66L 4X62Q 1NBWA 1PH4A 2AWOA 4JI7L 3I4NG 4BBSG 3CPWA 1S72A 1ASYA 3GTOH 3G48A 3H0GH 1CKNA 4JI3L 3ICEA 4A3MH 4POFA 2BH8A 2K5VA 3HKSA 4DV6Q 5DLQE 2BA0A 4JI5L 1PYSB 1M1KC 5GQOA 1I5FA 1N9WA 4KLKA 2HHHL 2VQEL 3RR5A 2WP8J 1JJGA 4DR3L 1VQDA 3GD7A 3T1YQ 1YBYA 1LUZA 5C4JH 4IOAA 4WJ3M 1WCMH 3W1BA 1I3QH 1OXVA 3CC7A 1J6QA 4RMFA 3F8TA 2DUDA 1Q12A 3HOUG 1HH2P 3HOWH 3TREA 2VW9A 4HJ8A 4DR1L 1RIPA 1XMOQ 3HOZG 3KLWA 3J81i 2V1CC 1FL0A 1TWAH 2B3GA 2NZHA 2ZM6L 3GTPH 1XTDA 5C0XI 2HIXA 1VQOA 4LFAL 2R92G 3JAMc 2VQFQ 1PH6A 4LF4Q 2JA7H 4WJ4A 1VQEA 2KBNA 4A3GG 1PHJA 3CCJA 2CKZB 3F2BA 4X64L 1W2BA 5M5WH 4JI8Q 2VY3A 2E5LQ 3AFPA 4X65L 4GOPA 4YCWA 4X62L 1RJMA 4UY8C 2JA5H 4JI6Q 1EYGA 1EOVA 2AWNA 1VQ5A 1SE8A 5M5XH 3PO3H 5E7NA 2K14A 5LMUQ 4AQYQ 1EFWA 1XPUA 3K81C 1WI5A 1XMOL 1X6OA 4JI3Q 3D0FA 2JA6H 4NNQA 2QA4A 3CCMA 4DKAC 1OXTA 3A5ZB 1U5KA 1N36Q 3RQGA 2CQOA 3L8IA 1VS0A 2R7ZG 3NELA 4GKKQ 3GO5A 2F4VL 3ADBA 4DR7Q 4GN4B 4DR6L 1N33Q 3CMAA 2FXQA 4DV5Q 3M9BA 4ALPA 4POGA 2YYZA 2GVBA 2A19A 3M4PA 4TVAB 3J7A5 1VQKA 1QVGA 4LF9L 1Z47A 2ZJRA 3LGJA 3KJPA 4NXMQ 1WYDA 1LYLA 1BVSA 2Q2IA 3I7FA 4A3JH 3J81j 1XNRL 2ID0A 1VQ8A 2NVYH 1HNWL 4LFBL 1NTGA 2R6GA 3OTOL 1X54A 4DAYB 4JBMA 4L5QA 4LUVA 2E2HH 3UDXA 3G6EA 2XTIA 4JYAQ 4DV3Q 1PFSA 2JK8A 1VQJA 1YHQA 4LF7Q 3NEMA 4LF9Q 2LXJA 3S15H 4LUOA 4UP8A 4BY1H 5C4XG 1KXLA 5IYBH 1P16A 3M4QA 3HOXG 3FHWA 1WJJA 2KHJA 1X65A 4DPGA 1E24A 3S1QH 3GTKH 3OTOQ 2HHHQ 2UXCL 3CCRA 3M4OH 1CKOA 1VQAA 2MQHA 2LXKA 4A3KG 1PV4A 4AIMA 4KHPQ 2YTXA 5JJLA 4A3LH 1W3SA 4OWXB 4A3CG 2ZTDA 4L5TA 1HZBA 4A3EH 4UPAA 1EWIA 4UP7A 3PO2G 2P63A 3O4XE 2HIVA 4GKKL 4P75A 1I50H 3RN5A 4H02A 3PUYA 4C3HH 3AJMA 1Z9FA 3ER0A 4BXXG 3L0OA 3PUXA 4BBRG 1UE6A 5LMNQ 3ADDA 2NN6I 1V1QA 2I5MX 5HGQA 2UUAQ 1K9MC 4GS3A 4DV2Q 4DK3C 1E22A 4HIDA 1HNXL 2Q2TA 3B6YA 3I4MH 4KHPL 3RN2A 4IFDJ 4JOIA 4IFDG 2JJQA 1Q8KA 3PUVA 1XMQQ 3I4OA 2EIFA 2PI2E 5FLMH 5IP7H 1K8GA 3WWVA 2Q2HA 3IRBA 1J5EL 3MEFA 2UUCL 1L0WA 4A3DG 3H15A 4DV6L 1HJPA 3CMEA 3E9IA 2JA8G 4X64Q 1X3FA 3CAMA 1BBUA 5IP9H 5ELNA 2OTLA 3S16H 4P74A 4NB3A 3S24A 1Y1WG 2IX0A 2E5LL 3GTGH 2E2IH 1N32Q 4APVA 3S17H 2VZAA 1PVOA 4LFCQ 4K0KL 4R1JA 3PV0A 4L5SA 3G4SA 3I4NH 4BBSH 1VQBA 1IBMQ 1XMQL 2I5LX 1B8AA 1Q46A 3BZCA 1K3RA 1X3EA 2R7FA 3CF5A 4GOPC 2ATWA 1NJIC 3A5UA 3PUZA 4GLVB 1MIUA 3ERSX 4DV1L 2A1AA 3RLOA 1B70B 2GN5A 1VQCA 1XPOA 1VQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ E;  3STB D;  4BA1 I;  4B3T Q;  2Z6K C;  1Q1B A;  5M3F H;  1D7Q A;  1YI2 A;  4LFC L;  5JJK A;  1XNQ Q;  3BZK A;  1NMF A;  3PCO B;  1UE7 A;  4OON A;  1L1O C;  4R4C A;  4AYB G;  3CCU A;  4A3I H;  4AYB E;  4QJF A;  4OWW B;  2N8N A;  2QEX A;  2WB1 G;  4QIW E;  1E7Z A;  3GTQ H;  1QUQ B;  2L15 A;  1SFO H;  4LF6 L;  3HOW G;  4A76 A;  4GN5 A;  3ULJ A;  2RCN A;  2NZO A;  2K52 A;  2Q2U A;  1I94 L;  1YHA A;  2PQA A;  4DK6 C;  2KHI A;  3AYH B;  3OW2 A;  2NVX H;  5LMN W;  1LM0 A;  3CCV A;  4DV2 L;  5M3M G;  3KDF B;  3ULP A;  1K73 C;  3HOZ H;  5BR8 L;  5C0X G;  1AE2 A;  3I56 A;  3K0X A;  1CKN B;  3UDG A;  3PIP A;  3CCQ A;  1N34 Q;  2PQA B;  2ZTC A;  4IPH A;  4IPC A;  3H3V H;  4DR5 L;  1JMC A;  5K36 G;  5GAG C;  1S3O A;  2JA9 A;  1V43 A;  1IZ6 A;  1I94 Q;  3KYH C;  1N33 L;  1AE3 A;  2JA5 G;  1HR0 L;  5H1S E;  3UE0 A;  3PO3 G;  2MFI A;  1RL2 A;  2K5H A;  3STB C;  1NE3 A;  4NXM L;  4DV0 L;  1IYJ B;  4JBW A;  4YCV A;  2K50 A;  1N8R C;  3M3Y H;  2UU9 L;  3HOY H;  2IHF A;  1VQM A;  2JA6 G;  1YHB A;  2NVT H;  3NEN A;  1SR3 A;  5M5Y H;  4JI8 L;  5LMN L;  2D62 A;  3E0E A;  1C9O A;  2R7Z H;  4QL5 A;  1YJW A;  1ASZ A;  1LTL A;  4JI6 L;  2ES2 A;  1JT8 A;  3FKI H;  4DV7 Q;  4Y52 H;  4B3T L;  4A3F G;  1OXU A;  3E9H A;  4DR4 L;  1A62 A;  2YV5 A;  3K7A H;  3G71 A;  1VCI A;  1IBK Q;  4DV0 Q;  4B3S Q;  4XTC S;  2HT1 A;  5IWA Q;  2HQL A;  4YHH L;  1KD1 C;  1J5E Q;  4MZ9 A;  3JC6 6;  3CW2 C;  4XIG S;  1G6P A;  2Y0S G;  4A3J G;  4BA2 I;  2B63 G;  3BU2 A;  1N36 L;  2E8G A;  3CC2 A;  4GKJ Q;  4OO1 I;  4NXN L;  3KOJ A;  3FP9 A;  3RLF A;  4LF6 Q;  4B3R L;  2D0P A;  1SRO A;  3AQQ A;  1Q7Y C;  4DR6 Q;  4B3S L;  2IT1 A;  1N32 L;  3PF5 A;  1WOC A;  4OXP A;  1I6H H;  1HZ9 A;  3CXC A;  4X6A H;  1GO3 E;  2KCM A;  3GDE A;  3W1G A;  4JI1 L;  1GM5 A;  5ELO A;  4BY1 G;  5C4X H;  1FGU A;  2N3S A;  1GKH A;  4B3R Q;  1PA6 A;  2VQF L;  1PH3 A;  5JJI A;  4LUZ A;  4HIO A;  5AJ3 L;  3PIO A;  5GAH C;  4DV1 Q;  1YZ6 A;  4HJ5 A;  1KC8 C;  4A3K H;  4GN3 B;  4JV5 L;  2IY5 B;  1EUJ A;  4C2M H;  4JI0 L;  3GTL H;  5IT9 c;  5JEA G;  4AQY L;  1XNQ L;  4A3L G;  4IJL A;  4IOC A;  4A3C H;  3M7N A;  3F1Z A;  1QUQ A;  3PSI A;  1HNX Q;  4YWL A;  5C3E H;  4A3E G;  4A3B G;  2D0O A;  2GVA A;  4YWK A;  3UDI A;  3PO2 H;  3CP0 A;  4A93 H;  4P71 A;  1E1T A;  2PI2 A;  2Z6K A;  5IE8 A;  1A0I A;  3S1N H;  1FVI A;  2WAQ G;  1A63 A;  1VQG A;  3UDF A;  1TWH H;  4BBR H;  4YY3 Q;  2Y0S E;  3J80 c;  4L5R C;  4DR1 Q;  2N78 A;  1JE5 A;  1FJG L;  4B3M Q;  4DAM A;  4PMW A;  2R93 G;  2UUB L;  5C44 H;  2OCE A;  3U50 C;  1PH9 A;  4HJA A;  4NPS A;  4LF5 Q;  5FLM G;  5IP7 G;  2EQS A;  4MTN A;  1VQI A;  3RZO H;  1VQ7 A;  4A3D H;  1UE1 A;  2H5X A;  1IBM L;  3GTM H;  1MJC A;  1GD7 A;  1N34 L;  1K0R A;  1SMX A;  4BY7 G;  3A74 A;  5IP9 G;  2OTJ A;  2MO1 A;  2B29 A;  4OX9 Q;  2VQE Q;  4QGU A;  3T1H L;  3JAM i;  2VUM G;  1AH9 A;  1IXR A;  1YIJ A;  1Y14 B;  2OQ0 A;  4O2D A;  3TQY A;  1EIF A;  4JYA L;  1X3G A;  3CCL A;  2UXB Q;  4JC0 A;  1Y1V G;  2RHS B;  4P72 A;  4DV4 L;  5J3B A;  4HIK A;  4GNX A;  1OTC A;  2N49 A;  1VQF A;  4IPG A;  3F2D A;  3CCS A;  3T1H Q;  1MJE A;  1Q1E A;  2K5N A;  2UXC Q;  1L2F A;  3GTJ H;  2ZJP A;  3NBH B;  1VQ6 A;  2YTY A;  1IBK L;  4DR7 L;  4JBJ A;  4RG1 A;  5M3F G;  4DR4 Q;  1CSP A;  2UXD L;  1PYB A;  5IYC G;  3A0J A;  1HZA A;  4QY7 A;  4HJ7 A;  5IYD G;  4DR2 L;  1YJ9 A;  4LF4 L;  3S2D H;  4GKJ L;  1BBW A;  1K83 H;  1TWF H;  4A3I G;  5FJ8 G;  3RZD H;  2JEA I;  3TEH B;  1YJN A;  3HOV H;  1C7Y A;  1KRS A;  1YEZ A;  3EIV A;  4LF8 Q;  1FJG Q;  1SRU A;  2VL6 A;  3DM3 A;  3U4V A;  2EXD A;  1Q81 C;  4YCU A;  1TXY A;  2KCT A;  4P73 A;  4FDB A;  3K8A A;  1CSQ A;  3PGZ A;  4JI1 Q;  4LF7 L;  3H3V I;  3S14 H;  3M85 A;  2ZJQ A;  5M3M H;  1UE5 A;  4LW1 A;  3ZJY C;  2I5H A;  3T1Y L;  2JEB I;  5C0X J;  2JE6 I;  3H0G G;  1QZH A;  2CCZ A;  1QVC A;  4A3M G;  4LF8 L;  3J80 i;  3CD6 A;  3BJU A;  2F4V Q;  5IY0 A;  1C0A A;  1NMG A;  1QZG A;  1TWG H;  3L7Z C;  4HJ9 A;  5GAE C;  4GNX C;  4C3I H;  4DUZ Q;  3U4Z A;  4JBK A;  2YU9 H;  1KL9 A;  4K0K Q;  5IWA L;  2IHE A;  2WB1 E;  4UP9 A;  2DGY A;  4YHH Q;  3HOY G;  1EQQ A;  1WCM G;  4GLX A;  1HZC A;  2RHQ B;  5EAY A;  3DLL A;  4YY3 L;  4DR5 Q;  1R9T H;  1VQL A;  5GAD C;  2I0Q A;  3S2H H;  4QQB X;  3HOU H;  2KEN A;  1BKB A;  3FKI G;  4O0A A;  3TS2 A;  2AHO B;  1KHI A;  2K4K A;  3HKZ G;  2LSS A;  4A3F H;  4PZ6 A;  3EBE A;  1YVC A;  1IBL Q;  1S40 A;  4LF5 L;  3S1R H;  4JCV E;  2UUB Q;  1XJV A;  5LMU L;  4JG2 A;  4OO1 G;  1M90 C;  4DUY Q;  1SN8 A;  2BA1 A;  4GNX B;  1EQR A;  1UEB A;  2ALY B;  4YWM A;  1KRT A;  2UUC Q;  3CC4 A;  2B63 H;  2R92 H;  3SGI A;  4DNI A;  2IX1 A;  2JA7 G;  4GLA C;  1JJ2 A;  1VQP A;  3KJO A;  3F2C A;  4A3G H;  1CKM A;  1OXS C;  1UWV A;  4IFD I;  4JI2 Q;  1MKH A;  4DV7 L;  1IBL L;  3AEV A;  3PF4 A;  1V9P A;  2QGQ A;  3CQZ H;  4OX9 L;  4GOP B;  2NN6 G;  3K7U C;  4JI7 Q;  3W5O A;  5BR8 Q;  4AH6 A;  2MNA A;  2OWO A;  3TS0 A;  3RLN A;  1X55 A;  1PH1 A;  4C3J H;  2MO0 A;  2VNU D;  1JB7 A;  1DGS A;  2OQK A;  3UE1 A;  2VS1 A;  2AMC B;  4A75 A;  3MXN B;  4JI5 Q;  3D31 A;  4R4O A;  4B3M L;  3VDY A;  2CWA A;  3Q8D A;  4LWC A;  5JEA J;  4DR2 Q;  1WFQ A;  4X65 Q;  3CCE A;  1KAW A;  2UXD Q;  4R4I A;  3KF8 B;  1U0L A;  4DR3 Q;  5C3E G;  2NVQ H;  4A3B H;  4A4I A;  3I2Z A;  2WFW A;  4DV3 L;  4IJH A;  2Z0S A;  1XPR A;  3HFZ B;  2ZTE A;  4A93 G;  3J7Z C;  5GRO A;  1E1O A;  1P8L A;  1Q82 C;  2UU9 Q;  1VQH A;  3KFU A;  2R7D A;  5AJ3 Q;  1OXX K;  1VQ9 A;  4JI0 Q;  4LNQ A;  2PNH A;  2ASB A;  2PMZ E;  1QVF A;  4JV5 Q;  2R93 H;  3OYY A;  5C44 G;  1PH7 A;  1JJC B;  5FLX c;  1B7Y B;  3I55 A;  1K8A C;  2F3I A;  4IPD A;  3PUW A;  3KDF A;  4EX5 A;  5IYB G;  1G29 1;  4BY7 H;  1G51 A;  3HOX H;  1TWC H;  3K80 C;  4JI2 L;  4NXN Q;  4PZ8 A;  1D8L A;  1YIT A;  1HNZ L;  1PH8 A;  1T9H A;  3CPF A;  3HKZ E;  4OWT B;  2VUM H;  2JQO A;  4Y7N H;  3EN2 A;  1L1O B;  3ULL A;  2XGT A;  4DUZ L;  3RNU A;  4R4T A;  2YTV A;  4PZ7 A;  1HR0 Q;  4ME3 A;  4TQU S;  3U58 A;  4KI0 A;  1Y1V H;  1O7I A;  3J81 c;  4JI4 L;  1YNX A;  4PG3 A;  5HY6 A;  3TRZ A;  2CWP A;  1SLJ A;  2CFM A;  1KIX A;  4MNO A;  4IO9 A;  1HNZ Q;  4BXX H;  3AFQ A;  4R4Q A;  1HR0 W;  3KF6 A;  1X9N A;  1PH5 A;  1Q86 C;  4X66 Q;  4DV5 L;  4KHZ A;  4HIM A;  1IL2 A;  1H95 A;  5IYC H;  3KF6 B;  1NY4 A;  4J15 A;  1X56 A;  2ZM6 Q;  3I4M G;  4EQ5 A;  5IYD H;  4JI4 Q;  1VQ4 A;  1EIY B;  2K75 A;  2UXB L;  5FJ8 H;  1E3P A;  4DUY L;  2E2J H;  1HNW Q;  2F52 A;  4LFA Q;  2AKW B;  4DV4 Q;  3HOV G;  1KQS A;  2BH2 A;  2JA8 H;  4LFB Q;  1XNR Q;  4JOI C;  2UUA L;  3L2P A;  1Y1W H;  1GVP A;  1L1O A;  1PH2 A;  3S1M H;  2A8V A;  1CUK A;  2RF4 A;  1A8V A;  2C35 B;  4X66 L;  4X62 Q;  1NBW A;  1PH4 A;  2AWO A;  4JI7 L;  3I4N G;  4BBS G;  3CPW A;  1S72 A;  1ASY A;  3GTO H;  3G48 A;  3H0G H;  1CKN A;  4JI3 L;  3ICE A;  4A3M H;  4POF A;  2BH8 A;  2K5V A;  3HKS A;  4DV6 Q;  5DLQ E;  2BA0 A;  4JI5 L;  1PYS B;  1M1K C;  5GQO A;  1I5F A;  1N9W A;  4KLK A;  2HHH L;  2VQE L;  3RR5 A;  2WP8 J;  1JJG A;  4DR3 L;  1VQD A;  3GD7 A;  3T1Y Q;  1YBY A;  1LUZ A;  5C4J H;  4IOA A;  4WJ3 M;  1WCM H;  3W1B A;  1I3Q H;  1OXV A;  3CC7 A;  1J6Q A;  4RMF A;  3F8T A;  2DUD A;  1Q12 A;  3HOU G;  1HH2 P;  3HOW H;  3TRE A;  2VW9 A;  4HJ8 A;  4DR1 L;  1RIP A;  1XMO Q;  3HOZ G;  3KLW A;  3J81 i;  2V1C C;  1FL0 A;  1TWA H;  2B3G A;  2NZH A;  2ZM6 L;  3GTP H;  1XTD A;  5C0X I;  2HIX A;  1VQO A;  4LFA L;  2R92 G;  3JAM c;  2VQF Q;  1PH6 A;  4LF4 Q;  2JA7 H;  4WJ4 A;  1VQE A;  2KBN A;  4A3G G;  1PHJ A;  3CCJ A;  2CKZ B;  3F2B A;  4X64 L;  1W2B A;  5M5W H;  4JI8 Q;  2VY3 A;  2E5L Q;  3AFP A;  4X65 L;  4GOP A;  4YCW A;  4X62 L;  4UY8 C;  2JA5 H;  4JI6 Q;  1EYG A;  1EOV A;  2AWN A;  1VQ5 A;  1SE8 A;  5M5X H;  3PO3 H;  5E7N A;  2K14 A;  5LMU Q;  4AQY Q;  1EFW A;  1XPU A;  3K81 C;  1WI5 A;  1XMO L;  1X6O A;  4JI3 Q;  3D0F A;  2JA6 H;  2QA4 A;  3CCM A;  4DKA C;  1OXT A;  3A5Z B;  1U5K A;  1N36 Q;  2CQO A;  2R7Z G;  1VS0 A;  4GKK Q;  3NEL A;  3GO5 A;  2F4V L;  4DR7 Q;  4GN4 B;  4DR6 L;  1N33 Q;  3CMA A;  2FXQ A;  4DV5 Q;  3M9B A;  4ALP A;  4POG A;  2YYZ A;  2GVB A;  2A19 A;  3M4P A;  4TVA B;  3J7A 5;  1VQK A;  1QVG A;  4LF9 L;  1Z47 A;  2ZJR A;  3LGJ A;  3KJP A;  4NXM Q;  1WYD A;  1LYL A;  1BVS A;  2Q2I A;  3I7F A;  4A3J H;  3J81 j;  1XNR L;  2ID0 A;  1VQ8 A;  2NVY H;  1HNW L;  4LFB L;  1NTG A;  2R6G A;  3OTO L;  1X54 A;  4DAY B;  4JBM A;  4L5Q A;  4LUV A;  2E2H H;  3UDX A;  3G6E A;  2XTI A;  4JYA Q;  4DV3 Q;  1PFS A;  2JK8 A;  1VQJ A;  1YHQ A;  4LF7 Q;  3NEM A;  4LF9 Q;  2LXJ A;  3S15 H;  4LUO A;  4UP8 A;  4BY1 H;  5C4X G;  1KXL A;  5IYB H;  1P16 A;  3M4Q A;  3HOX G;  3FHW A;  1WJJ A;  2KHJ A;  1X65 A;  4DPG A;  1E24 A;  3S1Q H;  3GTK H;  3OTO Q;  2HHH Q;  2UXC L;  3CCR A;  3M4O H;  1CKO A;  1VQA A;  2MQH A;  2LXK A;  4A3K G;  1PV4 A;  4AIM A;  4KHP Q;  2YTX A;  5JJL A;  4A3L H;  1W3S A;  4OWX B;  4A3C G;  2ZTD A;  4L5T A;  1HZB A;  4A3E H;  4UPA A;  1EWI A;  4UP7 A;  3PO2 G;  2HIV A;  4GKK L;  4P75 A;  1I50 H;  3RN5 A;  4H02 A;  3PUY A;  4C3H H;  3ER0 A;  1Z9F A;  4BXX G;  3L0O A;  3PUX A;  4BBR G;  1UE6 A;  5LMN Q;  2NN6 I;  1V1Q A;  2I5M X;  5HGQ A;  2UUA Q;  1K9M C;  4GS3 A;  4DV2 Q;  4DK3 C;  1E22 A;  4HID A;  1HNX L;  2Q2T A;  3B6Y A;  3I4M H;  4KHP L;  3RN2 A;  4IFD J;  4JOI A;  4IFD G;  2JJQ A;  1Q8K A;  3PUV A;  1XMQ Q;  3I4O A;  2EIF A;  2PI2 E;  5FLM H;  5IP7 H;  1K8G A;  3WWV A;  2Q2H A;  3IRB A;  1J5E L;  3MEF A;  2UUC L;  1L0W A;  4A3D G;  3H15 A;  4DV6 L;  1HJP A;  3CME A;  3E9I A;  2JA8 G;  4X64 Q;  1X3F A;  3CAM A;  1BBU A;  5IP9 H;  5ELN A;  2OTL A;  3S16 H;  4P74 A;  4NB3 A;  3S24 A;  1Y1W G;  2IX0 A;  2E5L L;  3GTG H;  2E2I H;  1N32 Q;  4APV A;  3S17 H;  2VZA A;  1PVO A;  4LFC Q;  4K0K L;  4R1J A;  3PV0 A;  4L5S A;  3G4S A;  3I4N H;  4BBS H;  1VQB A;  1IBM Q;  1XMQ L;  2I5L X;  1B8A A;  1Q46 A;  3BZC A;  1K3R A;  1X3E A;  2R7F A;  3CF5 A;  4GOP C;  2ATW A;  1NJI C;  3A5U A;  3PUZ A;  4GLV B;  1MIU A;  3ERS X;  4DV1 L;  2A1A A;  3RLO A;  1B70 B;  2GN5 A;  1VQC A;  1XPO A;  1VQN A; 
#chains in the Genus database with same CATH topology
 4BA1 I;  5COR A;  3STB D;  3RZD B;  2Z6K C;  2HUG A;  1H9M A;  1X3P A;  3H02 A;  3BZK A;  1G2T A;  1UE7 A;  4R4C A;  3CCU A;  4AYB G;  1RCV D;  2Q8R E;  3EFX D;  2QEX A;  1TWH B;  1S5F D;  4QIW E;  1E2W A;  4ZUI A;  3GTQ H;  4ZKC B;  1IKM A;  4GN5 A;  1QOH A;  4UHV A;  3WOF A;  3FMC A;  5JPN C;  4FF2 A;  4HR7 B;  2ZXP A;  4DK6 C;  2NVX H;  2VRE A;  3E0J A;  2HDM A;  4XQJ A;  3KDF B;  4DV2 L;  5BR8 L;  3J80 E;  1A6X A;  1AE2 A;  2B8G A;  3NPP A;  3Q6S A;  4RH6 A;  3FKI B;  3UDG A;  4ELX A;  5KND A;  3PIP A;  3C2P A;  4ABN A;  2R7Z B;  2A69 D;  4DR5 L;  4U1A A;  1S3O A;  4Z9C B;  5GAG C;  5M9O A;  5ISR A;  1I94 Q;  3KYH C;  1HR0 L;  4G7Z C;  3HRX A;  1OO9 B;  4C3I G;  1NE3 A;  2KHS A;  4NXM L;  1IYJ B;  1H9S A;  3M3Y H;  2IHF A;  3R3O A;  2JA6 G;  4HMI A;  1YHB A;  4K2K A;  5IT9 L;  2F0S A;  5LMN L;  4BS9 A;  2D62 A;  3KBX A;  4JI6 L;  2ES2 A;  1JT8 A;  3FKI H;  1L0X B;  1SBB B;  2Y0S B;  3K7A H;  3EQL C;  1BDO A;  1KD1 C;  1HA6 A;  1BCP D;  3CW2 C;  1G6P A;  3K5L A;  1EY3 A;  1A3U A;  2Q8I B;  4GKJ Q;  1X32 A;  4FXG C;  5M5Y B;  3RLF A;  4DAP A;  3S15 B;  4H7B A;  1T5X D;  1GO3 E;  4CHT B;  1D5X C;  1SYG A;  4B3R Q;  2VXW A;  3S1N B;  1PA6 A;  5E4X A;  2VQF L;  5JJI A;  5I9P A;  1K3B C;  4HIO A;  4JV5 L;  4A3K H;  4QB4 A;  3IKJ A;  2A73 B;  4C2M H;  3QJY A;  2OT2 A;  3HRZ C;  1YNJ D;  2OEO A;  3GV3 A;  1EYD A;  3OWE B;  1HNX Q;  4PMC A;  1F9R A;  4CKB A;  5I6Y A;  2PI2 A;  5IE8 A;  2R93 B;  5D65 A;  2ZQR A;  1X3Q A;  1CI3 M;  2EPB A;  2F0O A;  2Y0S E;  1JE5 A;  4B3M Q;  4DAM A;  2LS0 1;  2UUB L;  1PH9 A;  3HIN A;  4LF5 Q;  1HHV A;  1XX8 A;  2FHT A;  2QIL A;  2XRS D;  1SAP A;  2F4I A;  3MXN A;  4IFD H;  1QE6 A;  2G9D A;  1TVX A;  2H5X A;  3C46 A;  1AW7 A;  2JXM B;  3T4A C;  2K33 A;  1SMX A;  3H0G B;  1O7Z A;  2B2Y C;  4EQO A;  4A3M B;  2MO1 A;  2B29 A;  3MEH A;  4OX9 Q;  2VQE Q;  1LAC A;  1ROD A;  2VUM G;  2IJ0 A;  4ZQ3 A;  1AH9 A;  1T5E A;  2SNM A;  4O2D A;  4KD4 A;  3TQY A;  4JYA L;  3E6Z X;  3CCL A;  3R2T A;  1DM0 B;  4HIK A;  1TS5 A;  2F0W A;  4KY5 A;  1SND A;  2B2U C;  3JAM L;  4IPG A;  3T1H Q;  1Q1E A;  2UXC Q;  1S5D D;  5KYL A;  3GTJ H;  3SLL A;  1IBK L;  4JBJ A;  5M3F G;  4DR4 Q;  2UXD L;  3OW7 A;  1ZEQ X;  1QWY A;  5IYD G;  5T1G A;  2EY1 A;  3S2D H;  4HTH A;  1TWF H;  4A3I G;  1TWG B;  3VR2 A;  1HQM C;  2JA7 B;  2F0V A;  4DA2 A;  4CBV A;  4FZW A;  2WII B;  4FO2 A;  1SRU A;  2VL6 A;  4RKL A;  4CGY B;  1Q81 C;  4ZLT F;  2E2D C;  1VDZ A;  4MTK A;  1CSQ A;  3PGZ A;  1F9S A;  4JI1 Q;  4LF7 L;  1EIH A;  3M85 A;  5M3M H;  1UE5 A;  3ZJY C;  1J8I A;  3A4L A;  2CW0 C;  5M5X B;  5C0X H;  3OMG A;  4O1N A;  2CCZ A;  1DOK A;  5IY0 A;  1C0A A;  4HN7 A;  2JP1 A;  1NMG A;  1PDQ A;  2WKD A;  5A2Q L;  1TWG H;  1HTL D;  3L7Z C;  4QIW B;  4IUU A;  5E1F A;  4U18 A;  1IW7 C;  3Q23 A;  1A3T A;  1KL9 A;  4UP9 A;  4WFN 3;  1CHP D;  1WCM G;  1HZC A;  1QVF A;  1STB A;  4YY3 L;  5KEE A;  1STH A;  1O78 A;  2UZF A;  2AQ3 B;  1EOT A;  3D4R A;  2KEN A;  3TS2 A;  2A74 C;  4A3F H;  4PZ6 A;  3EBE A;  1YVC A;  2K5Q A;  4N8F A;  1PTO D;  2B39 A;  2UUB Q;  5C4H A;  1WTW A;  4JG2 A;  4FF3 A;  2J0T D;  2BA1 A;  2MJ8 A;  4WJW A;  2F6Q A;  4K8I A;  1BF4 A;  2UUC Q;  3CC4 A;  3PO3 B;  2B63 H;  1RTN A;  1JJ2 A;  3HS0 C;  1VQP A;  1U4M A;  4DV7 L;  2F0J A;  1R9T B;  2QGQ A;  3DWQ A;  2NN6 G;  3K7U C;  3W5O A;  3S1R B;  5BR8 Q;  3TS0 A;  4XYQ A;  1BCP B;  3PQI A;  3RLN A;  1WD0 A;  5EPL A;  1MGS A;  3R93 A;  4C3J H;  1JB7 A;  1DGS A;  1BOS A;  2O2L D;  3K6O A;  3MYB A;  2CWA A;  2L4N A;  1AP0 A;  3TN2 A;  3CCE A;  4DNT B;  2UXD Q;  1U0L A;  4A3B H;  4A4I A;  5ELE A;  2WFW A;  2XWJ B;  2JYO A;  2EXZ A;  3KFU A;  1P8L A;  3DEO A;  1Q82 C;  2R7D A;  1DXM A;  2NB0 A;  1VQ9 A;  2PNH A;  5IGD A;  2ASB A;  2PMZ E;  1EZ6 A;  2R93 H;  3Q24 A;  3PO2 B;  3I55 A;  3SE0 A;  1QNU A;  5CV8 A;  3G7L A;  4EX5 A;  5IYB G;  4BY7 H;  3K5O A;  1TWC H;  2NBF A;  1A15 A;  4NXN Q;  1D8L A;  1B2T A;  1T9H A;  2EJF C;  3CPF A;  5A35 A;  4Y7N H;  3EN2 A;  1L1O B;  4DUZ L;  1PTO H;  4R4T A;  3BG3 A;  4ME3 A;  2C9O A;  1Y1V H;  2K32 A;  3J81 c;  3VYT A;  2CWP A;  4XQN A;  2A68 C;  1SFO B;  1JE4 A;  1KIX A;  1WZ8 A;  4C3H G;  5DM6 3;  3AFQ A;  4BXX H;  3S2D B;  2NUC A;  4HSP A;  3KF6 B;  1NY4 A;  1TY0 A;  4JW0 A;  4JI4 Q;  4ELW A;  4DUY L;  4N9P A;  3VR6 A;  4LFA Q;  4ELS A;  3HOV G;  5ELB A;  5IGF A;  2JA8 H;  1XNR Q;  2UUA L;  2F0M A;  1STY A;  1Y1W H;  1YNN D;  1PH2 A;  2A8V A;  1CUK A;  4NDX A;  1Y69 U;  4RGN A;  1PH4 A;  4H0L C;  1GOZ A;  4V19 0;  3I4N G;  1CQV A;  1SE3 A;  1CKN A;  4RHR A;  3J81 E;  1DOL A;  3ICE A;  2ENB A;  4CJ1 B;  4ILW A;  3T56 B;  1PYS B;  1M1K C;  5CV9 A;  1M8A A;  3QK8 A;  2M9V A;  3RR5 A;  1Q52 A;  4IOA A;  1YBY A;  1I3Q H;  1J6Q A;  1HH2 P;  4X3K A;  2K28 A;  4HJ8 A;  3HZX A;  1SXT A;  1BXT A;  3GTP H;  2V1C C;  2A6H C;  2VQF Q;  1PRT D;  4WJ4 A;  3R9S A;  4DXF A;  4A3G G;  1SYC A;  4XT3 B;  1PHJ A;  2CKZ B;  4K5W A;  3VYR A;  2QF7 A;  1F9P A;  1V1P B;  3AFP A;  3KUP A;  4YCW A;  5IOD A;  2JA5 H;  2RQX A;  2ZXO A;  1XPU A;  1XMO L;  2L12 A;  4OGQ C;  4JI3 Q;  3TP8 A;  4NNQ A;  1H9K A;  4HSV A;  2CQO A;  3FVQ A;  1XWE A;  3L8I A;  1RTO A;  3A54 A;  3NEL A;  3GO5 A;  1PFB A;  4R8N A;  2F4V L;  3TSS A;  3ND9 A;  3QOJ A;  4GN4 B;  1N33 Q;  3AMU A;  4ALP A;  2GVB A;  1EQV A;  2Z9H A;  1VMC A;  5EKL A;  5C3W A;  1WYD A;  1MHW C;  1LYL A;  1BVS A;  4A3J H;  3J81 j;  2ID0 A;  2XN9 C;  4RCN A;  3GTK B;  3D6W A;  1JQY D;  4JBM A;  4A3E B;  3VYS A;  1BR9 A;  4JYA Q;  2B2Y A;  4QUF A;  3DUZ A;  1PYW D;  3M4Q A;  2FMM A;  3HOX G;  3SHL A;  1ML0 D;  4XYO A;  3OTO Q;  4I7A A;  3Q0J A;  3CCR A;  1U4P A;  1VQA A;  4A3K G;  2B8F A;  2RVL A;  1HPC A;  2YTX A;  3NUC A;  1W3S A;  2F0H A;  4OWX B;  2ZTD A;  2Z1C A;  3M4Y A;  3NTI A;  4P75 A;  3MXU A;  4H02 A;  3PUY A;  3PUX A;  4BBR G;  1B9N A;  4L63 B;  1V1Q A;  3SK6 A;  5HGQ A;  1K9M C;  5IGB A;  3RN2 A;  4IFD G;  2JJQ A;  3FRP B;  2PI2 E;  2NVT H;  3WWV A;  3IRB A;  2HCC A;  1KNA A;  4B9X A;  4DV6 L;  1HJP A;  1X3F A;  3CAM A;  1BBU A;  2OTL A;  1NNX A;  4I4Z A;  4P74 A;  2WAQ B;  4NB3 A;  3S17 H;  1PVO A;  3KK7 A;  4BBS H;  1B8A A;  5DAU A;  5JBW A;  1F77 A;  2PCF B;  3HOU B;  3ERS X;  2ICE C;  4DV1 L;  2A1A A;  1RHP A;  3K58 A;  1B70 B;  3S2H B;  4K5V A;  1XPO A;  3CKI B;  1K83 B;  5CBA E;  4LFC L;  3DWA A;  4OIK A;  1NMF A;  4OON A;  2PZU A;  4AYB E;  1JOK A;  4WOR A;  4OWW B;  3V96 A;  2WB1 G;  4TSS A;  1E7Z A;  1TT2 A;  2R61 A;  2KED A;  4PNY A;  3SDZ A;  3D4D A;  1SFO H;  1TWA B;  3CRL C;  4Q0F A;  3ULJ A;  4KTA A;  1XTC D;  2Q2U A;  1YHA A;  1QB5 D;  3OW2 A;  5LMN W;  3HOZ H;  4EQP A;  3HOW B;  1K73 C;  3I91 A;  3I56 A;  2EYM A;  1CKN B;  4KK7 A;  4OIJ A;  3CCQ A;  2ZTC A;  4IPH A;  4IPC A;  3H3V H;  3X3M A;  2L1B A;  3D8G A;  3Q0A A;  3UE0 A;  1PFN A;  4CJ2 C;  3STB C;  4JPB W;  1DON A;  3BS1 A;  2EYO A;  3PMF A;  1VQM A;  1DCZ A;  4K2L A;  1FGB D;  5M5Y H;  1NZY B;  4CKE A;  2KCN A;  2R7Z H;  1K28 A;  4DV7 Q;  1OXU A;  4OEL B;  1UEA B;  4B3S Q;  3G71 A;  1IBK Q;  1VCI A;  5C9G A;  1D5M C;  1Q51 A;  1J5E Q;  4MZ9 A;  3JC6 6;  4OO1 H;  1NZY A;  3N52 A;  4BA2 I;  2B63 G;  3OC7 A;  2E8G A;  2X6L A;  3FP9 A;  4LF6 Q;  3M7G A;  1SRO A;  1Q7Y C;  3LWU A;  4HMJ A;  1UUP A;  3MZ5 A;  4K8J A;  1WOC A;  3PF5 A;  1N32 L;  2OF1 A;  4ZUJ A;  3CXC A;  4X6A H;  4KJO A;  4QIJ A;  1GM5 A;  1SNQ A;  4BY1 G;  2R3Z A;  1FGU A;  2N3S A;  1GKH A;  1C48 A;  5M5W B;  1SJH D;  1PH3 A;  2PMZ B;  4LUZ A;  4LAA A;  1NCV A;  5GAH C;  4DV1 Q;  1YZ6 A;  2IY5 B;  4N9T A;  1UX5 A;  4IZ8 A;  5JEA G;  1XNQ L;  4A3L G;  1EY0 A;  1I6H B;  1B3Q A;  1DJR D;  2PYK A;  1PTO C;  3RD4 A;  3PSI A;  2D0O A;  1HCZ A;  1O7Y A;  3UDI A;  3PO2 H;  4P71 A;  4IAL A;  2Z6K A;  3S1N H;  1A63 A;  1TWH H;  4IUN A;  5FKA C;  4HCS A;  3VR5 A;  2RSN A;  1CZG A;  1ZYR C;  3ONA B;  5C44 H;  2OCE A;  3U50 C;  1GHJ A;  2A5H A;  1SNC A;  5I2Y A;  4PMB A;  5IP7 G;  1M4V A;  3EA6 A;  5BN5 A;  5LL6 X;  4A3D H;  1DZ1 A;  1ZXT A;  5KRU A;  1DOM A;  5FO7 B;  2EOT A;  1N34 L;  4BY7 G;  2OTJ A;  2NVY B;  1EEI D;  3T16 A;  1BNZ A;  3SVM A;  4QGU A;  5EJW A;  3JAM i;  1IXR A;  5CV6 A;  5EBD A;  2L55 A;  1Y14 B;  1EIF A;  3WDN A;  1X3G A;  1PLF A;  1Y1V G;  2LKV A;  5CMD A;  4GNX A;  1MJE A;  2K5N A;  2HDL A;  1Y64 B;  1EF8 A;  1GUO A;  3RUZ A;  2E2J B;  1PYB A;  5M3M B;  5IYC G;  3A0J A;  1HZA A;  4DR2 L;  1YJ9 A;  4GKJ L;  1K83 H;  1TS2 A;  5FJ8 G;  3PIP 3;  3K57 A;  1YJN A;  4OLQ A;  1YEZ A;  4ZRZ A;  1I4R A;  3G6J B;  4YCU A;  4JFC A;  4FDB A;  5I9O A;  4DK0 A;  3MTS A;  3H3V I;  2F0D A;  2ZJQ A;  1CA5 A;  2JEB I;  5AFW A;  2IWH A;  1TWC B;  2ZQQ A;  3C3L A;  3FEW X;  3J80 i;  2K7V A;  2F4V Q;  2NTT A;  3H81 A;  3TZD A;  4AYB B;  4KN4 C;  3BZD B;  1ENC A;  3LWE A;  4HJ9 A;  3ND8 A;  5GAE C;  4GNX C;  3SXH A;  4C3I H;  5C5L A;  3U4Z A;  3S17 B;  3ERO A;  2YU9 H;  1ET6 A;  5IWA L;  4YHH Q;  2DGY A;  4GLX A;  5EAY A;  3DLL A;  2EJM A;  1B53 A;  2N88 A;  1HUN A;  2NWG A;  2MHV A;  2RCF A;  2AQ2 B;  3HOU H;  3FKI G;  4O0A A;  2AHO B;  2KVM A;  4MOU A;  3LX0 A;  3A4N A;  2RDH A;  4IUP A;  3H09 A;  2VNU D;  2FBM A;  1EQR A;  4YWM A;  1KRT A;  3SGI A;  2IX1 A;  1U4R A;  3QXI A;  4A3G H;  3NTK A;  1UWV A;  4IFD I;  5KIX A;  2JA6 B;  3PF4 A;  4OX9 L;  1PRT F;  1EYA A;  1RJT A;  4JI7 Q;  2OWO A;  2MNA A;  3RSI A;  4QCL A;  1X55 A;  1PH1 A;  3I72 A;  3FPP A;  1ZYR D;  2OQK A;  3NWS A;  2QKI C;  4A75 A;  1FNU A;  1JWS D;  1D2B A;  2EY2 A;  2N55 A;  1PMR A;  5ELF A;  3VDY A;  2LFN A;  3GP7 A;  3ZYY X;  3P20 A;  2BDN A;  1KAW A;  4ZKB B;  1F2L A;  1NR4 A;  3KF8 B;  2NVQ H;  1H9J A;  2WKC A;  1EIG A;  4KKT A;  1XPR A;  1H9S B;  2ZTE A;  3J7Z C;  3ADC A;  3HKZ B;  1OXX K;  5CGK A;  5I4D A;  2Z8L A;  4JV5 Q;  1E0B A;  1PH7 A;  1JJC B;  4LK1 C;  5J22 A;  1B7Y B;  4IPD A;  5C44 B;  2EYJ A;  1WTQ A;  1PZK D;  2PO4 A;  1KAB A;  1SNP A;  1EFI D;  5E4W C;  2IL8 A;  2K05 A;  3HP3 A;  3BDL A;  1LO5 D;  2JN4 A;  1JOR A;  1FR3 A;  3BVG A;  3RNU A;  2L5T A;  4PZ7 A;  3U58 A;  4FXD A;  1YNN C;  3TME A;  1TQO A;  5HY6 A;  3TRZ A;  1SLJ A;  2CFM A;  5G3L D;  4OHJ A;  5IGG A;  1HR0 W;  3KF6 A;  4X66 Q;  1EWC A;  3L3O C;  5C3E B;  4IUR A;  1X56 A;  2AQ1 B;  4J15 A;  4EQ5 A;  2E2I B;  5IYD H;  1ESF A;  3NQT A;  1E3P A;  2E2J H;  1ICF B;  3GTG B;  1WTP A;  3R0O A;  1PTO F;  4DV4 Q;  2BH2 A;  4GZY C;  2CVR A;  2A69 C;  1RD9 D;  1ILQ A;  4JOI C;  2M00 A;  2F0N A;  2RF4 A;  2C35 B;  4X66 L;  4X62 Q;  3I73 A;  4JI7 L;  3SEB A;  4BBS G;  4RKB A;  1F2Z A;  1ASY A;  3G48 A;  3H0G H;  4G57 A;  2XNA C;  4A3M H;  1XXG A;  2JA8 B;  4DV6 Q;  5DLQ E;  4JI5 L;  5C3X A;  5CBE E;  4JOT A;  3DXJ C;  1SJE D;  1N9W A;  1HRJ A;  2HHH L;  4ODG A;  1JJG A;  1JCK B;  1VQD A;  1QIL A;  3VR4 A;  3PIO 3;  1K0S A;  3T1Y Q;  4WJ3 M;  1LUZ A;  5JVH 3;  1WCM H;  4FP5 D;  2RDG A;  3W1B A;  3CC7 A;  5JPM C;  4RMF A;  2X69 A;  3TRE A;  2VW9 A;  1CFM A;  1RIP A;  3HEJ A;  1EEF D;  1XMO Q;  3FPU B;  3DHQ A;  3KQF A;  1CZW A;  1FL0 A;  1XTD A;  2R92 G;  2HIX A;  2B2W A;  1V8Q A;  2JA7 H;  2F0G A;  1U9R A;  1FNV A;  5M5W H;  5KNB A;  4ZAI A;  1D1I A;  2VY3 A;  3M3Y B;  4X65 L;  1ENF A;  1RJM A;  1C4Q A;  5D3I B;  4JI6 Q;  3S14 B;  1EYG A;  1EOV A;  2PNR C;  1VQ5 A;  4E6I A;  1SE8 A;  3K5M A;  5E7N A;  4Y7N B;  3OIP A;  1EFW A;  3CQZ B;  1X6O A;  1U5K A;  2R7Z G;  1VS0 A;  4GKK Q;  5J39 A;  3ADB A;  1Y8N B;  3TP7 A;  4DR6 L;  4JVZ A;  4DV5 Q;  2YYZ A;  2A19 A;  3J7A 5;  4C3I B;  1CHQ D;  4LF9 L;  1GUW A;  1Z47 A;  2ZJR A;  2B2T C;  4NXM Q;  4O42 A;  2A6E D;  3M4O B;  1XNR L;  4LFB L;  3OTO L;  4A3D B;  4C56 C;  2QDL A;  4ID6 A;  2B2W C;  4A3B B;  1MI2 A;  3UDX A;  1R4P B;  3D3R A;  3G6E A;  3HOZ B;  4DV3 Q;  2JK8 A;  4LJZ C;  2VB2 X;  2B2U A;  1K8O A;  2E75 C;  2O5J C;  5C4X G;  2QDB A;  5IYB H;  4JYL A;  3FHW A;  1WJJ A;  1W6K A;  1C8C A;  2UXC L;  4KY6 A;  1GUN A;  1CKO A;  3AU7 A;  5JOB A;  4AIM A;  4A3L H;  4A3C G;  2FFK B;  5D14 A;  3K5N A;  4L8J A;  2EY5 A;  1EWI A;  4UP7 A;  3PO2 G;  2P63 A;  3O4X E;  3W3A A;  2WAC A;  3RMH A;  3AJM A;  2X6G A;  1UE6 A;  5LMN Q;  4KV6 A;  2NN6 I;  3JAM E;  4F7X A;  4QF4 A;  4GS3 A;  3I4M H;  3QR8 A;  4KHP L;  1H9R A;  3DM1 A;  3SK4 A;  2VX2 A;  2EIF A;  5FLM H;  5IP7 H;  1K8G A;  2Q2H A;  2P5Z X;  1V1O A;  3C1F A;  3L9A X;  4CDE C;  3CME A;  3TP5 A;  1SE2 A;  3IFD A;  2IX0 A;  2E5L L;  4LFC Q;  1MJ3 A;  1SDF A;  4R1J A;  3PV0 A;  1LLR D;  1BCP C;  5EQ0 A;  1BO0 A;  1XMQ L;  3K59 A;  1X3E A;  2R7F A;  1BUV T;  4IUQ A;  3T13 A;  1LTB D;  3A5U A;  4V0B A;  4U19 A;  2EYF A;  5ELD A;  1VQN A;  3T89 A;  2WAQ E;  4B3T Q;  1Q1B A;  1WTR A;  5JJK A;  3PCO B;  3V05 A;  2RKS A;  4QUC A;  3EJI A;  1SMY D;  4RGO S;  1AN8 A;  2RBM A;  1QUQ B;  2L15 A;  3HOW G;  2PBP A;  2RCN A;  2NZO A;  3R2I A;  2K52 A;  4ZCK A;  2KHI A;  5M3F B;  2F0K A;  1LM0 A;  4Q5V A;  4P2C B;  2CQA A;  2G5D A;  1N34 Q;  2PQA B;  1Y1W B;  2KA7 A;  5K36 G;  4RGT A;  2JA9 A;  1TY2 A;  1LT6 D;  1AE3 A;  2JA5 G;  3S9W A;  2MFI A;  2K5H A;  5KNC A;  4S3S A;  1JWM D;  1N8R C;  4JBW A;  4OEM B;  2K50 A;  2HW5 A;  4XDX A;  2KUM A;  1JB3 A;  5KGU A;  4QL5 A;  2GTR A;  1YJW A;  1LTL A;  1EF9 A;  1GUT A;  1UX4 A;  5IT9 E;  1A62 A;  1AZP A;  1LTI D;  2HT1 A;  2HQL A;  1EU4 A;  4XIG S;  4A3F B;  3KLR A;  4A3J G;  1BQQ T;  3BU2 A;  3P7J A;  2F0Q A;  4OO1 I;  4NXN L;  4EGV A;  5EKI A;  3KOJ A;  3UI2 A;  2F1M A;  3AQQ A;  3Q0G A;  2E76 C;  4DR6 Q;  4B3S L;  2IT1 A;  2CH4 A;  1I6H H;  1HZ9 A;  2J4X A;  3GDE A;  2XRQ D;  1I4Q A;  4JI1 L;  5ELO A;  1D5Z C;  1PRT B;  2F0L A;  1IHZ A;  5AJ3 L;  1CT1 D;  2XIW A;  4K2N A;  2ZT9 C;  1DUB A;  2AUK A;  2FJ2 A;  4HJ5 A;  1KC8 C;  4C3J B;  3GTL H;  5IT9 c;  4AQY L;  4FF4 A;  4IOC A;  3M7N A;  2H4O A;  5C3E H;  4A3E G;  5BN4 A;  1EY5 A;  2TSS A;  2I46 A;  4IN3 A;  4YWK A;  4X3T A;  3CP0 A;  1E1T A;  1A3V A;  3ITP A;  1A0I A;  3V2T A;  1FVI A;  3KF8 A;  4BBR H;  4YY3 Q;  2Z4I A;  1JXZ A;  1O7L A;  2N78 A;  1FJG L;  1TU2 B;  4G7O C;  4PMW A;  4HJA A;  1G6Z A;  3MC0 B;  3RQE A;  4A3K B;  3T8A A;  3F2U A;  2EQS A;  3MXP A;  1VQI A;  4MTN A;  3P5M A;  1UE1 A;  3VR3 A;  1IBM L;  3GTM H;  1MJC A;  1K0R A;  4JK1 C;  4OL7 A;  5IP9 G;  4ME5 A;  1D1K A;  1ESR A;  1KLU D;  2IX3 A;  2Q8T A;  4I42 A;  1Y1V B;  1Q3L A;  2IPK D;  1F9Q A;  2UXB Q;  2RHS B;  2V4D A;  3W2D A;  4F8M A;  2PW7 A;  2RA4 A;  1OTC A;  1LTA D;  1VQF A;  2DNE A;  2N49 A;  2ICI A;  3F2D A;  2F03 A;  1Y8O B;  1VQ6 A;  4DR7 L;  3TBI B;  4RG1 A;  1RJN A;  4HJ7 A;  3A56 A;  4KNP A;  3RZD H;  2JEA I;  3TEH B;  1CM9 A;  1C7Y A;  1KRS A;  3EIV A;  1EWH A;  2F0F A;  2DUB A;  1WTX A;  5J1Z A;  4C3H B;  3U4V A;  1TXY A;  2KCT A;  3K8A A;  4K14 A;  3S14 H;  4EML A;  2I5H A;  4BWG B;  3T1Y L;  1LT5 D;  4X3S A;  5C0X J;  4RWS C;  3H0G G;  3NQI A;  1QZH A;  4A3M G;  3CD6 A;  3J7Y W;  1SEB D;  1HFG A;  1KLG D;  5EGT A;  4DUZ Q;  4R9W A;  4K0K Q;  2M2L A;  3HOY G;  2LY7 A;  2F0U A;  1R9T H;  4DR5 Q;  1VQL A;  2I0Q A;  5NUC A;  1EQT A;  3S2H H;  3T88 A;  4LMQ D;  1DD2 A;  1BCP F;  1G8Z D;  1F2Y A;  1BKB A;  4KMU C;  4RGM A;  5LHY 1;  2D5D A;  1IBL Q;  1S40 A;  4LF5 L;  4G7H C;  1XJV A;  5LMU L;  4KD3 A;  4OO1 G;  1M90 C;  2ALY B;  2R92 H;  3OPO A;  2JA7 G;  2EDG A;  3F2C A;  3J81 L;  4FYD A;  3FDU A;  2MPM A;  4JI2 Q;  3AEV A;  1V9P A;  2FW2 A;  3KLS X;  3GQB A;  3U9O A;  1HTP A;  2NVQ B;  3W8I B;  4AH6 A;  2QEJ C;  1WTV A;  3NXW A;  4KHV A;  5COY A;  1EY9 A;  2MO0 A;  1I4G A;  3QO2 A;  3TP6 A;  2VS1 A;  2AMC B;  1A2U A;  4QII A;  4GEH B;  2EYL A;  3MXN B;  5FK9 C;  4JI5 Q;  4R4O A;  3VYU A;  2B63 B;  1EY8 A;  5JEA J;  4HCE A;  5JEA H;  4R4I A;  2Z4H A;  2KQ3 A;  3I2Z A;  4DV3 L;  2PPB C;  4IJH A;  3GTL B;  3P75 A;  3OHX C;  4A93 G;  2UU9 Q;  3A8I E;  5AJ3 Q;  2KOL A;  3I4L A;  1UAP A;  4JI0 Q;  4BY1 B;  3HOV B;  2F3V A;  2XSC A;  4ZK9 B;  3AM1 A;  1A2T A;  5C44 G;  2WIN B;  3MFY A;  3DMU A;  3P1H A;  3QB3 A;  1K8A C;  4I52 A;  1KAA A;  3C1E A;  3H6M A;  1TR5 A;  3KDF A;  1G29 1;  3K80 C;  1VF7 A;  3OWF A;  1YIT A;  1HNZ L;  1JC7 A;  3T51 B;  4OWT B;  3HKZ E;  2OXP A;  2JQO A;  2ZXR A;  1F2M A;  2XGT A;  3ULL A;  3WOE A;  1HR0 Q;  2YTV A;  1KDC A;  2D2C C;  1QG7 A;  4KI0 A;  1O7I A;  3EVQ A;  1YNX A;  4PG3 A;  3NBI A;  1WTH A;  4IUT A;  1BBX C;  4MNO A;  4IO9 A;  2PQE A;  3IAY A;  3BVZ A;  1PH5 A;  3MWY W;  2XWB B;  2KJX A;  3GTO B;  1JWU D;  4HIM A;  5IYC H;  2ZM6 Q;  3I4M G;  2NVX B;  1VQ4 A;  2FMC A;  5FJ8 H;  1HNW Q;  2DN8 A;  3O13 A;  4KY7 A;  4LFB Q;  4RHS A;  1L1O A;  2K5D A;  4BBS B;  3BVM A;  5C4J B;  1A8V A;  4UAI A;  1NBW A;  1D6E C;  2AWO A;  1LT3 D;  2VB3 X;  2O5I C;  3TRR A;  3CPW A;  1S72 A;  3GTO H;  3A7L A;  4JI3 L;  1B50 A;  2DJG C;  3S1Q B;  4POF A;  3HG9 A;  2BH8 A;  3I8Z A;  2K5V A;  3HKS A;  2BA0 A;  4TRD A;  5GQO A;  3GTP B;  5FOB B;  1ZKO A;  2EJG C;  1CTM A;  5L37 A;  2WP8 J;  4DR3 L;  3GD7 A;  5C4J H;  1IYU A;  1OXV A;  4RA8 A;  3TDQ A;  1Q12 A;  4U67 3;  3HOU G;  3HOW H;  4DR1 L;  2R92 B;  2K5W A;  2QCP X;  5D3D A;  2EE1 A;  3BDC A;  3KLW A;  1TWA H;  5A2Q E;  1PTO B;  5C0X I;  1VQO A;  4LFA L;  3JAM c;  4LF4 Q;  1PFM A;  3CCJ A;  2SDF A;  1W2B A;  3HOX B;  1I3Q B;  4B08 A;  4GOP A;  5G3L F;  3I4N B;  4AQY Q;  3K81 C;  3D0F A;  2JA6 H;  3KBG A;  1SYE A;  5EBC A;  4DKA C;  4FVM A;  3RQG A;  3SK5 A;  1S4Z A;  3GV6 A;  2PZW A;  4N8X 1;  4DR7 Q;  1ICW A;  3M9B A;  2YU9 B;  4C1N I;  4IUV A;  1B1Z A;  1EY4 A;  5F2D A;  1QVG A;  4MHE A;  3I7F A;  1HNW L;  2MUY A;  4FXK C;  2NVY H;  3GTQ B;  4RFB A;  1X54 A;  1CA6 A;  1GXD C;  2XVS A;  4B9W A;  4XT1 B;  2E2H H;  1STA A;  1PFS A;  1VQJ A;  1YHQ A;  2DJF C;  3NEM A;  4LF9 Q;  1IW7 D;  2LXJ A;  1KXL A;  4DNR B;  3MA2 B;  1L0Y B;  4DPG A;  1E24 A;  4RCO A;  2LXK A;  3G64 A;  3Q1T A;  4KHP Q;  5JJL A;  1B44 D;  5FO8 B;  1KTK A;  3SR1 A;  1HZB A;  4DAV A;  4A3E H;  3NSW A;  1PZJ D;  1R4Q B;  4CDC C;  1EZ8 A;  4KN7 C;  2K1B A;  2HIV A;  4GKK L;  2BE5 D;  3ER0 A;  1Z9F A;  1AEX A;  3L0O A;  2Z6B A;  5CV7 A;  3GTM B;  1QCB D;  3ADD A;  2I5M X;  2UUA Q;  1MBY A;  4DV2 Q;  4DK3 C;  1E22 A;  4HID A;  4J6H A;  2WV6 D;  3B6Y A;  1HNX L;  4JOI A;  3T53 B;  1Q8K A;  3PUV A;  3I4O A;  3OMC A;  2UUC L;  1J5E L;  3MEF A;  3DEP A;  3E9I A;  1RDP D;  2JSO A;  3I90 A;  5IP9 H;  1I50 B;  5ELN A;  4X64 Q;  3S16 H;  3S24 A;  2E2I H;  4APV A;  4A3I B;  3G4S A;  4K3W A;  2I5L X;  1XYI A;  1Q46 A;  1K3R A;  4F88 A;  4GOP C;  1NJI C;  3CRK C;  1SNM A;  1EYC A;  1PXU A;  4BY7 B;  1MIU A;  3RLO A;  2GN5 A;  2PW5 A;  5IGE A;  4L6T B;  2PZT A;  4CDF C;  5M3F H;  1D7Q A;  1YI2 A;  1XNQ Q;  2MGS A;  1L1O C;  4A3I H;  4H44 C;  2HQE A;  4QJF A;  2A68 D;  2N8N A;  4BBR B;  1AFP A;  1PZI D;  1JR0 D;  4M8A A;  4LF6 L;  4A76 A;  3HGB A;  1E2V A;  1GUS A;  1HUM A;  1I94 L;  2PQA A;  3AYH B;  1WCM B;  3CCV A;  3ULP A;  1FYC A;  1Z7T A;  5M3M G;  1IYV A;  1STG A;  5C0X G;  3K0X A;  4XXE A;  4NEK A;  4IZC A;  1NSN S;  3I3C A;  1CK1 A;  1JMC A;  3J80 L;  4CDD C;  1V43 A;  1IZ6 A;  1N33 L;  1VMP A;  4DU9 A;  5H1S E;  2K04 A;  3PO3 G;  3QG1 A;  1RL2 A;  4DV0 L;  2O4X A;  2CHB D;  3E3X A;  4YCV A;  2UU9 L;  3HOY H;  5IGC A;  3NEN A;  1SR3 A;  4JI8 L;  3E0E A;  1C9O A;  1SYF A;  1ASZ A;  3BDO A;  4Y52 H;  4B3T L;  4A3F G;  1II3 A;  3E9H A;  4DR4 L;  2CW0 D;  2YV5 A;  4A3J B;  4DV0 Q;  4XTC S;  5IWA Q;  4YHH L;  5C5M A;  2Y0S G;  1O80 A;  2SNS A;  1N36 L;  2E2H B;  2L9H A;  1LTG D;  5JJZ A;  3OOC A;  3CC2 A;  2F0I A;  4B3R L;  3J7A F;  2D0P A;  1DCI A;  3LNN A;  4OXP A;  5HUR A;  2NN6 H;  4NP5 A;  5DM7 3;  2KCM A;  4JWV A;  3W1G A;  3SK8 A;  3QOL A;  5C4X H;  4C3J G;  3KLS A;  1LTS D;  1U4L A;  3PIO A;  3H3V C;  5BN3 A;  4GN3 B;  1EUJ A;  5E3F A;  4JI0 L;  4MI2 A;  2DNC A;  4IJL A;  5I6W A;  4A3C H;  3F1Z A;  1QUQ A;  3OIQ A;  4YWL A;  4A3B G;  4K6L A;  2GVA A;  1Q8I A;  1JIC A;  4A93 H;  4I65 A;  1ONL A;  2HCI A;  4UDU C;  3A8K E;  2WAQ G;  3X3N A;  1VQG A;  1NUC A;  5I2X A;  3UDF A;  3J80 c;  5C4X B;  4L5R C;  4DR1 Q;  2NVT B;  2TMP A;  2R93 G;  1QNK A;  2BCO A;  4NPS A;  4ZU2 A;  5FLM G;  2QW7 A;  4RAU C;  3RZO H;  1IL8 A;  1VQ7 A;  1GD7 A;  1UNS A;  4HAE A;  1CQF A;  3A74 A;  3QXZ A;  1GJX A;  3T1H L;  3FDT A;  3Q22 A;  1MSH A;  3QIA A;  1YIJ A;  5CC4 A;  3H94 A;  2DY8 A;  2OQ0 A;  3TLF A;  2EJ5 A;  4JC0 A;  2VUM B;  4P72 A;  4DV4 L;  5J3B A;  2WB1 B;  1HFN A;  3URY A;  3CCS A;  2BOS A;  3RZO B;  1L2F A;  2ZJP A;  3NBH B;  2YTY A;  1KNE A;  3I70 A;  1CSP A;  4QY7 A;  4QMG A;  4LF4 L;  1BBW A;  2K01 A;  1I4X A;  3S1M B;  4EVO A;  3HOV H;  4NW2 A;  4LF8 Q;  1FJG Q;  3DM3 A;  2EXD A;  4F47 A;  1TS3 A;  4WRD A;  4U68 A;  3BYT B;  4P73 A;  1RF2 D;  2B2V C;  1SNO A;  3D6C A;  2GA4 B;  4DF7 A;  1GHK A;  4LW1 A;  1TII D;  3QWN A;  3R9T A;  1KDB A;  2NZ1 D;  2JE6 I;  4I7Z C;  1QVC A;  4LF8 L;  3BJU A;  1Q90 A;  3K0Y A;  3NP8 A;  4ULL A;  5K36 H;  2IW3 A;  1QZG A;  5KJP A;  2MP1 A;  3HOY B;  2IEX A;  3IL8 A;  4ZYS A;  4C2M B;  3E5S A;  1VF5 C;  4M1U B;  4JBK A;  3RQF A;  2IHE A;  2WB1 E;  1EQQ A;  2RHQ B;  5GAD C;  3NE5 B;  2F0E A;  4QQB X;  1B3A A;  2K4K A;  1KHI A;  3HKZ G;  2LSS A;  3S1R H;  4JCV E;  1LAB A;  3BYY B;  1YNJ C;  3CU7 A;  4K5X A;  3TZU A;  1LV9 A;  4DUY Q;  1JOO A;  1SN8 A;  4GNX B;  1UEB A;  4HED A;  4JCS A;  4DNI A;  2B2V A;  4GLA C;  3KJO A;  1CKM A;  1OXS C;  1MKH A;  1IBL L;  5ELC A;  4EQN A;  3CQZ H;  3NK9 A;  4GOP B;  4FNF A;  2E74 C;  2EYH A;  2F0T A;  2PPY A;  5CYU A;  4DFA A;  1ILP A;  3VA5 A;  1W6J A;  3UE1 A;  3MVV A;  1JOQ A;  1PRT C;  2KCC A;  2D9U A;  3D31 A;  4KKU A;  4B3M L;  1E2Z A;  3W8H B;  3Q8D A;  4LWC A;  5FLX L;  4DR2 Q;  1EY6 A;  1WFQ A;  4X65 Q;  1WVL A;  1IKL A;  1KDA A;  3OSO A;  5C3E G;  4DR3 Q;  3MOY A;  1NR2 A;  2EY6 A;  2Z0S A;  5CR3 A;  3HFZ B;  1SYB A;  3A4M A;  5GRO A;  1E1O A;  1VQH A;  1B9M A;  4LNQ A;  3A55 A;  3NHH A;  1EY7 A;  3OYY A;  5C4Z A;  5FLX c;  1G91 A;  3MXG A;  2F3I A;  3PUW A;  4FF1 A;  1WD1 A;  3IFT A;  1G51 A;  3HOX H;  1I6V C;  1QJO A;  1RKN A;  4J8Q A;  4JI2 L;  4PZ8 A;  5JAV A;  1PH8 A;  3ERQ A;  2FIN B;  2VUM H;  2C5C A;  5CV5 A;  4TQU S;  5HGT A;  1K8M A;  4NMZ A;  4R8I A;  4JI4 L;  2L11 A;  1ENA A;  1HQR D;  1SMY C;  4F87 A;  1HNZ Q;  4R4Q A;  4DN4 M;  3SWX A;  3L8J A;  1X9N A;  2LMC B;  4DK1 A;  1Q86 C;  4DV5 L;  4KHZ A;  1IL2 A;  2NTS A;  1H95 A;  5FLX E;  3I47 A;  4FZW C;  4X3U A;  1EIY B;  2K75 A;  2UXB L;  5EPJ A;  2F52 A;  2J7Z A;  3VA7 A;  2AKW B;  3GTJ B;  3J7A V;  1NAP A;  1KQS A;  1S5B D;  3L2P A;  2K6A A;  1GVP A;  4YIJ A;  3S1M H;  4K6D A;  1TKW B;  1S5C D;  5LL6 S;  2I07 B;  1WTO A;  1STN A;  5C6A A;  3MFG A;  1Y8P B;  1Z6H A;  2B2T A;  1I5F A;  2F3W A;  2RSO A;  4KLK A;  4XQQ A;  2VQE L;  2EZV A;  1EU3 A;  4H13 C;  1G2S A;  5CV4 A;  4TKO B;  4KKS A;  1STE A;  3F8T A;  5EPK A;  2DUD A;  1HXY D;  4FJW D;  5JBX A;  1GUG A;  1ET9 A;  4KJN A;  5T1I A;  2QQ3 A;  1TWF B;  3HOZ G;  3U9S A;  3J81 i;  2B3G A;  2NZH A;  2ZM6 L;  1PH6 A;  1VQE A;  1SE4 A;  2KBN A;  5EKK A;  1DYQ A;  1AZQ A;  2K03 A;  3F2B A;  4X64 L;  4JI8 Q;  4DGZ A;  2E5L Q;  4UY8 C;  4PV1 C;  4X62 L;  4A3G B;  3D4W A;  2AWN A;  3PO3 H;  5M5X H;  1UIY A;  2K14 A;  5LMU Q;  1WI5 A;  4CJ0 B;  2QA4 A;  1LTT D;  3CCM A;  1N36 Q;  1OXT A;  3A5Z B;  3NWT A;  3NBH A;  4MIU A;  5TSS A;  2F0P A;  3CMA A;  2FXQ A;  4POG A;  2JA5 B;  3M4P A;  4TVA B;  1VQK A;  1FNW A;  1LT4 D;  2AUJ D;  3LGJ A;  5DEH A;  3KJP A;  2Q2I A;  3K7A B;  1TS4 A;  1VQ8 A;  4OG1 A;  1NTG A;  2R6G A;  4IQZ A;  4DAY B;  1V1P A;  4L5Q A;  4DXG A;  4IZB A;  4LUV A;  2CH4 W;  2H1E A;  2XTI A;  2DY7 A;  1I4P A;  1SYD A;  4LF7 Q;  1MSG A;  5IOC A;  5IIF A;  3S15 H;  4LUO A;  4UP8 A;  3H91 A;  4BY1 H;  1HZD A;  1FD7 D;  1P16 A;  2G9H D;  2KHJ A;  2NYZ D;  1MD2 D;  1X65 A;  1S5E D;  2SOB A;  4NKL A;  3GTK H;  3S1Q H;  1B4O A;  4MN3 A;  2HHH Q;  4A93 B;  4C1N K;  2L0C A;  3M4O H;  2MQH A;  4PQX A;  2A6E C;  1PV4 A;  2RDF A;  2KEE A;  3NTH A;  4L5T A;  4DAY A;  2EYP A;  2KEC A;  5JVG 3;  4UPA A;  3DWP A;  1I50 H;  3S16 B;  3RN5 A;  4C3H H;  4BXX G;  5K5P A;  1SSO A;  2BDO A;  2HD3 A;  4IZD A;  3N6R A;  2Q2T A;  4J1M A;  4IFD J;  2EVB A;  1J9O A;  1I4H A;  1XMQ Q;  1HA5 A;  4A3D G;  1L0W A;  3H15 A;  2JA8 G;  2BE5 C;  4G4K A;  3PZK A;  3GTG H;  1Y1W G;  5FO9 B;  1N32 Q;  2SEB D;  3A8J E;  2VZA A;  4K0K L;  2A6H D;  3MHB A;  4L5S A;  3I4N H;  4WCZ A;  1VQB A;  1IBM Q;  1EL0 A;  3BZC A;  3CF5 A;  3I4M B;  2ATW A;  3CHB D;  3R8B A;  3A7A B;  4CKC A;  3PUZ A;  4GLV B;  5KYI A;  3MAQ A;  5DNF A;  1VQC A;  1LTR D;  3AB9 A; 
#chains in the Genus database with same CATH homology
 2WAQ E;  3STB D;  4BA1 I;  4B3T Q;  2Z6K C;  1Q1B A;  5M3F H;  1D7Q A;  1YI2 A;  4LFC L;  5JJK A;  1XNQ Q;  3BZK A;  1NMF A;  3PCO B;  1UE7 A;  4OON A;  1L1O C;  4R4C A;  4AYB G;  3CCU A;  4A3I H;  4AYB E;  4QJF A;  4OWW B;  2N8N A;  2QEX A;  2WB1 G;  4QIW E;  1E7Z A;  3GTQ H;  1QUQ B;  2L15 A;  1SFO H;  4LF6 L;  3HOW G;  4A76 A;  4GN5 A;  3ULJ A;  2RCN A;  2NZO A;  2K52 A;  2Q2U A;  1I94 L;  1YHA A;  2PQA A;  4DK6 C;  2KHI A;  3AYH B;  3OW2 A;  2NVX H;  5LMN W;  1LM0 A;  3CCV A;  4DV2 L;  5M3M G;  3KDF B;  3ULP A;  1K73 C;  3HOZ H;  5BR8 L;  5C0X G;  1AE2 A;  3I56 A;  3K0X A;  1CKN B;  3UDG A;  3PIP A;  3CCQ A;  1N34 Q;  2PQA B;  2ZTC A;  4IPH A;  4IPC A;  3H3V H;  4DR5 L;  1JMC A;  5K36 G;  5GAG C;  1S3O A;  2JA9 A;  1V43 A;  1IZ6 A;  1I94 Q;  3KYH C;  1N33 L;  1AE3 A;  2JA5 G;  1HR0 L;  5H1S E;  3UE0 A;  3PO3 G;  2MFI A;  1RL2 A;  2K5H A;  3STB C;  1NE3 A;  4NXM L;  4DV0 L;  1IYJ B;  4JBW A;  4YCV A;  2K50 A;  1N8R C;  3M3Y H;  2UU9 L;  3HOY H;  2IHF A;  1VQM A;  2JA6 G;  1YHB A;  2NVT H;  3NEN A;  1SR3 A;  5M5Y H;  4JI8 L;  5LMN L;  2D62 A;  3E0E A;  1C9O A;  2R7Z H;  4QL5 A;  1YJW A;  1ASZ A;  1LTL A;  4JI6 L;  2ES2 A;  1JT8 A;  3FKI H;  4DV7 Q;  4Y52 H;  4B3T L;  4A3F G;  1OXU A;  3E9H A;  1UX4 A;  4DR4 L;  1A62 A;  2YV5 A;  3K7A H;  3G71 A;  1VCI A;  1IBK Q;  4DV0 Q;  4B3S Q;  4XTC S;  2HT1 A;  5IWA Q;  2HQL A;  4YHH L;  1KD1 C;  1J5E Q;  4MZ9 A;  3JC6 6;  3CW2 C;  4XIG S;  1G6P A;  2Y0S G;  4A3J G;  4BA2 I;  2B63 G;  3BU2 A;  1N36 L;  2E8G A;  3CC2 A;  4GKJ Q;  4OO1 I;  4NXN L;  3KOJ A;  3FP9 A;  3RLF A;  4LF6 Q;  4B3R L;  2D0P A;  1SRO A;  3AQQ A;  1Q7Y C;  4DR6 Q;  4B3S L;  2IT1 A;  1N32 L;  3PF5 A;  1WOC A;  4OXP A;  1I6H H;  1HZ9 A;  3CXC A;  4X6A H;  1GO3 E;  2KCM A;  3GDE A;  3W1G A;  4JI1 L;  1GM5 A;  5ELO A;  4BY1 G;  5C4X H;  1FGU A;  2N3S A;  1GKH A;  4B3R Q;  1PA6 A;  2VQF L;  1PH3 A;  5JJI A;  4LUZ A;  4HIO A;  5AJ3 L;  3PIO A;  5GAH C;  4DV1 Q;  1YZ6 A;  4HJ5 A;  1KC8 C;  4A3K H;  1UX5 A;  4GN3 B;  4JV5 L;  2IY5 B;  1EUJ A;  4C2M H;  4JI0 L;  3GTL H;  5IT9 c;  5JEA G;  4AQY L;  1XNQ L;  4A3L G;  4IJL A;  4IOC A;  4A3C H;  3M7N A;  3F1Z A;  1QUQ A;  3PSI A;  1HNX Q;  4YWL A;  5C3E H;  4A3E G;  4A3B G;  2D0O A;  2GVA A;  4YWK A;  3UDI A;  3PO2 H;  3CP0 A;  4A93 H;  4P71 A;  1E1T A;  2PI2 A;  2Z6K A;  5IE8 A;  1A0I A;  3S1N H;  1FVI A;  2WAQ G;  1A63 A;  1VQG A;  3UDF A;  1TWH H;  4BBR H;  4YY3 Q;  2Y0S E;  3J80 c;  4L5R C;  4DR1 Q;  2N78 A;  1JE5 A;  1FJG L;  4B3M Q;  4DAM A;  4PMW A;  2R93 G;  2UUB L;  5C44 H;  2OCE A;  3U50 C;  1PH9 A;  4HJA A;  4NPS A;  4LF5 Q;  3RQE A;  5FLM G;  5IP7 G;  2EQS A;  4MTN A;  1VQI A;  3RZO H;  1VQ7 A;  4A3D H;  1UE1 A;  2H5X A;  1IBM L;  3GTM H;  1MJC A;  1GD7 A;  1N34 L;  1K0R A;  1SMX A;  4BY7 G;  3A74 A;  5IP9 G;  2OTJ A;  2MO1 A;  2B29 A;  4OX9 Q;  2VQE Q;  4QGU A;  3T1H L;  3JAM i;  2VUM G;  1AH9 A;  1IXR A;  1YIJ A;  1Y14 B;  2OQ0 A;  4O2D A;  3TQY A;  1EIF A;  4JYA L;  1X3G A;  3CCL A;  2UXB Q;  4JC0 A;  1Y1V G;  2RHS B;  4P72 A;  4DV4 L;  5J3B A;  4HIK A;  4GNX A;  1OTC A;  2N49 A;  1VQF A;  4IPG A;  3F2D A;  3CCS A;  3T1H Q;  1MJE A;  1Q1E A;  2K5N A;  2UXC Q;  1L2F A;  3GTJ H;  2ZJP A;  3NBH B;  1VQ6 A;  2YTY A;  1IBK L;  4DR7 L;  4JBJ A;  1Y64 B;  4RG1 A;  5M3F G;  1CSP A;  4DR4 Q;  2UXD L;  1PYB A;  5IYC G;  3A0J A;  1HZA A;  4QY7 A;  4HJ7 A;  5IYD G;  4DR2 L;  1YJ9 A;  4LF4 L;  3S2D H;  4GKJ L;  1BBW A;  1K83 H;  1TWF H;  4A3I G;  5FJ8 G;  3RZD H;  2JEA I;  3TEH B;  1YJN A;  3HOV H;  1C7Y A;  1KRS A;  1YEZ A;  3EIV A;  4LF8 Q;  1FJG Q;  1SRU A;  2VL6 A;  3DM3 A;  3U4V A;  2EXD A;  1Q81 C;  4YCU A;  1TXY A;  2KCT A;  4P73 A;  4FDB A;  3K8A A;  1CSQ A;  3PGZ A;  4JI1 Q;  4LF7 L;  3H3V I;  3S14 H;  3M85 A;  2ZJQ A;  5M3M H;  1UE5 A;  4LW1 A;  3ZJY C;  3A4L A;  2I5H A;  3T1Y L;  2JEB I;  5C0X J;  2JE6 I;  3H0G G;  1QZH A;  2CCZ A;  1QVC A;  4A3M G;  4LF8 L;  3J80 i;  3CD6 A;  3BJU A;  2F4V Q;  5IY0 A;  1C0A A;  1NMG A;  1QZG A;  1TWG H;  3L7Z C;  4HJ9 A;  5GAE C;  4GNX C;  4C3I H;  4DUZ Q;  3U4Z A;  4JBK A;  2YU9 H;  1KL9 A;  4K0K Q;  5IWA L;  3RQF A;  2IHE A;  2WB1 E;  2DGY A;  4UP9 A;  4YHH Q;  3HOY G;  1EQQ A;  1WCM G;  4GLX A;  1HZC A;  2RHQ B;  5EAY A;  3DLL A;  4YY3 L;  4DR5 Q;  1R9T H;  1VQL A;  5GAD C;  2I0Q A;  3S2H H;  4QQB X;  3HOU H;  2KEN A;  1BKB A;  3FKI G;  4O0A A;  3TS2 A;  2AHO B;  1KHI A;  2K4K A;  3HKZ G;  2LSS A;  4A3F H;  4PZ6 A;  3EBE A;  1YVC A;  1IBL Q;  3A4N A;  1S40 A;  4LF5 L;  3S1R H;  4JCV E;  2UUB Q;  1XJV A;  5LMU L;  4JG2 A;  4OO1 G;  1M90 C;  4DUY Q;  1SN8 A;  2BA1 A;  4GNX B;  1EQR A;  1UEB A;  2ALY B;  4YWM A;  1KRT A;  2UUC Q;  3CC4 A;  2B63 H;  2R92 H;  3SGI A;  4DNI A;  2IX1 A;  2JA7 G;  4GLA C;  1JJ2 A;  1VQP A;  3KJO A;  3F2C A;  4A3G H;  1CKM A;  1OXS C;  1UWV A;  4IFD I;  4JI2 Q;  1MKH A;  4DV7 L;  1IBL L;  3AEV A;  3PF4 A;  1V9P A;  2QGQ A;  3CQZ H;  4OX9 L;  4GOP B;  2NN6 G;  3K7U C;  4JI7 Q;  3W5O A;  3W8I B;  5BR8 Q;  4AH6 A;  2MNA A;  2OWO A;  3TS0 A;  3RLN A;  1X55 A;  1PH1 A;  4C3J H;  2MO0 A;  2VNU D;  1JB7 A;  1DGS A;  2OQK A;  3UE1 A;  2VS1 A;  2AMC B;  4A75 A;  4GEH B;  3MXN B;  4JI5 Q;  3D31 A;  4R4O A;  4B3M L;  3W8H B;  3VDY A;  2CWA A;  3Q8D A;  4LWC A;  5JEA J;  4DR2 Q;  1WFQ A;  4X65 Q;  3CCE A;  1KAW A;  2UXD Q;  4R4I A;  3KF8 B;  1U0L A;  4DR3 Q;  5C3E G;  2NVQ H;  4A3B H;  4A4I A;  3I2Z A;  2WFW A;  4DV3 L;  4IJH A;  2Z0S A;  1XPR A;  3HFZ B;  2ZTE A;  4A93 G;  3A4M A;  3J7Z C;  5GRO A;  1E1O A;  1P8L A;  1Q82 C;  2UU9 Q;  1VQH A;  3KFU A;  2R7D A;  5AJ3 Q;  3ADC A;  1OXX K;  1VQ9 A;  4JI0 Q;  4LNQ A;  2PNH A;  2ASB A;  2PMZ E;  1QVF A;  4JV5 Q;  3AM1 A;  2R93 H;  3OYY A;  5C44 G;  1PH7 A;  1JJC B;  5FLX c;  1B7Y B;  3I55 A;  1K8A C;  2F3I A;  4IPD A;  3PUW A;  3KDF A;  4EX5 A;  5IYB G;  1G29 1;  4BY7 H;  1G51 A;  3HOX H;  1TWC H;  3K80 C;  4JI2 L;  4NXN Q;  4PZ8 A;  1D8L A;  1YIT A;  1HNZ L;  1PH8 A;  1T9H A;  3CPF A;  3HKZ E;  4OWT B;  2VUM H;  2JQO A;  4Y7N H;  3EN2 A;  1L1O B;  3ULL A;  2XGT A;  4DUZ L;  3RNU A;  4R4T A;  2YTV A;  4PZ7 A;  1HR0 Q;  4ME3 A;  4TQU S;  3U58 A;  4KI0 A;  1Y1V H;  1O7I A;  3J81 c;  4JI4 L;  1YNX A;  4PG3 A;  5HY6 A;  3TRZ A;  2CWP A;  1SLJ A;  2CFM A;  1KIX A;  4MNO A;  4IO9 A;  1HNZ Q;  4BXX H;  3AFQ A;  4R4Q A;  1HR0 W;  3L8J A;  3KF6 A;  1X9N A;  1PH5 A;  1Q86 C;  4X66 Q;  4DV5 L;  4KHZ A;  4HIM A;  1IL2 A;  1H95 A;  5IYC H;  3KF6 B;  1NY4 A;  4J15 A;  1X56 A;  2ZM6 Q;  3I4M G;  4EQ5 A;  5IYD H;  4JI4 Q;  1VQ4 A;  1EIY B;  2K75 A;  2UXB L;  5FJ8 H;  1E3P A;  4DUY L;  2E2J H;  1HNW Q;  2F52 A;  4LFA Q;  2AKW B;  4DV4 Q;  3HOV G;  1KQS A;  2BH2 A;  2JA8 H;  4LFB Q;  1XNR Q;  4JOI C;  2UUA L;  3L2P A;  1Y1W H;  1GVP A;  1L1O A;  1PH2 A;  3S1M H;  2A8V A;  1CUK A;  2RF4 A;  1A8V A;  2C35 B;  4X66 L;  4X62 Q;  1NBW A;  1PH4 A;  2AWO A;  4JI7 L;  3I4N G;  4BBS G;  3CPW A;  1S72 A;  1ASY A;  3GTO H;  3G48 A;  3H0G H;  1CKN A;  4JI3 L;  3ICE A;  4A3M H;  4POF A;  2BH8 A;  2K5V A;  3HKS A;  4DV6 Q;  5DLQ E;  2BA0 A;  4JI5 L;  1PYS B;  1M1K C;  5GQO A;  1I5F A;  1N9W A;  4KLK A;  2HHH L;  2VQE L;  3RR5 A;  2WP8 J;  1JJG A;  4DR3 L;  1VQD A;  3GD7 A;  3T1Y Q;  1YBY A;  1LUZ A;  5C4J H;  4IOA A;  4WJ3 M;  1WCM H;  3W1B A;  1I3Q H;  1OXV A;  3CC7 A;  1J6Q A;  4RMF A;  3F8T A;  2DUD A;  1Q12 A;  3HOU G;  1HH2 P;  3HOW H;  3TRE A;  2VW9 A;  4HJ8 A;  4DR1 L;  1RIP A;  1XMO Q;  3HOZ G;  3KLW A;  3J81 i;  2V1C C;  1FL0 A;  1TWA H;  2B3G A;  2NZH A;  2ZM6 L;  3GTP H;  1XTD A;  5C0X I;  2HIX A;  1VQO A;  4LFA L;  2R92 G;  3JAM c;  2VQF Q;  1PH6 A;  4LF4 Q;  2JA7 H;  4WJ4 A;  1VQE A;  2KBN A;  4A3G G;  1PHJ A;  3CCJ A;  2CKZ B;  3F2B A;  4X64 L;  1W2B A;  5M5W H;  4JI8 Q;  2VY3 A;  2E5L Q;  3AFP A;  4X65 L;  4GOP A;  4YCW A;  4X62 L;  1RJM A;  4UY8 C;  2JA5 H;  4JI6 Q;  1EYG A;  1EOV A;  2AWN A;  1VQ5 A;  1SE8 A;  5M5X H;  3PO3 H;  5E7N A;  2K14 A;  5LMU Q;  4AQY Q;  1EFW A;  1XPU A;  3K81 C;  1WI5 A;  1XMO L;  1X6O A;  4JI3 Q;  3D0F A;  2JA6 H;  4NNQ A;  2QA4 A;  3CCM A;  4DKA C;  1OXT A;  3A5Z B;  1U5K A;  1N36 Q;  3RQG A;  2CQO A;  3L8I A;  1VS0 A;  2R7Z G;  3NEL A;  4GKK Q;  3GO5 A;  2F4V L;  3ADB A;  4DR7 Q;  4GN4 B;  4DR6 L;  1N33 Q;  3CMA A;  2FXQ A;  4DV5 Q;  3M9B A;  4ALP A;  4POG A;  2YYZ A;  2GVB A;  2A19 A;  3M4P A;  4TVA B;  3J7A 5;  1VQK A;  1QVG A;  4LF9 L;  1Z47 A;  2ZJR A;  3LGJ A;  3KJP A;  4NXM Q;  1WYD A;  1LYL A;  1BVS A;  2Q2I A;  3I7F A;  4A3J H;  3J81 j;  1XNR L;  2ID0 A;  1VQ8 A;  2NVY H;  1HNW L;  4LFB L;  1NTG A;  2R6G A;  3OTO L;  1X54 A;  4DAY B;  4JBM A;  4L5Q A;  4LUV A;  2E2H H;  3UDX A;  3G6E A;  2XTI A;  4JYA Q;  4DV3 Q;  1PFS A;  2JK8 A;  1VQJ A;  1YHQ A;  4LF7 Q;  3NEM A;  4LF9 Q;  2LXJ A;  3S15 H;  4LUO A;  4UP8 A;  4BY1 H;  5C4X G;  1KXL A;  5IYB H;  1P16 A;  3M4Q A;  3HOX G;  3FHW A;  1WJJ A;  2KHJ A;  1X65 A;  4DPG A;  1E24 A;  3S1Q H;  3GTK H;  3OTO Q;  2HHH Q;  2UXC L;  3CCR A;  3M4O H;  1CKO A;  1VQA A;  2MQH A;  2LXK A;  4A3K G;  1PV4 A;  4AIM A;  4KHP Q;  2YTX A;  5JJL A;  4A3L H;  1W3S A;  4OWX B;  4A3C G;  2ZTD A;  4L5T A;  1HZB A;  4A3E H;  4UPA A;  1EWI A;  4UP7 A;  3PO2 G;  2P63 A;  3O4X E;  2HIV A;  4GKK L;  4P75 A;  1I50 H;  3RN5 A;  4H02 A;  3PUY A;  4C3H H;  3AJM A;  1Z9F A;  3ER0 A;  4BXX G;  3L0O A;  3PUX A;  4BBR G;  1UE6 A;  5LMN Q;  3ADD A;  2NN6 I;  1V1Q A;  2I5M X;  5HGQ A;  2UUA Q;  1K9M C;  4GS3 A;  4DV2 Q;  4DK3 C;  1E22 A;  4HID A;  1HNX L;  2Q2T A;  3B6Y A;  3I4M H;  4KHP L;  3RN2 A;  4IFD J;  4JOI A;  4IFD G;  2JJQ A;  1Q8K A;  3PUV A;  1XMQ Q;  3I4O A;  2EIF A;  2PI2 E;  5FLM H;  5IP7 H;  1K8G A;  3WWV A;  2Q2H A;  3IRB A;  1J5E L;  3MEF A;  2UUC L;  1L0W A;  4A3D G;  3H15 A;  4DV6 L;  1HJP A;  3CME A;  3E9I A;  2JA8 G;  4X64 Q;  1X3F A;  3CAM A;  1BBU A;  5IP9 H;  5ELN A;  2OTL A;  3S16 H;  4P74 A;  4NB3 A;  3S24 A;  1Y1W G;  2IX0 A;  2E5L L;  3GTG H;  2E2I H;  1N32 Q;  4APV A;  3S17 H;  2VZA A;  1PVO A;  4LFC Q;  4K0K L;  4R1J A;  3PV0 A;  4L5S A;  3G4S A;  3I4N H;  4BBS H;  1VQB A;  1IBM Q;  1XMQ L;  2I5L X;  1B8A A;  1Q46 A;  3BZC A;  1K3R A;  1X3E A;  2R7F A;  3CF5 A;  4GOP C;  2ATW A;  1NJI C;  3A5U A;  3PUZ A;  4GLV B;  1MIU A;  3ERS X;  4DV1 L;  2A1A A;  3RLO A;  1B70 B;  2GN5 A;  1VQC A;  1XPO A;  1VQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...