3IRBA

Crystal structure of protein with unknown function from duf35 family (13815350) from sulfolobus solfataricus at 1.80 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
KEGSLLRWYDVMEAERYEYTVGPAGEQFFNGLKQNKIIGSKCSKCGRIFVPARSYCEHCFVKIENYVEINKDEAYVDSYTIIYNDDEGNKLAQPVYIALIRFPNIEGGLLCYAEGNVKVGAKAKILSFQWPLRVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein from DUF35 family
publication title The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Acyl-coa binding protein
total genus 27
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01796 OB_aCoA_assoc DUF35 OB-fold domain, acyl-CoA-associated
A PF12172 DUF35_N Rubredoxin-like zinc ribbon domain (DUF35_N)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.20 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3irbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3irbA02
2L15A 3E0EA 1K9MC 4OO1I 2F3IA 4BBRG 4DV3L 3S16H 4P74A 2PI2E 1K73C 4B3TL 4A3DG 2GVAA 4JI3Q 1L0WA 5K36G 3KF6A 5IP7G 1LUZA 2XTIA 3K7AH 4A3LH 3BZCA 1UE7A 2UXCQ 5C0XI 4QJFA 1WCMH 1Z47A 4YWMA 3T1YL 1VQAA 5FLMG 3KOJA 4XIGS 1M90C 1XTDA 5IYBH 1IBLL 3S15H 4C3IH 3KLWA 5BR8Q 3RR5A 4A3BG 1OXVA 3BZKA 5JJLA 2KCMA 1Q1BA 4GLAC 2E8GA 3RLNA 3PUVA 4AIMA 4A3JG 5HY6A 1K8GA 3E9IA 1J5EL 4YHHQ 1A8VA 1VQLA 1O7IA 3KF6B 1L1OC 4BBSH 2IX0A 3HKZE 5AJ3Q 2ZM6Q 1HR0W 3CMEA 1XMQQ 1CKMA 1IL2A 3GTKH 1PYBA 2WP8J 4JI3L 1X9NA 3PO3H 1UEBA 1NY4A 4PZ7A 4BY7H 1IBKQ 4UP9A 2NVQH 2WB1E 2I5HA 2VY3A 4GS3A 3RNUA 1KL9A 1TWFH 3J81i 4BBRH 3CMAA 2UUAQ 4NXNQ 1XNQQ 4GOPC 4A3DH 1XNRQ 2YU9H 1XJVA 5IP7H 5GQOA 1B8AA 1QVFA 1GO3E 3ZJYC 1NMFA 5BR8L 3RZOH 3B6YA 5IP9G 1TWHH 1PYSB 2R7ZH 4X64Q 1E7ZA 5FLMH 2YTYA 2R7DA 2ZTEA 4JI6L 2MQHA 4WJ3M 3FKIG 1D8LA 1TWAH 1MJEA 1PH8A 3M9BA 1I94L 2K75A 5ELNA 3NEMA 3J80c 4A3BH 4YHHL 5C4JH 1MKHA 3HKSA 4JCVE 1HNZQ 3A5ZB 3K81C 3F1ZA 4AYBE 5GAGC 5AJ3L 2ZM6L 1G291 1R9TH 1XMQL 2B3GA 4A3JH 2VS1A 3CCJA 1VQ8A 1KXLA 1QVGA 1IBKL 3KDFB 3ULPA 1XPOA 2KCTA 4GKKQ 2I5MX 1N32L 1WOCA 3ER0A 2R6GA 4NXNL 1XNQL 1PFSA 2R93G 4C3JH 2UUAL 4IJLA 4IFDJ 2WB1G 1PA6A 1ASZA 3RN2A 1XNRL 1VQ9A 3CPFA 3U4VA 4JBKA 3M4QA 2PQAA 1GVPA 5FLXc 3HOUG 4GNXA 1VQ4A 2E5LQ 4LF4Q 3ICEA 1HNWQ 4J15A 4BY1H 2BA0A 4X64L 2F4VL 4L5TA 3BJUA 2DGYA 5M5YH 1W2BA 1N34Q 1OXXK 1VQJA 1NJIC 1KRTA 5IP9H 2D62A 2NVYH 2IT1A 4ME3A 2H5XA 2IHEA 2UXDQ 5LMUQ 2NZHA 1EFWA 3FKIH 1PH3A 1BBWA 3I4OA 3PO2G 4YCUA 4JI4Q 4GKKL 4DV4Q 4A3FG 3GTGH 2RF4A 5M5XH 4LF6Q 4UP8A 1SE8A 4GNXB 3FHWA 3OTOQ 4YY3Q 3K0XA 2NVXH 1N9WA 4B3MQ 5LMNW 4LUOA 3TS2A 3W5OA 4KLKA 3PF5A 4OWXB 2QEXA 2K52A 1GM5A 2E5LL 4LF4L 4BA2I 1HNWL 3PF4A 3HOZG 2CWAA 2OTJA 2AKWB 1YJWA 2A19A 4DR5Q 3BU2A 5GAHC 1N34L 1K3RA 4GN5A 3HOUH 3U4ZA 1N32Q 1N36Q 4Y7NH 3RLOA 1YJNA 1S72A 4P73A 1KRSA 2EIFA 3HFZB 3ULLA 3G71A 1QZHA 2R7FA 2UXDL 2JJQA 2YYZA 1TXYA 5LMUL 1HR0Q 2NVTH 2KHJA 4YCVA 3I55A 3T1HQ 4JI4L 4DV4L 1IXRA 1Y1WH 3HOYH 4B3RQ 5IYBG 2NZOA 3STBD 2DUDA 4PG3A 1E22A 5GAEC 2UU9Q 3S17H 4FDBA 3OTOL 3PO2H 1UE1A 3AQQA 4KI0A 4YY3L 2B63H 4A3FH 4DV5Q 4B3ML 2MO1A 5DLQE 2JA7G 2NN6I 1I3QH 3GTJH 2ZJPA 1EOVA 1TWCH 5M5WH 4JI8Q 4IOAA 5C4XG 2E2JH 4DR5L 4BBSG 3KJOA 4LF7Q 4O2DA 2KBNA 5JEAG 4AQYQ 2I5LX 1X54A 2KHIA 2EXDA 2N78A 3CAMA 4IPHA 4EX5A 2GVBA 3K80C 4DV1Q 1N36L 2MFIA 2JQOA 4NXMQ 3IRBA 4A3KH 2RHSB 4XTCS 2HIXA 2F4VQ 3HOZH 4HJ5A 3I4MG 1CUKA 1NMGA 1HR0L 1PH9A 1EQRA 1OXUA 1GD7A 2AWNA 3T1HL 4B3RL 3L7ZC 5M3MG 1K8AC 4JI2Q 1PVOA 4LW1A 5JJIA 5H1SE 4DR2Q 3E9HA 1SR3A 1YI2A 2UU9L 2R7ZG 5FJ8G 4DV5L 2IX1A 3PIOA 3AFQA 4A3GG 4Y52H 4DNIA 4DAMA 4B3SQ 4JI8L 2CKZB 1RL2A 4P71A 4LF7L 4JI6Q 4AQYL 4A3EH 2JA7H 1WYDA 1YVCA 4X65Q 3JAMc 3CCMA 4DV1L 1I94Q 3AFPA 4DR1Q 2LXJA 1OXSC 5C4XH 4X62Q 2MNAA 4IFDI 3TS0A 4OXPA 4JI7Q 4IPDA 3AYHB 3NBHB 2VQEQ 3H3VH 4C2MH 4DK3C 3D0FA 1HNXQ 3S1QH 4JI2L 1BBUA 4A3MH 1BKBA 1AE3A 4C3HH 1VQMA 3MEFA 1Y14B 4DR2L 3HOWH 3I4MH 3KDFA 3H0GH 4BY1G 4X66Q 1QUQB 3I4NG 3M4OH 3S2DH 2VUMG 4RMFA 5IE8A 3CPWA 5M3MH 4TQUS 5GROA 2VW9A 5LMNQ 1Q7YC 5ELOA 2C35B 4A4IA 1PH2A 4B3SL 1KIXA 1I50H 2K50A 3PGZA 3GTMH 2Y0SE 5FJ8H 4EQ5A 2MO0A 3S1NH 4BA1I 1VQHA 3G6EA 1KD1C 1VQ5A 4A3GH 4GNXC 4X65L 2A8VA 3CCEA 4X6AH 4LWCA 4DR1L 4X62L 2WAQE 4MZ9A 1VQGA 3TREA 1SRUA 4QGUA 3L0OA 2V1CC 1IZ6A 4DUYQ 4JI7L 2VQEL 3M3YH 3HKZG 1HNXL 3F2DA 1YIJA 1WI5A 3U58A 3VDYA 3RZDH 2YTVA 4X66L 4DR7Q 3M4PA 4OX9Q 3S1MH 4QIWE 1N33L 1SN8A 1VQIA 2K4KA 2BH2A 5LMNL 1D7QA 1L1OA 4NPSA 1SMXA 1V43A 4GKJQ 3CC7A 1VCIA 2VZAA 3RLFA 3I4NH 3KFUA 1Q1EA 2VUMH 2A1AA 5IYCG 4H02A 3GTLH 2R92H 1OXTA 4GOPA 1FL0A 1JJCB 1JJ2A 1Y1WG 3HOYG 3A74A 1K83H 3CXCA 2Z0SA 2ZTCA 2RCNA 3A5UA 1XPRA 1HH2P 4DUYL 2WAQG 1HZ9A 4AYBG 5C44H 3CCSA 2Q2UA 3HOVG 3J7A5 2B63G 2R93H 1Q12A 2Z6KA 4JV5Q 1KQSA 1M1KC 1ASYA 3I56A 3F2CA 4DR7L 1L1OB 1VQOA 4POGA 1B7YB 1NTGA 4OX9L 1JMCA 2JA5G 2UUBQ 4JOIC 4DR3Q 3UDXA 5IWAQ 4KHZA 1P8LA 4L5RC 3GTQH 1PH1A 2JE6I 4GKJL 1EYGA 2KENA 3I2ZA 2F52A 1E24A 1X3FA 4JG2A 4A3KG 1UE6A 4IO9A 4GOPB 2CWPA 3OYYA 2JA8H 3W1BA 4YWLA 3LGJA 4P72A 1A62A 1EUJA 2QA4A 1Q46A 1VQEA 1A0IA 2WFWA 3FP9A 2LSSA 3KYHC 4DPGA 3J81c 4HJ9A 2VQFQ 5IYCH 1MJCA 2OWOA 4MNOA 1EIFA 4JYAQ 2YV5A 1X56A 3MXNB 3UE0A 5C3EG 3D31A 4JV5L 1TWGH 2XGTA 2PMZE 2ES2A 4OWWB 3PCOB 3CQZH 4OONA 2UXCL 2AWOA 4O0AA 3Q8DA 3HOVH 2UUBL 5IY0A 4DR3L 3DM3A 1WFQA 5IWAL 4A3EG 4BXXG 4UY8C 4DR6Q 3F2BA 4GN4B 3CD6A 2OTLA 1IBMQ 1L2FA 3PUYA 2JA5H 2K5VA 2D0OA 1EQQA 4JBJA 4JYAL 1A63A 4KHPQ 3WWVA 4L5SA 3CC4A 5JEAJ 1JT8A 1JJGA 1CKOA 1FJGQ 5HGQA 2GN5A 4DAYB 4A3MG 3JC66 2VQFL 3HOWG 2QGQA 3J80i 1KHIA 1E1TA 1LTLA 1YZ6A 3H0GG 4OWTB 3GO5A 3W1GA 4HJ8A 3TEHB 3PIPA 1G51A 2OQKA 3CC2A 3CCVA 1PV4A 2E2IH 4NB3A 2Q2TA 2JA9A 1NBWA 2JA6H 2OQ0A 2CQOA 3CW2C 3K7UC 1Q81C 4LF8Q 1YBYA 3PUXA 4LFAQ 5C3EH 1WJJA 2HT1A 4R4CA 1QUQA 3ULJA 1PH7A 4LNQA 4A76A 4DR6L 1HZAA 4R1JA 1YEZA 2IY5B 3I7FA 1IBML 2B29A 4JC0A 2BH8A 1HJPA 1JB7A 1CKNA 1XMOQ 4KHPL 1X55A 3PV0A 4BXXH 1YJ9A 2HIVA 1QZGA 4IJHA 4DKAC 3S1RH 4GN3B 4JBMA 3PUWA 1CSQA 1B70B 4GLXA 2FXQA 2UXBL 2ZTDA 4POFA 1Y1VG 1YHAA 3NELA 4DR4Q 2EQSA 4A3IG 1LYLA 1E3PA 3EIVA 3NENA 4K0KQ 1S3OA 4HIDA 3PUZA 4LF8L 1V1QA 4R4TA 3K8AA 4LFAL 4ALPA 4IOCA 1CSPA 4UP7A 1N33Q 5IYDH 4R4IA 1RIPA 2N8NA 2Q2HA 2R92G 1Q8KA 1CKNB 1FJGL 2NN6G 1FGUA 3A0JA 4QQBX 4LUZA 5J3BA 5GADC 1XMOL 3EBEA 1VQ6A 1AH9A 3ERSX 4R4QA 4DK6C 5C44G 1U0LA 1J6QA 4PZ8A 4A3CG 2JEAI 2JEBI 2K5NA 2ZJRA 4LF5Q 1LM0A 4OO1G 3CCLA 3J7ZC 2ID0A 4DR4L 4K0KL 1VQBA 3G48A 1C9OA 2Q2IA 3CF5A 3S2HH 2UXBQ 3HOXG 5C0XG 4APVA 4PMWA 5JJKA 2K14A 3L2PA 1Y1VH 2N49A 5C0XJ 2JA8G 4A3IH 2Z6KC 5E7NA 1H95A 4RG1A 4DUZQ 1SFOH 1W3SA 3G4SA 1X3EA 2D0PA 2RHQB 4A75A 1U5KA 1S40A 1VQDA 1P16A 2PNHA 4JI1Q 2Y0SG 4JBWA 3PSIA 3CP0A 1N8RC 1HZCA 1UE5A 4LF5L 4IFDG 3GTOH 1YHBA 4DV6Q 1JE5A 4A3CH 1K0RA 3KJPA 3KF8B 3F8TA 1QVCA 3GTPH 1KAWA 3TQYA 3UDIA 3CCRA 1KC8C 1EWIA 4JI0Q 5M3FG 2ATWA 4DUZL 4IPCA 1BVSA 1HZBA 2OCEA 1MIUA 1I5FA 4YCWA 5IT9c 3HOXH 4DV0Q 1YITA 3SGIA 4JI5Q 3H3VI 3PO3G 4YWKA 3J81j 4WJ4A 4GLVB 4L5QA 1VQ7A 4JI1L 3UE1A 1HNZL 4LFBQ 2BA1A 2UUCQ 2AHOB 4A93G 1VQFA 4DV2Q 2JA6G 3JAMi 1Q86C 1OTCA 4NXML 2PI2A 3UDFA 4P75A 4DV6L 1YNXA 4HIKA 2CCZA 4LUVA 1G6PA 2PQAB 2VL6A 1Z9FA 1X6OA 4TVAB 4HIMA 1XPUA 1UWVA 1E1OA 3EN2A 1C0AA 1Q82C 4QL5A 3GDEA 4PZ6A 2LXKA 4HIOA 4JI0L 1VQNA 2ALYB 1I6HH 2YTXA 1FVIA 2AMCB 4DV7Q 4HJAA 1IYJB 3UDGA 4MTNA 1PH4A 1C7YA 4LFCQ 4DV0L 1GKHA 2HHHQ 3S14H 2HQLA 1X3GA 4JI5L 4LF9Q 5M3FH 3CCQA 1AE2A 1YHQA 1PH5A 4IPGA 3S24A 2E2HH 4A3LG 4LFBL 1WCMG 1DGSA 1T9HA 4DV3Q 1X65A 2UUCL 1V9PA 3H15A 4B3TQ 3M85A 4DV2L 4JOIA 1PH6A 4QY7A 3AEVA 3U50C 4LF6L 3M7NA 5IYDG 2JK8A 3T1YQ 1PHJA 3GD7A 4HJ7A 1VS0A 4A93H 3RN5A 2VNUD 1SROA 4R4OA 1IBLQ 1EIYB 3DLLA 2ZJQA 1SLJA 1VQKA 4DV7L 3STBC 1VQPA 3CCUA 4LFCL 4UPAA 2ASBA 2HHHL 4LF9L 2IHFA 3TRZA 3OW2A 2N3SA 5EAYA 4BY7G 2K5HA 1VQCA 4AH6A 2I0QA 2CFMA 1NE3A 1J5EQ
chains in the Genus database with same CATH superfamily
1LO5D 3S16H 1UNSA 4DV3L 1IW7D 2AQ3B 1GUTA 5K36G 2GVAA 4JI3Q 1L0WA 4ZLTF 3K7AH 2DJGC 3W8HB 1UAPA 4KKTA 1XXGA 5C0XI 2UXCQ 5E4WC 4XT3B 1VQAA 3KOJA 1B1ZA 5EJWA 4FZWA 4IZDA 4XQJA 2K6AA 5ELBA 3RR5A 4A3BG 2KCMA 2Y0SB 1Q1BA 1SNCA 5C6AA 3OHXC 3PUVA 5HY6A 3J80L 1J5EL 4YHHQ 1VQLA 1L1OC 3D6CA 4CJ1B 4TKOB 1YNJD 4C1NI 4DAPA 1CKMA 4JCSA 3HS0C 1UEBA 1NY4A 3S14B 3HRXA 1SYBA 2QF7A 2F03A 5IGCA 2HT1A 4BBRH 4GOPC 5M3FB 1DOLA 2JA5B 2EYMA 2O5IC 2CQAA 3KUPA 3ZJYC 1NMFA 3MXUA 5BR8L 1J9OA 2B2UA 4DXFA 2YTYA 5IT9L 2PNRC 4K2NA 1SE4A 1TWAH 4HSVA 2PCFB 5ELNA 3NEMA 2O5JC 2JA6B 3LWUA 2VREA 3F1ZA 2ZM6L 1XMQL 4A3JH 2VS1A 3OOCA 1QVGA 1SNQA 4NXNL 2R6GA 2IJ0A 1PA6A 1ASZA 4RFBA 2BE5C 2Z9HA 1H9SB 1WTXA 3GV3A 4JBKA 4IZCA 1GVPA 4RA8A 4RCOA 5FLXc 1AW7A 3I8ZA 3MHBA 4CJ2C 3T89A 3I47A 2CH4A 4DF7A 3ICEA 1HNWQ 2AQ1B 2CHBD 2EYPA 2F0TA 3VYSA 5KGUA 4K6LA 1N34Q 3R3OA 1O80A 3BS1A 4XT1B 2EVBA 2D62A 2NVYH 2H5XA 2UXDQ 1JOQA 1EFWA 2NZHA 1SYDA 1HA5A 3N6RA 1A6XA 3QOJA 3P1HA 5DNFA 1IYVA 3GQBA 2F0DA 5I6YA 1SE8A 2EY6A 2ICIA 1TY2A 5T1GA 4YY3Q 3K0XA 4B3MQ 4JPBW 5LMNW 4LUOA 3TS2A 4KLKA 2R93H 2B2TA 3KLRA 2I46A 1C48A 2AKWB 1YJWA 1HFGA 4GN5A 4A3DB 2XIWA 1YJNA 2RQXA 1QZHA 1LLRD 5EPJA 2JJQA 5LMUL 1EYCA 1F2ZA 4YCVA 4DK0A 4JI4L 4RGTA 5ELFA 4B3RQ 4FO2A 3STBD 5IODA 2X6GA 4PG3A 4OL7A 4K8IA 3TDQA 1I4QA 2ENBA 4F87A 2B63H 4A3FH 2ZJPA 2A6EC 4IOAA 5C4XG 2E2JH 2A69C 1FNWA 2A6HD 3KJOA 1MSHA 4O2DA 4AQYQ 1X54A 2KHIA 1A3VA 4DV1Q 3IRBA 4A3KH 4XTCS 3GTPB 3D4DA 3NQTA 3NTIA 4C3HG 1CUKA 5JOBA 2OEOA 5DM73 3HG9A 4JI2Q 5JJIA 4DR2Q 2F0PA 4U19A 2K33A 1HTLD 1EY0A 3AMUA 2IX1A 3PIOA 3AFQA 5NUCA 4A3GG 4WRDA 3FKIB 1RF2D 3URYA 3RSIA 2CKZB 3GTGB 1GUOA 4LF7L 4JI6Q 2O2LD 2JA7H 5K5PA 1WYDA 3JAMc 4DAVA 1KXLA 4NXML 3C2PA 1I6HB 5JEAH 1PFMA 3D0FA 2WKDA 3MXPA 1BBUA 1BKBA 3H3VC 3BDOA 4P2CB 1VQMA 3HOWH 1Y14B 3I4MH 3HOUB 3R2IA 3H0GH 1QUQB 2E74C 3MVVA 3I4NG 3S2DH 5EKLA 4NEKA 5M3MH 4RH6A 5GROA 5LMNQ 1Q7YC 1M4VA 5FJ8H 1EWHA 1NR4A 4FXKC 1VQHA 1DCIA 2KA7A 4ZYSA 2QDLA 4K2LA 4X62L 2BE5D 2WAQE 3H09A 4MZ9A 2PZWA 3TREA 1SRUA 4DUYQ 1EY3A 3E0JA 3IAYA 1WI5A 1PTOH 3RZDH 4X66L 4DR7Q 4OX9Q 3S1MH 2SNSA 1L1OA 2LFNA 4ILWA 1I4HA 4DU9A 2RVLA 1Q52A 2A1AA 3VA5A 1WCMB 4GOPA 2HD3A 3Q24A 3A74A 3J81L 2ZTCA 4C3IB 5F2DA 2DUBA 3QO2A 3J7A5 3HOVG 3M7GA 2B63G 4JV5Q 3ADCA 3I56A 3KLSA 3UI2A 2A74C 1B7YB 3VR2A 1JMCA 4JOIC 4BBSB 3O13A 2EY5A 1P8LA 4GKJL 4R9WA 1EYGA 4C2MB 1E24A 4A3KG 2QEJC 1HZDA 3OWEB 3TP7A 4YWLA 4P72A 1LABA 4NNQA 1V1PA 1A0IA 4DPGA 3MZ5A 1G2SA 3N52A 5FLXE 4MNOA 1TWHB 1PRTB 4DAYA 1X56A 2VB3X 3MXNB 1RTOA 2A6ED 1BCPB 2A69D 3PCOB 2ZQQA 4A3BB 5IY0A 4DR3L 3DM3A 3T51B 1WFQA 1EYAA 2KUMA 1R9TB 4BXXG 4UY8C 4DR6Q 1STNA 1GXDC 4GN4B 3CD6A 1STYA 4I7AA 3NUCA 2QDBA 3QG1A 1IBMQ 2OTLA 2JA5H 1JC7A 4JBJA 1KDAA 3BVGA 3JAML 1CKOA 5EGTA 3VR4A 3HOWG 3H0GG 3TEHB 1G51A 1RHPA 4NB3A 3FEWX 2JA6H 2RA4A 4LF8Q 1YBYA 5C3EH 4MIUA 2VXWA 3U9OA 3C1FA 3ULJA 2IY5B 4KMUC 4R1JA 1D1KA 3I4LA 2FBMA 4JYLA 4JC0A 2BH8A 2MP1A 3MA2B 1XMOQ 5M5XB 2HDLA 1F2LA 2K05A 4DKAC 4N9PA 1LTGD 4GN3B 1Y8NB 1X3QA 3PUWA 4L6TB 1CSQA 3GTQB 2FXQA 2UXBL 2ZTDA 4FNFA 1MJ3A 4ZUJA 1EY5A 3NELA 4DR4Q 2EQSA 1E3PA 1MHWC 3PUZA 3K8AA 3ND9A 4LFAL 4IOCA 4UP7A 5IYDH 1PFBA 2PW7A 2NVTB 1Q8KA 3R93A 3HOYB 3D4RA 1TWGB 2B2VA 3EBEA 1VQ6A 4OG1A 2WAQB 4QIIA 3AM1A 1B4OA 1J6QA 4AYBB 3RD4A 4HCEA 4LF5Q 1CQFA 1LM0A 1LTAD 5KJPA 3T16A 1Y8OB 3G48A 2Q2IA 3S2HH 2QILA 4PMWA 1D1IA 2K14A 1DOKA 2C5CA 5E7NA 4XYQA 1H95A 1ZYRD 1W3SA 2RKSA 1X3EA 4CKEA 1CHPD 4A75A 3MAQA 4PNYA 3BDLA 1VQDA 4WFN3 4CGYB 2Y0SG 4DFAA 1T5EA 2XRQD 1QILA 5CR3A 4DXGA 3CP0A 1O7ZA 3HINA 2HUGA 4IFDG 1EEID 1JE5A 1EY4A 2K32A 4A3CH 4ZU2A 1K0RA 4A3EB 3KF8B 3F8TA 3GTPH 1U4MA 1KAWA 4JI0Q 5M3FG 3OMCA 2K5QA 1HZBA 2QW7A 3H3VI 1PVOA 4JI5Q 1YITA 1S5FD 2CH4W 4X3TA 4WJ4A 1I4GA 1EY8A 4C3HB 4LFBQ 3CRLC 2UUCQ 2NYZD 2JA6G 1DXMA 3A4LA 3W2DA 1OTCA 3UDFA 1ONLA 4DV6L 2PQEA 4LUVA 2SDFA 1X6OA 1LACA 2F0UA 1C0AA 4QL5A 1VDZA 4HIOA 1RJTA 2B2WA 1I6HH 1JWMD 1C7YA 1GKHA 4LF9Q 3NE5B 4LAAA 1AE2A 1YHQA 1TU2B 1B3AA 2BOSA 1X65A 4B3TQ 3M85A 3DEPA 3T4AC 1B44D 4JOIA 1G6ZA 2LY7A 4QY7A 4Q0FA 3AEVA 4F8MA 5IYDG 1E0BA 1PHJA 1GUWA 3GD7A 4A93H 2R92B 3KBXA 2NZ1D 1EIYB 4TRDA 5J1ZA 1IBLQ 1XTCD 3J7AF 5C4ZA 2F0KA 4DV7L 2JP1A 3QJYA 1GHKA 2ASBA 3X3NA 3SWXA 4BY7G 2PZTA 3IKJA 2CFMA 3E0EA 4QF4A 2IW3A 5L37A 4P74A 1NCVA 4A3DG 1STEA 3KF6A 3E6ZX 5KNBA 2XTIA 5DEHA 3CU7A 1WCMH 4YWMA 4M1UB 3H02A 3OWFA 3VYRA 1M90C 4K5VA 5IYBH 3S15H 1EU4A 4C3IH 3KLWA 2AUKA 3MXGA 3BZKA 1EF8A 3DUZA 3RLNA 4AIMA 4KTAA 1PYWD 3E9IA 1XYIA 1Q90A 1SE2A 4NKLA 4BBSH 3HKZE 1HR0W 1IL2A 1PYBA 2WP8J 1IYUA 3G6JB 3EA6A 3RMHA 2WB1E 2I5HA 3RNUA 3FMCA 3CMAA 3PIP3 1W6JA 3P7JA 1XNRQ 2YU9H 4QIWB 1QVFA 3TSSA 4QB4A 3RZOH 5IP9G 1TWHH 1PYSB 4JI6L 3FKIG 2E2IB 2F3WA 3M9BA 2K75A 3J80c 4A3BH 2SNMA 4V190 3HKSA 5JVH3 5GAGC 3K6OA 1SNOA 2F0HA 5AJ3L 4U673 1R9TH 2B3GA 1VQ8A 1EU3A 1H9RA 1IBKL 1IKMA 4GKKQ 3R9TA 1XNQL 1PFSA 2UUAL 4IFDJ 1II3A 4FF1A 1VQ9A 2EY1A 3HOUG 1QJOA 4K2KA 4GNXA 4ID6A 2BA0A 2RBMA 4X64L 1S4ZA 1OXXK 2PW5A 2QCPX 2IT1A 4ME3A 2KOLA 4R8NA 1GUNA 1S5DD 1BBWA 2VX2A 3DWPA 1PDQA 2RF4A 2EYHA 5M5XH 2PMZB 4UP8A 4CDEC 3BYTB 1H9MA 5D3IB 2E5LL 4LF4L 1B9NA 3QB3A 4XYOA 1TS5A 2A19A 4DR5Q 3VYUA 3U4ZA 1N32Q 1N36Q 1B53A 1GUSA 3NWTA 3PMFA 1KRSA 2EIFA 3HFZB 2R7FA 1WTVA 1MSGA 2YYZA 1HR0Q 2NVTH 4HAEA 2KHJA 3T1HQ 1BDOA 5EBCA 2ZT9C 4DV4L 1SFOB 2MJ8A 3HOYH 5IYBG 5ELDA 2NZOA 1TQOA 5BN5A 1E22A 4OLQA 5CV8A 3S17H 3I3CA 3OTOL 3AQQA 1G91A 4DV5Q 2NN6I 4IUUA 1TWCH 2A73B 4MHEA 4JI8Q 3Q0GA 2F0OA 3CRKC 4BBSG 1Y64B 5FO8B 2KBNA 3CAMA 3HP3A 2N78A 4EX5A 2GVBA 3K80C 2JQOA 5IOCA 4J1MA 1OO9B 1EZ8A 2G5DA 1EQRA 1GD7A 3BZDB 1K8AC 1G8ZD 3NBHA 3P20A 4IUNA 3E9HA 1YI2A 2UU9L 2UZFA 4Y52H 3OIQA 4DNIA 5DM63 3DM1A 1RL2A 3MC0B 4P71A 4KKUA 4A3EH 2IWHA 1I94Q 2F4VL 5I4DA 5C4XH 1OXSC 2MNAA 1Y8PB 3T88A 4OXPA 2WB1B 4IPDA 2F0NA 2Z4IA 1A2UA 4C56C 1AE3A 1SNMA 4C3HH 2M2LA 4LK1C 2RDHA 1BNZA 2OT2A 2E2HB 2B2YC 2IPKD 5IE8A 3CPWA 4QUFA 5KEEA 2C35B 4B3SL 3PGZA 1C4QA 3S1NH 3G6EA 1KD1C 1VQ5A 4A3GH 1GJXA 4X65L 1I6VC 3PO2B 5FOBB 4LWCA 4DR1L 3NTHA 1SYEA 4JI7L 2V1CC 1IZ6A 2ZXRA 3M3YH 2VQEL 1ENFA 1HNXL 1YIJA 4FXGC 3U58A 5ELEA 1D5XC 1PTOC 5M9OA 3R0OA 4OELB 3M4PA 3HOZB 2F0GA 4PQXA 4ELSA 4NPSA 3EFXD 3MTSA 2IL8A 4C1NK 3I4NH 1Q1EA 4HEDA 1STBA 2VB2X 5IYCG 1HUNA 1EY9A 3D3RA 1R4QB 3K5MA 2R92H 3L8IA 4KN7C 4ZUIA 3HOYG 1K83H 4KN4C 2PYKA 1HH2P 4F7XA 2WAQG 5C4HA 1HZ9A 4AYBG 2Q2UA 3ONAB 2Z6KA 1KQSA 1M1KC 3AB9A 3F2CA 2P5ZX 1HQRD 4U1AA 4EVOA 5E3FA 4ELWA 3J80E 3UDXA 4PV1C 3KK7A 3GTKB 4BY7B 3PO3B 1PMRA 1UE6A 2EOTA 3OYYA 1TWFB 3VR5A 1A62A 1SJED 1X3PA 1Q46A 1VQEA 1G2TA 2WFWA 2RSNA 5FO9B 5KYIA 3J81c 4M8AA 2OWOA 1MJCA 5CYUA 1EIFA 1KDCA 2R7ZB 1I50B 4DNRB 3QK8A 1CA5A 2K04A 3NSWA 3WOFA 2XGTA 4QMGA 5IT9E 4OONA 4ODGA 5CORA 5C4JB 2UUBL 3HOVH 1UX5A 1JWUD 5IWAL 4A3EG 2L1BA 2K5VA 1F9RA 4KHPQ 1SBBB 1JJGA 3LNNA 5HGQA 4ELXA 2VQFL 1QE6A 1WTHA 2QGQA 4JYAL 1YZ6A 4BY1B 3A4MA 3CCVA 4RHRA 2E2IH 2VUMB 5M5YB 2JA9A 1KDBA 3TLFA 3GTLB 3CW2C 1YNNC 1Z7TA 3PUXA 4OEMB 2F4IA 2BCOA 1ILPA 1PH7A 4A76A 1JQYD 1YEZA 4CKCA 2B29A 1RDPD 2XVSA 1HJPA 2OXPA 1CKNA 1X55A 1MBYA 3PV0A 4PMCA 4BXXH 2HIVA 1QZGA 4IJHA 4HR7B 3PQIA 4IUVA 2NVXB 1FD7D 3FRPB 2M00A 4FXDA 1XWEA 4GLXA 2IX3A 1I4XA 4GZYC 1ML0D 4A3IG 3NENA 3EIVA 2DY8A 2JXMB 1S3OA 5CBEE 5CV4A 4HIDA 2R92G 2J7ZA 1ILQA 2NBFA 4JK1C 4LUZA 1AH9A 3FDUA 1UEAB 1U0LA 4PZ8A 5JPMC 1PTOD 3OC7A 1LV9A 1I3QB 3MWYW 4OO1G 4OIJA 5M5WB 2ID0A 1EY7A 4K0KL 3EQLC 3SK8A 4QIJA 3KQFA 1VQBA 2DNEA 1EY6A 1C9OA 1C8CA 4H7BA 1H9JA 5JJKA 4ZCKA 5C0XJ 4PMBA 4DUZQ 2E2DC 2HCCA 1SFOH 3C3LA 1HHVA 1U5KA 3DWQA 2D2CC 1S40A 1D5ZC 2DN8A 5FO7B 5IGGA 3TZDA 4JBWA 1JR0D 3PSIA 2LKVA 4XQNA 1LT3D 3HEJA 1N8RC 1U9RA 4MN3A 1WTOA 1YHBA 4JVZA 1HRJA 2RCFA 3OMGA 4FF3A 3CCRA 3TQYA 1EWIA 3QXZA 1TIID 1ICFB 4KV6A 2RDGA 2ATWA 4Z9CB 1A3TA 1I5FA 2EE1A 1PZID 1SDFA 1KNEA 4JI1L 2TSSA 3M4OB 2F6QA 1HPCA 2G9DA 1HCZA 1KAAA 4K5WA 4G7HC 3JAMi 4K5XA 5D3DA 3EVQA 2R3ZA 1DCZA 4P75A 1R4PB 1G6PA 2CCZA 2EYJA 1Z9FA 1Q3LA 4L8JA 1EYDA 1E1OA 1UWVA 3DXJC 1Q82C 3BYYB 4IFDH 3ADDA 1PXUA 5J22A 2EYFA 1HQMC 4MTNA 1PH4A 3S14H 4DV0L 1X3GA 1MGSA 4L63B 5M3FH 1QG7A 3V05A 4IPGA 4ME5A 3S24A 2E2HH 4A3LG 2KCNA 4DV3Q 1Y1VB 1V9PA 3H15A 4DV2L 1JB3A 3GV6A 4EQOA 4IN3A 4IZ8A 2KCCA 1DJRD 3SHLA 4GEHB 2EJGC 2ZJQA 4R4OA 4U18A 1VQKA 5IGEA 3J81E 1VQPA 1BXTA 2K7VA 4LFCL 4UPAA 2HHHL 5C44B 3TRZA 3OW2A 1BF4A 2K5HA 1VQCA 1NE3A 1J5EQ 1BBXC 2F3IA 5CV5A 1EOTA 4N9TA 3CKIB 5I2XA 5IP7G 1LUZA 3T56B 3BZCA 1UE7A 4FYDA 3HOXB 1RCVD 1Z47A 3T1YL 2JA8B 3Q23A 5FLMG 2FFKB 2GTRA 2NUCA 1K28A 1XTDA 4I52A 1ICWA 2AUJD 5BR8Q 4NDXA 5COYA 1GUGA 1WTWA 3SK4A 1TR5A 2EYOA 2IX0A 2ZM6Q 3IL8A 1TT2A 1XMQQ 3GTKH 4JI3L 1X9NA 3PO3H 4KHVA 4BY7H 1VF7A 1TY0A 2X69A 4UP9A 5I6WA 2VY3A 4NXNQ 1SYGA 2UXCL 1TWFH 3I70A 4A3DH 2PO4A 1O78A 3L3OC 5GQOA 1B8AA 1MD2D 1GO3E 4J8QA 1U4LA 1H9SA 4ZKCB 3JAME 2WV6D 2R7ZH 2EJMA 3R2TA 1JXZA 1PRTC 2ZTEA 1DD2A 2WIIB 1D8LA 1BCPC 1PH8A 1I94L 1EF9A 3FDTA 4YHHL 5C4JH 1Q8IA 3H81A 3K81C 3Q6SA 3TRRA 3CCJA 1XPOA 2KCTA 2I5MX 2F0QA 3ER0A 3E5SA 2D5DA 2EXZA 2WB1G 3RN2A 3CPFA 4DN4M 3S16B 2PQAA 1ZXTA 1B3QA 3SR1A 4J15A 4BY1H 2MUYA 4L5TA 2DGYA 5M5YH 1W2BA 2WACA 4UAIA 3VA7A 3Q0AA 1NJIC 5IP9H 3A55A 2IHEA 2N55A 3E3XA 3FVQA 2B8FA 5LMUQ 2EJFC 4B9WA 2QQ3A 3FKIH 3PO2G 4JI4Q 3GTGH 1ESRA 1FR3A 4LF6Q 1J8IA 3FHWA 3U9SA 4JFCA 2NVXH 1N9WA 3QWNA 3W5OA 4BA2I 1HNWL 4CKBA 3PF4A 1O7LA 3HOZG 2CWAA 2OTJA 3BU2A 1CT1D 5GAHC 4BBRB 1N34L 1K3RA 3HOUH 4KJOA 1CK1A 4KY6A 4JWVA 3RLOA 4BS9A 3R8BA 2UXDL 3ULLA 4FP5D 3O4XE 4WJWA 3TMEA 4A3IB 3I55A 4XQQA 1CFMA 1SMYC 2DUDA 4LMQD 1TWAB 2EYLA 4FDBA 4G4KA 1UE1A 4YY3L 4B3ML 2MO1A 1EFID 1I3QH 3NP8A 1JWSD 1LTID 5M5WH 3QIAA 3MEHA 1WTPA 4MTKA 3GTOB 1U4PA 4LF7Q 2I5LX 3PO3G 2EXDA 1JORA 3EROA 4N8X1 1JCKB 4NXMQ 3F2UA 2RHSB 2K5WA 1PH9A 2SEBD 1DZ1A 4B3RL 3L7ZC 5A2QL 1CI3M 4LW1A 5C3WA 5H1SE 2OF1A 2R7ZG 4HSPA 5EPKA 4F88A 1H9KA 1ESFA 3MOYA 5J39A 1NNXA 4EQNA 3T13A 4IUPA 4AQYL 4FF2A 4DV1L 3CCMA 3W8IB 2B2UC 2LXJA 4X62Q 5CC4A 3H6MA 1JOKA 3TS0A 3AYHB 4ZAIA 4C2MH 4DK3C 5D14A 1D2BA 2XSCA 4JI2L 1IW7C 4ULLA 3MEFA 4DR2L 2FHTA 1A2TA 3KDFA 3NXWA 4BY1G 4X66Q 3M4OH 1PRTD 4JW0A 2VUMG 3A8JE 4RMFA 1SSOA 4TQUS 2VW9A 4I42A 1D6EC 1PH2A 3WDNA 1KIXA 1AP0A 1TS4A 2Y0SE 1BQQT 4DGZA 2MO0A 4EQ5A 4EGVA 1ET9A 3FPUB 3R9SA 1UIYA 4X6AH 1QOHA 3M4YA 1LT6D 1VQGA 4QGUA 3L0OA 1Q51A 5CBAE 1Z6HA 1YNJC 4ZK9B 4HMIA 4O1NA 2YTVA 3G7LA 2K5DA 2FMMA 1DM0B 3OW7A 5LMNL 1D7QA 1SMXA 1V43A 5FKAC 4GKJQ 3CC7A 1EQVA 3RLFA 2VZAA 3KFUA 1EIGA 2CW0C 1E2WA 4H02A 1PZKD 2K1BA 1FL0A 2B2TC 1QWYA 1JJ2A 2KVMA 2Z4HA 2ZQRA 1L0YB 4RAUC 5KIXA 4DUYL 3RQFA 5C44H 3L8JA 1ENAA 1Q12A 1HXYD 1GOZA 4DR7L 3K5NA 1L1OB 1VQOA 4POGA 4OX9L 1NTGA 4HTHA 1AZQA 4WCZA 4DR3Q 2Z6BA 4KHZA 3GTQH 1HA6A 1PH1A 2JE6I 4CDCC 5C0XH 4K6DA 2NVQB 2FMCA 4GOPB 2CWPA 3A54A 2JA8H 3ADBA 2F0IA 3I73A 1EUJA 5G3LF 3S2DB 3BVMA 1SMYD 3KYHC 3FP9A 2LSSA 2A68C 4HJ9A 4QCLA 5M3MB 2KEEA 1HUMA 2NB0A 3ND8A 5IYCH 4RKBA 1TVXA 2YV5A 1A15A 3D31A 4JV5L 5IGDA 3RQEA 1TWGH 4OWWB 2AWOA 4O0AA 4F47A 1SAPA 4ZQ3A 1E2ZA 1WTRA 3F2BA 1V1PB 5I9PA 3PUYA 2D0OA 4C3JB 3WWVA 3SVMA 1FJGQ 2GN5A 4DAYB 1RJNA 1EEFD 5LL6X 3J80i 1KHIA 1E1TA 1LTLA 3W1GA 2UXBQ 3CC2A 3PIPA 1LTSD 4DA2A 1LT5D 2Q2TA 1NBWA 1B2TA 1K8MA 2OQ0A 3K7UC 1SXTA 4LFAQ 2A5HA 4KY5A 1WJJA 2L0CA 3HRZC 5HGTA 4DR6L 1HZAA 3SE0A 3I7FA 4RGMA 3TZUA 1IBML 1WD0A 4I4ZA 4X3UA 4E6IA 3HKZB 2A6HC 4JBMA 2WKCA 5CV9A 4ABNA 2F0WA 3A7AB 5CV7A 4POFA 2GA4B 1Y1VG 2HDMA 4Q5VA 2PZUA 5G3LD 4KNPA 4LF8L 4Y7NB 4ALPA 1CSPA 1CA6A 1N33Q 5EPLA 4R4IA 1RIPA 2N8NA 5HURA 1KLUD 2NWGA 2NN6G 3H94A 1FGUA 2Q8IB 1Y1WB 3D4WA 3A0JA 3K59A 1SNPA 1XMOL 1RJMA 3ERSX 4R4QA 5C44G 3A8IE 3S9WA 2JEAI 1F2MA 4B9XA 2JEBI 2K5NA 2ZJRA 3GTJB 2PBPA 3CCLA 4YIJA 1CM9A 5EKIA 3A8KE 5JBXA 3SXHA 1WTQA 4DR4L 3MYBA 2K03A 1BR9A 3CF5A 2CW0D 3HOXG 5C0XG 1QNUA 4APVA 3L2PA 2N49A 2JA8G 3KF8A 2JSOA 2Z1CA 4A3IH 3PIO3 1SEBD 3G4SA 1RD9D 2RHQB 2K01A 2PNHA 2F0SA 3C46A 4N8FA 5C3EB 3A56A 2G9HD 4S3SA 4LF5L 3GTOH 3QOLA 5IGFA 4DV6Q 4CBVA 1KNAA 2P63A 1KC8C 4OO1H 4DK1A 4IPCA 2A68D 1UUPA 1LTRD 1MIUA 1EQTA 4YCWA 3S1QB 3SGIA 2Q8RE 1NSNS 4YWKA 2IEXA 4A3MB 1VQ7A 3UE1A 2BA1A 3RUZA 4LJZC 2AHOB 1Q86C 4HIKA 4K8JA 2L9HA 2MPMA 3NK9A 5JBWA 3GTMB 2PQAB 2VL6A 1S5CD 2DY7A 3DMUA 3GDEA 2LXKA 1SYFA 2J4XA 4JI0L 2ALYB 1FVIA 2AMCB 4DV7Q 4HJAA 1IYJB 2KJXA 5CGKA 1PTOF 4JI5L 5KNCA 3CCQA 1PZJD 3VR6A 1HTPA 4KD4A 3S2HB 4LFBL 2F0EA 4K3WA 2UUCL 1V1OA 1NZYA 2EJ5A 3K57A 2M9VA 1PH6A 1NR2A 3SEBA 2J0TD 5AFWA 3BG3A 3U50C 2EZVA 5KRUA 4LF6L 4IQZA 2H4OA 4RKLA 1BOSA 1SROA 1F77A 1XX8A 1JICA 3TP8A 2TMPA 4I7ZC 5EKKA 3CCUA 3PZKA 1SNDA 5IGBA 4LF9L 2B8GA 2NTSA 2N3SA 5EAYA 4AH6A 3VYTA 1KLGD 2I0QA 3NTKA 2L15A 1K9MC 2FINB 4OO1I 4BBRG 5JJZA 1K73C 2PI2E 3EJIA 2XWBB 4B3TL 1X32A 1FGBD 2ZXPA 3KLSX 1Y69U 2L11A 5C5LA 4A3LH 2B2VC 2F0FA 2BDOA 4QJFA 4RWSC 3TP5A 4MI2A 3I91A 5E1FA 4XIGS 1LT4D 2SOBA 2FW2A 1IBLL 3HGBA 2RDFA 2PPBC 3X3MA 2HCIA 1OXVA 3OIPA 5JJLA 4GLAC 1MI2A 2E8GA 4A3JG 1K8GA 1A8VA 1O7IA 2JN4A 3KF6B 3CQZB 5JVG3 5AJ3Q 5ELCA 3SK6A 3CMEA 5KNDA 4HN7A 4PZ7A 4HCSA 1IBKQ 2NVQH 3SDZA 4JOTA 4V0BA 4TSSA 1SJHD 4GS3A 3KBGA 1KL9A 3J81i 1XNQQ 2UUAQ 5DAUA 1RODA 1XJVA 5IP7H 2EY2A 5FLXL 4OGQC 2L4NA 4RHSA 3B6YA 3ERQA 1K0SA 2O4XA 4X64Q 1E7ZA 5FLMH 2BDNA 2R7DA 4CDFC 4EMLA 2MQHA 1ENCA 4WJ3M 1VMCA 3A7LA 1MJEA 3IFDA 4A93B 2K28A 1MKHA 4JCVE 1HNZQ 3A5ZB 4AYBE 1G291 2B2YA 3KDFB 4KK7A 3ULPA 1WOCA 5CV6A 4C3JH 2R93G 4IJLA 4NP5A 1XNRL 4UHVA 3U4VA 3M4QA 3MFGA 1AZPA 3S1RB 1QCBD 1VQ4A 2E5LQ 1TS3A 4LF4Q 1DOMA 3FPPA 3BJUA 3D6WA 4OIKA 1VQJA 2B2WC 2E76C 1KRTA 1KABA 1ZYRC 3VR3A 4FF4A 1IKLA 3S15B 1F2YA 1PH3A 2R61A 3I4OA 4YCUA 1WVLA 1JE4A 4DV4Q 4A3FG 1JOOA 4GKKL 2NTTA 1L0XB 2F0JA 4GNXB 3OTOQ 3LX0A 3PF5A 4OWXB 2QEXA 2K52A 4H44C 1GM5A 2V4DA 4IUQA 1V8QA 5T1IA 5FK9C 4XDXA 1PLFA 2YU9B 4Y7NH 1S72A 2E75C 4P73A 1KTKA 3G71A 1SE3A 1TXYA 3BDCA 4RGNA 3RZOB 2KEDA 4K14A 1YNND 1EZ6A 1IXRA 1Y1WH 5GAEC 2UU9Q 1D5MC 4X3KA 3PO2H 3K58A 4KI0A 4H0LC 1RKNA 5DLQE 2JA7G 3GTJH 1EOVA 4KKSA 1WZ8A 1I4PA 4DR5L 4KY7A 4NW2A 5JEAG 1N32L 1N36L 4IPHA 5I9OA 2F4VQ 2MFIA 3HOZH 2HIXA 1UX4A 4HJ5A 3I4MG 1NMGA 1HR0L 1OXUA 2AWNA 4DNTB 3QXIA 3T1HL 5M3MG 4IZBA 4O42A 4IALA 3K5LA 4MOUA 2B39A 1SR3A 5FJ8G 4DV5L 1VMPA 3K0YA 1S5BD 3DHQA 3ZYYX 4FVMA 1K3BC 5LHY1 4DAMA 4B3SQ 1AN8A 4JI8L 2F1MA 4CJ0B 2ICEC 3QR8A 1YVCA 2XWJB 4X65Q 1FJGL 3AFPA 4DR1Q 2L5TA 4C3JG 4IFDI 2Q8TA 4ZKBB 4JI7Q 3NBHB 2VQEQ 1TKWB 3H3VH 3S1QH 1HNXQ 1E2VA 4A3MH 2DNCA 1DUBA 5EQ0A 2LMCB 3P75A 1RTNA 4X3SA 3SK5A 4G7ZC 5ELOA 4B08A 4A4IA 5JAVA 1CZGA 1I50H 2K50A 3GTMH 1GHJA 3NQIA 4BA1I 4GNXC 3S17B 1FNUA 3CCEA 2A8VA 1BUVT 1QB5D 1STHA 3NBIA 1TWCB 3HKZG 1M8AA 3F2DA 3A4NA 3T53B 3VDYA 2QKIC 2HQEA 2X6LA 4QIWE 1N33L 1SN8A 1VQIA 5D65A 2K4KA 2F3VA 2BH2A 5C3XA 3TBIB 1ZEQX 1VCIA 2WINB 3K7AB 2VUMH 1DYQA 3MFYA 4RCNA 3GTLH 1OXTA 4OHJA 1JJCB 1Y1WG 3CXCA 3J7AV 2Z0SA 3A5UA 2RCNA 1XPRA 1B50A 3CCSA 2PPYA 1STGA 1ASYA 5BN3A 1EL0A 5C4XB 2JA5G 2UUBQ 4KD3A 5IWAQ 4L5RC 4FJWD 2KENA 3I2ZA 3SLLA 1X3FA 2F52A 4JG2A 4IO9A 1ET6A 3W1BA 3LGJA 2JYOA 2QA4A 5ISRA 4BWGB 2C9OA 3K5OA 2VQFQ 1PRTF 4ZRZA 4JYAQ 1CHQD 5BN4A 1BCPF 2XN9C 3UE0A 5C3EG 5EBDA 3S1NB 2PMZE 2ES2A 4A3GB 3CQZH 3Q8DA 2FJ2A 1AEXA 3LWEA 3RQGA 4A3JB 3M3YB 3Q22A 1TS2A 1L2FA 1EQQA 1F9QA 4J6HA 1A63A 4FZWC 4L5SA 3CC4A 5JEAJ 1JT8A 3CHBD 4CHTB 1HFNA 2EPBA 1F9PA 4IUTA 3TP6A 4A3MG 4EQPA 3JC66 2HW5A 4CDDC 2KQ3A 1YJ9A 4OWTB 4HJ8A 3GO5A 3GP7A 4I65A 2OQKA 3I4NB 1PV4A 2CQOA 1Q81C 5A35A 1NAPA 2ZXOA 4XXEA 2NVYB 1CQVA 1K83B 3L9AX 3I90A 4R4CA 1QUQA 4LNQA 5LL6S 4U68A 1IHZA 4HMJA 2LS01 1NZYB 4H13C 1JB7A 4KHPL 3NWSA 3T8AA 5C5MA 3S1RH 1EIHA 5I2YA 5IIFA 3NPPA 1B70B 2R93B 2N88A 4KJNA 1YHAA 2KECA 4K0KQ 1LYLA 2XNAC 1V1QA 4R4TA 5E4XA 3H91A 1BCPD 2Q2HA 2XRSD 3TN2A 5CMDA 1CKNB 2F0VA 4QQBX 5J3BA 5GADC 1A3UA 3D8GA 4DK6C 4A3CG 3HOVB 2B63B 4A3FB 4G7OC 2Z8LA 3HZXA 3J7ZC 3G64A 2E2JB 5K36H 1ZKOA 1Y1VH 4A3KB 3WOEA 3J7YW 3DWAA 1VF5C 1FNVA 2Z6KC 4RG1A 4NMZA 3V96A 2D0PA 5A2QE 2CVRA 3V2TA 1O7YA 1P16A 2RSOA 4JI1Q 2F0LA 2MHVA 1NUCA 4IURA 3P5MA 2NN6H 1HZCA 1UE5A 1CZWA 1EWCA 1SYCA 1CTMA 3KJPA 2JA7B 1QVCA 3MXNA 3UDIA 1LTBD 2L55A 3OPOA 4G57A 3I72A 4DUZL 4QUCA 1BVSA 2D9UA 2EDGA 2OCEA 5IT9c 4DV0Q 3HOXH 3J81j 1T5XD 4GLVB 4L5QA 3ITPA 3I4MB 3HOWB 2MGSA 1DONA 1HNZL 3H0GB 3Q1TA 1W6KA 3IFTA 5TSSA 4A93G 1VQFA 4DV2Q 3Q0JA 3DEOA 5JPNC 2H1EA 2PI2A 1YNXA 4WORA 4TVAB 4HIMA 1XPUA 1AFPA 3EN2A 1B9MA 2KHSA 4PZ6A 4R8IA 1STAA 1BO0A 1VQNA 5C9GA 2L12A 2YTXA 3UDGA 4LFCQ 2I07B 2HHHQ 2HQLA 3BVZA 1PTOB 3RZDB 1PH5A 2DJFC 3OSOA 3AJMA 1DGSA 1F9SA 1T9HA 1WCMG 3S1MB 1S5ED 1LTTD 1K8OA 1PFNA 4C3IG 3AU7A 3M7NA 5KYLA 2JK8A 3T1YQ 4HJ7A 1VS0A 3RN5A 2VNUD 1FYCA 1WD1A 1I4RA 4UDUC 3DLLA 4RGOS 1SLJA 3STBC 1QNKA 3C1EA 2F0MA 1IL8A 3NHHA 1U4RA 2AQ2B 2IHFA 3W3AA
chains in the Genus database with same CATH topology
2L15A 3E0EA 1K9MC 4OO1I 2F3IA 4BBRG 4DV3L 3S16H 4P74A 2PI2E 1K73C 4B3TL 4A3DG 2GVAA 4JI3Q 1L0WA 5K36G 3KF6A 5IP7G 1LUZA 2XTIA 3K7AH 4A3LH 3BZCA 3W8HB 1UE7A 5C0XI 4QJFA 2UXCQ 1WCMH 1Z47A 4YWMA 3T1YL 1VQAA 5FLMG 3KOJA 4XIGS 1M90C 1XTDA 5IYBH 1IBLL 3S15H 4C3IH 3KLWA 5BR8Q 3RR5A 4A3BG 1OXVA 3BZKA 5JJLA 2KCMA 1Q1BA 4GLAC 2E8GA 3RLNA 3PUVA 4AIMA 4A3JG 5HY6A 1K8GA 3E9IA 1J5EL 4YHHQ 1A8VA 1VQLA 1O7IA 3KF6B 1L1OC 4BBSH 2IX0A 3HKZE 5AJ3Q 2ZM6Q 1HR0W 3CMEA 1XMQQ 1CKMA 1IL2A 3GTKH 1PYBA 2WP8J 4JI3L 1X9NA 3PO3H 1UEBA 1NY4A 4PZ7A 4BY7H 1IBKQ 4UP9A 2NVQH 2WB1E 2I5HA 2VY3A 4GS3A 3RNUA 1KL9A 1TWFH 3J81i 4BBRH 3CMAA 2UUAQ 4NXNQ 1XNQQ 4GOPC 4A3DH 1XNRQ 2YU9H 1XJVA 5IP7H 5GQOA 1B8AA 1QVFA 1GO3E 3ZJYC 1NMFA 5BR8L 3RZOH 3B6YA 5IP9G 1TWHH 1PYSB 2R7ZH 4X64Q 1E7ZA 5FLMH 2YTYA 2R7DA 2ZTEA 4JI6L 2MQHA 4WJ3M 3FKIG 1D8LA 1TWAH 1MJEA 1PH8A 3M9BA 1I94L 2K75A 5ELNA 3NEMA 3J80c 4A3BH 4YHHL 5C4JH 1MKHA 3HKSA 4JCVE 1HNZQ 3A5ZB 3K81C 3F1ZA 4AYBE 5GAGC 5AJ3L 2ZM6L 1G291 1R9TH 1XMQL 2B3GA 4A3JH 2VS1A 3CCJA 1VQ8A 1KXLA 1QVGA 1IBKL 3KDFB 3ULPA 1XPOA 2KCTA 4GKKQ 2I5MX 1N32L 1WOCA 3ER0A 2R6GA 4NXNL 1XNQL 1PFSA 2R93G 4C3JH 2UUAL 4IJLA 4IFDJ 2WB1G 1PA6A 1ASZA 3RN2A 1XNRL 1VQ9A 3CPFA 3U4VA 4JBKA 3M4QA 2PQAA 1GVPA 5FLXc 3HOUG 4GNXA 1VQ4A 2E5LQ 4LF4Q 3ICEA 1HNWQ 4J15A 4BY1H 2BA0A 4X64L 2F4VL 4L5TA 3BJUA 2DGYA 5M5YH 1W2BA 1N34Q 1OXXK 1VQJA 1NJIC 1KRTA 5IP9H 2D62A 2NVYH 2IT1A 4ME3A 2H5XA 2IHEA 2UXDQ 5LMUQ 2NZHA 1EFWA 3FKIH 1PH3A 1BBWA 3I4OA 3PO2G 4YCUA 4JI4Q 4GKKL 4DV4Q 4A3FG 3GTGH 2RF4A 5M5XH 4LF6Q 4UP8A 1SE8A 4GNXB 3FHWA 3OTOQ 4YY3Q 3K0XA 2NVXH 1N9WA 4B3MQ 5LMNW 4LUOA 3TS2A 3W5OA 4KLKA 3PF5A 4OWXB 2QEXA 2K52A 1GM5A 2E5LL 4LF4L 4BA2I 1HNWL 3PF4A 3HOZG 2CWAA 2OTJA 2AKWB 1YJWA 2A19A 4DR5Q 3BU2A 5GAHC 1N34L 1K3RA 4GN5A 3HOUH 3U4ZA 1N32Q 1N36Q 4Y7NH 3RLOA 1YJNA 1S72A 4P73A 1KRSA 2EIFA 3HFZB 3ULLA 3G71A 1QZHA 2R7FA 2UXDL 2JJQA 3O4XE 1TXYA 2YYZA 5LMUL 1HR0Q 2NVTH 2KHJA 4YCVA 3I55A 3T1HQ 4JI4L 4DV4L 1IXRA 1Y1WH 3HOYH 4B3RQ 5IYBG 2NZOA 3STBD 2DUDA 4PG3A 1E22A 5GAEC 2UU9Q 3S17H 4FDBA 3OTOL 3PO2H 1UE1A 3AQQA 4KI0A 4YY3L 2B63H 4A3FH 4DV5Q 4B3ML 2MO1A 5DLQE 2JA7G 2NN6I 1I3QH 3GTJH 2ZJPA 1EOVA 1TWCH 5M5WH 4JI8Q 4IOAA 5C4XG 2E2JH 4DR5L 4BBSG 1Y64B 3KJOA 4LF7Q 4O2DA 2KBNA 5JEAG 4AQYQ 2I5LX 1X54A 2KHIA 2EXDA 2N78A 3CAMA 4IPHA 4EX5A 2GVBA 3K80C 4DV1Q 1N36L 2MFIA 2JQOA 4NXMQ 3IRBA 4A3KH 2RHSB 4XTCS 2HIXA 2F4VQ 3HOZH 1UX4A 4HJ5A 3I4MG 1CUKA 1NMGA 1HR0L 1PH9A 1EQRA 1OXUA 1GD7A 2AWNA 3T1HL 4B3RL 3L7ZC 5M3MG 1K8AC 4JI2Q 1PVOA 4LW1A 5JJIA 5H1SE 4DR2Q 3E9HA 1SR3A 1YI2A 2UU9L 2R7ZG 5FJ8G 4DV5L 2IX1A 3PIOA 3AFQA 4A3GG 4Y52H 4DNIA 4DAMA 4B3SQ 4JI8L 2CKZB 1RL2A 4P71A 4LF7L 4JI6Q 4AQYL 4A3EH 2JA7H 1WYDA 1YVCA 4X65Q 3JAMc 3CCMA 4DV1L 1I94Q 3AFPA 4DR1Q 3W8IB 1OXSC 2LXJA 5C4XH 4X62Q 2MNAA 4IFDI 3TS0A 4OXPA 4JI7Q 4IPDA 3AYHB 3NBHB 2VQEQ 3H3VH 4C2MH 4DK3C 3D0FA 1HNXQ 3S1QH 4JI2L 1BBUA 4A3MH 1BKBA 1AE3A 4C3HH 1VQMA 3MEFA 1Y14B 4DR2L 3HOWH 3I4MH 3KDFA 3H0GH 4BY1G 4X66Q 1QUQB 3I4NG 3M4OH 3S2DH 2VUMG 4RMFA 5IE8A 3CPWA 5M3MH 4TQUS 5GROA 2VW9A 5LMNQ 1Q7YC 5ELOA 2C35B 4A4IA 1PH2A 4B3SL 1KIXA 1I50H 2K50A 3PGZA 3GTMH 2Y0SE 5FJ8H 4EQ5A 2MO0A 3S1NH 4BA1I 1VQHA 3G6EA 1KD1C 1VQ5A 4A3GH 4GNXC 4X65L 2A8VA 3CCEA 4X6AH 4LWCA 4DR1L 4X62L 2WAQE 4MZ9A 1VQGA 3TREA 1SRUA 4QGUA 3L0OA 2V1CC 1IZ6A 4DUYQ 4JI7L 2VQEL 3M3YH 3HKZG 1HNXL 3F2DA 3A4NA 1YIJA 1WI5A 3U58A 3VDYA 3RZDH 2YTVA 4X66L 4DR7Q 3M4PA 4OX9Q 3S1MH 4QIWE 1N33L 1SN8A 1VQIA 2K4KA 2BH2A 5LMNL 1D7QA 1L1OA 4NPSA 1SMXA 1V43A 4GKJQ 3CC7A 1VCIA 2VZAA 3RLFA 3I4NH 3KFUA 1Q1EA 2VUMH 2A1AA 5IYCG 4H02A 3GTLH 2R92H 1OXTA 4GOPA 3L8IA 1FL0A 1JJCB 1JJ2A 1Y1WG 3HOYG 3A74A 1K83H 3CXCA 2Z0SA 2ZTCA 2RCNA 3A5UA 1XPRA 1HH2P 4DUYL 2WAQG 1HZ9A 3RQFA 4AYBG 5C44H 3L8JA 3CCSA 2Q2UA 3HOVG 2B63G 3J7A5 2R93H 1Q12A 3ADCA 2Z6KA 1KQSA 1M1KC 4JV5Q 1ASYA 3I56A 3F2CA 4DR7L 1L1OB 1VQOA 4POGA 1B7YB 1NTGA 4OX9L 1JMCA 2JA5G 2UUBQ 4JOIC 4DR3Q 3UDXA 5IWAQ 4KHZA 1P8LA 4L5RC 3GTQH 1PH1A 2JE6I 4GKJL 1EYGA 2KENA 3I2ZA 2F52A 1E24A 1X3FA 4JG2A 4A3KG 1UE6A 4IO9A 4GOPB 2CWPA 3OYYA 2JA8H 3W1BA 4YWLA 3LGJA 4P72A 1A62A 3ADBA 4NNQA 1EUJA 2QA4A 1Q46A 1VQEA 1A0IA 2WFWA 3FP9A 2LSSA 3KYHC 4DPGA 3J81c 4HJ9A 2VQFQ 5IYCH 1MJCA 2OWOA 4MNOA 1EIFA 4JYAQ 2YV5A 1X56A 3MXNB 3UE0A 5C3EG 3D31A 4JV5L 3RQEA 1TWGH 2XGTA 2PMZE 2ES2A 4OWWB 3PCOB 3CQZH 4OONA 2UXCL 2AWOA 4O0AA 3Q8DA 3HOVH 2UUBL 1UX5A 5IY0A 4DR3L 3DM3A 1WFQA 5IWAL 4A3EG 4BXXG 3RQGA 4UY8C 4DR6Q 3F2BA 4GN4B 3CD6A 2OTLA 1IBMQ 1L2FA 3PUYA 2JA5H 2K5VA 2D0OA 1EQQA 4JBJA 4JYAL 1A63A 4KHPQ 3WWVA 4L5SA 3CC4A 5JEAJ 1JT8A 1JJGA 1CKOA 1FJGQ 5HGQA 2GN5A 4DAYB 4A3MG 3JC66 2VQFL 3HOWG 2QGQA 3J80i 1KHIA 1E1TA 1LTLA 1YZ6A 3H0GG 4OWTB 3GO5A 3W1GA 4HJ8A 3TEHB 3PIPA 1G51A 2OQKA 3A4MA 3CCVA 1PV4A 2E2IH 4NB3A 2Q2TA 2JA9A 1NBWA 2JA6H 2OQ0A 2CQOA 3CW2C 3K7UC 1Q81C 4LF8Q 1YBYA 3PUXA 4LFAQ 5C3EH 1WJJA 2HT1A 4R4CA 1QUQA 3ULJA 1PH7A 4LNQA 4A76A 4DR6L 1HZAA 4R1JA 1YEZA 2IY5B 3I7FA 1IBML 2B29A 4JC0A 2BH8A 1HJPA 1JB7A 1CKNA 1XMOQ 4KHPL 1X55A 3PV0A 4BXXH 1YJ9A 2HIVA 1QZGA 4IJHA 4DKAC 3S1RH 4GN3B 4JBMA 3PUWA 1CSQA 1B70B 4GLXA 2FXQA 2UXBL 2ZTDA 4POFA 1Y1VG 1YHAA 3NELA 4DR4Q 2EQSA 4A3IG 1LYLA 1E3PA 3EIVA 3NENA 4K0KQ 1S3OA 4HIDA 3PUZA 4LF8L 1V1QA 4R4TA 3K8AA 4LFAL 4ALPA 4IOCA 1CSPA 4UP7A 1N33Q 5IYDH 4R4IA 1RIPA 2N8NA 2Q2HA 2R92G 1Q8KA 1CKNB 1FJGL 2NN6G 1FGUA 3A0JA 4QQBX 4LUZA 5J3BA 5GADC 1XMOL 3EBEA 1VQ6A 1AH9A 1RJMA 3ERSX 4R4QA 4DK6C 3AM1A 5C44G 1U0LA 1J6QA 4PZ8A 4A3CG 2JEAI 2JEBI 2K5NA 2ZJRA 4LF5Q 1LM0A 4OO1G 3CCLA 3J7ZC 2ID0A 4DR4L 4K0KL 1VQBA 3G48A 1C9OA 2Q2IA 3CF5A 3S2HH 2UXBQ 3HOXG 5C0XG 4APVA 4PMWA 5JJKA 2K14A 3L2PA 1Y1VH 2N49A 5C0XJ 2JA8G 4A3IH 2Z6KC 5E7NA 1H95A 4RG1A 4DUZQ 1SFOH 1W3SA 3G4SA 1X3EA 2D0PA 2RHQB 4A75A 1U5KA 1S40A 1VQDA 1P16A 2PNHA 4JI1Q 2Y0SG 4JBWA 3PSIA 3CP0A 1N8RC 1HZCA 1UE5A 4LF5L 4IFDG 3GTOH 1YHBA 4DV6Q 1JE5A 4A3CH 1K0RA 3KJPA 3KF8B 2P63A 3F8TA 1QVCA 3GTPH 1KAWA 3TQYA 3UDIA 3CCRA 1KC8C 1EWIA 4JI0Q 5M3FG 2ATWA 4DUZL 4IPCA 1BVSA 1HZBA 2OCEA 1MIUA 1I5FA 4YCWA 5IT9c 3HOXH 4DV0Q 1YITA 3SGIA 4JI5Q 3H3VI 3PO3G 4YWKA 3J81j 4WJ4A 4GLVB 4L5QA 1VQ7A 4JI1L 3UE1A 1HNZL 4LFBQ 2BA1A 2UUCQ 2AHOB 4A93G 1VQFA 4DV2Q 2JA6G 3JAMi 3A4LA 1Q86C 1OTCA 4NXML 2PI2A 3UDFA 4P75A 4DV6L 1YNXA 4HIKA 2CCZA 4LUVA 1G6PA 2PQAB 2VL6A 1Z9FA 1X6OA 4TVAB 4HIMA 1XPUA 1UWVA 1E1OA 3EN2A 1C0AA 1Q82C 4QL5A 3GDEA 4PZ6A 2LXKA 4HIOA 4JI0L 1VQNA 3ADDA 2ALYB 1I6HH 2YTXA 1FVIA 2AMCB 4DV7Q 3CC2A 4HJAA 1IYJB 3UDGA 4MTNA 1PH4A 1C7YA 4LFCQ 4DV0L 1GKHA 2HHHQ 3S14H 2HQLA 1X3GA 4JI5L 4LF9Q 5M3FH 3CCQA 1AE2A 1YHQA 1PH5A 4IPGA 3S24A 2E2HH 4A3LG 4LFBL 3AJMA 1DGSA 1T9HA 1WCMG 4DV3Q 1X65A 2UUCL 1V9PA 3H15A 4B3TQ 3M85A 4DV2L 4JOIA 1PH6A 4QY7A 3AEVA 3U50C 4LF6L 3M7NA 5IYDG 2JK8A 3T1YQ 1PHJA 3GD7A 4HJ7A 1VS0A 4A93H 3RN5A 2VNUD 4GEHB 1SROA 4R4OA 1IBLQ 1EIYB 3DLLA 2ZJQA 1SLJA 1VQKA 4DV7L 3STBC 1VQPA 3CCUA 4LFCL 4UPAA 2ASBA 2HHHL 4LF9L 2IHFA 3TRZA 3OW2A 2N3SA 5EAYA 4BY7G 2K5HA 1VQCA 4AH6A 2I0QA 2CFMA 1NE3A 1J5EQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L15 A;  3E0E A;  1K9M C;  4OO1 I;  2F3I A;  4BBR G;  4DV3 L;  3S16 H;  4P74 A;  2PI2 E;  1K73 C;  4B3T L;  4A3D G;  2GVA A;  4JI3 Q;  1L0W A;  5K36 G;  3KF6 A;  5IP7 G;  1LUZ A;  2XTI A;  3K7A H;  4A3L H;  3BZC A;  1UE7 A;  2UXC Q;  5C0X I;  4QJF A;  1WCM H;  1Z47 A;  4YWM A;  3T1Y L;  1VQA A;  5FLM G;  3KOJ A;  4XIG S;  1M90 C;  1XTD A;  5IYB H;  1IBL L;  3S15 H;  4C3I H;  3KLW A;  5BR8 Q;  3RR5 A;  4A3B G;  1OXV A;  3BZK A;  5JJL A;  2KCM A;  1Q1B A;  4GLA C;  2E8G A;  3RLN A;  3PUV A;  4AIM A;  4A3J G;  5HY6 A;  1K8G A;  3E9I A;  1J5E L;  4YHH Q;  1A8V A;  1VQL A;  1O7I A;  3KF6 B;  1L1O C;  4BBS H;  2IX0 A;  3HKZ E;  5AJ3 Q;  2ZM6 Q;  1HR0 W;  3CME A;  1XMQ Q;  1CKM A;  1IL2 A;  3GTK H;  1PYB A;  2WP8 J;  4JI3 L;  1X9N A;  3PO3 H;  1UEB A;  1NY4 A;  4PZ7 A;  4BY7 H;  1IBK Q;  4UP9 A;  2NVQ H;  2WB1 E;  2I5H A;  2VY3 A;  4GS3 A;  3RNU A;  1KL9 A;  1TWF H;  3J81 i;  4BBR H;  3CMA A;  2UUA Q;  4NXN Q;  1XNQ Q;  4GOP C;  4A3D H;  1XNR Q;  2YU9 H;  1XJV A;  5IP7 H;  5GQO A;  1B8A A;  1QVF A;  1GO3 E;  3ZJY C;  1NMF A;  5BR8 L;  3RZO H;  3B6Y A;  5IP9 G;  1TWH H;  1PYS B;  2R7Z H;  4X64 Q;  1E7Z A;  5FLM H;  2YTY A;  2R7D A;  2ZTE A;  4JI6 L;  2MQH A;  4WJ3 M;  3FKI G;  1D8L A;  1TWA H;  1MJE A;  1PH8 A;  3M9B A;  1I94 L;  2K75 A;  5ELN A;  3NEM A;  3J80 c;  4A3B H;  4YHH L;  5C4J H;  1MKH A;  3HKS A;  4JCV E;  1HNZ Q;  3A5Z B;  3K81 C;  3F1Z A;  4AYB E;  5GAG C;  5AJ3 L;  2ZM6 L;  1G29 1;  1R9T H;  1XMQ L;  2B3G A;  4A3J H;  2VS1 A;  3CCJ A;  1VQ8 A;  1KXL A;  1QVG A;  1IBK L;  3KDF B;  3ULP A;  1XPO A;  2KCT A;  4GKK Q;  2I5M X;  1N32 L;  1WOC A;  3ER0 A;  2R6G A;  4NXN L;  1XNQ L;  1PFS A;  2R93 G;  4C3J H;  2UUA L;  4IJL A;  4IFD J;  2WB1 G;  1PA6 A;  1ASZ A;  3RN2 A;  1XNR L;  1VQ9 A;  3CPF A;  3U4V A;  4JBK A;  3M4Q A;  2PQA A;  1GVP A;  5FLX c;  3HOU G;  4GNX A;  1VQ4 A;  2E5L Q;  4LF4 Q;  3ICE A;  1HNW Q;  4J15 A;  4BY1 H;  2BA0 A;  4X64 L;  2F4V L;  4L5T A;  3BJU A;  2DGY A;  5M5Y H;  1W2B A;  1N34 Q;  1OXX K;  1VQJ A;  1NJI C;  1KRT A;  5IP9 H;  2D62 A;  2NVY H;  2IT1 A;  4ME3 A;  2H5X A;  2IHE A;  2UXD Q;  5LMU Q;  2NZH A;  1EFW A;  3FKI H;  1PH3 A;  1BBW A;  3I4O A;  3PO2 G;  4YCU A;  4JI4 Q;  4GKK L;  4DV4 Q;  4A3F G;  3GTG H;  2RF4 A;  5M5X H;  4LF6 Q;  4UP8 A;  1SE8 A;  4GNX B;  3FHW A;  3OTO Q;  4YY3 Q;  3K0X A;  2NVX H;  1N9W A;  4B3M Q;  5LMN W;  4LUO A;  3TS2 A;  3W5O A;  4KLK A;  3PF5 A;  4OWX B;  2QEX A;  2K52 A;  1GM5 A;  2E5L L;  4LF4 L;  4BA2 I;  1HNW L;  3PF4 A;  3HOZ G;  2CWA A;  2OTJ A;  2AKW B;  1YJW A;  2A19 A;  4DR5 Q;  3BU2 A;  5GAH C;  1N34 L;  1K3R A;  4GN5 A;  3HOU H;  3U4Z A;  1N32 Q;  1N36 Q;  4Y7N H;  3RLO A;  1YJN A;  1S72 A;  4P73 A;  1KRS A;  2EIF A;  3HFZ B;  3ULL A;  3G71 A;  1QZH A;  2R7F A;  2UXD L;  2JJQ A;  2YYZ A;  1TXY A;  5LMU L;  1HR0 Q;  2NVT H;  2KHJ A;  4YCV A;  3I55 A;  3T1H Q;  4JI4 L;  4DV4 L;  1IXR A;  1Y1W H;  3HOY H;  4B3R Q;  5IYB G;  2NZO A;  3STB D;  2DUD A;  4PG3 A;  1E22 A;  5GAE C;  2UU9 Q;  3S17 H;  4FDB A;  3OTO L;  3PO2 H;  1UE1 A;  3AQQ A;  4KI0 A;  4YY3 L;  2B63 H;  4A3F H;  4DV5 Q;  4B3M L;  2MO1 A;  5DLQ E;  2JA7 G;  2NN6 I;  1I3Q H;  3GTJ H;  2ZJP A;  1EOV A;  1TWC H;  5M5W H;  4JI8 Q;  4IOA A;  5C4X G;  2E2J H;  4DR5 L;  4BBS G;  3KJO A;  4LF7 Q;  4O2D A;  2KBN A;  5JEA G;  4AQY Q;  2I5L X;  1X54 A;  2KHI A;  2EXD A;  2N78 A;  3CAM A;  4IPH A;  4EX5 A;  2GVB A;  3K80 C;  4DV1 Q;  1N36 L;  2MFI A;  2JQO A;  4NXM Q;  3IRB A;  4A3K H;  2RHS B;  4XTC S;  2HIX A;  2F4V Q;  3HOZ H;  4HJ5 A;  3I4M G;  1CUK A;  1NMG A;  1HR0 L;  1PH9 A;  1EQR A;  1OXU A;  1GD7 A;  2AWN A;  3T1H L;  4B3R L;  3L7Z C;  5M3M G;  1K8A C;  4JI2 Q;  1PVO A;  4LW1 A;  5JJI A;  5H1S E;  4DR2 Q;  3E9H A;  1SR3 A;  1YI2 A;  2UU9 L;  2R7Z G;  5FJ8 G;  4DV5 L;  2IX1 A;  3PIO A;  3AFQ A;  4A3G G;  4Y52 H;  4DNI A;  4DAM A;  4B3S Q;  4JI8 L;  2CKZ B;  1RL2 A;  4P71 A;  4LF7 L;  4JI6 Q;  4AQY L;  4A3E H;  2JA7 H;  1WYD A;  1YVC A;  4X65 Q;  3JAM c;  3CCM A;  4DV1 L;  1I94 Q;  3AFP A;  4DR1 Q;  2LXJ A;  1OXS C;  5C4X H;  4X62 Q;  2MNA A;  4IFD I;  3TS0 A;  4OXP A;  4JI7 Q;  4IPD A;  3AYH B;  3NBH B;  2VQE Q;  3H3V H;  4C2M H;  4DK3 C;  3D0F A;  1HNX Q;  3S1Q H;  4JI2 L;  1BBU A;  4A3M H;  1BKB A;  1AE3 A;  4C3H H;  1VQM A;  3MEF A;  1Y14 B;  4DR2 L;  3HOW H;  3I4M H;  3KDF A;  3H0G H;  4BY1 G;  4X66 Q;  1QUQ B;  3I4N G;  3M4O H;  3S2D H;  2VUM G;  4RMF A;  5IE8 A;  3CPW A;  5M3M H;  4TQU S;  5GRO A;  2VW9 A;  5LMN Q;  1Q7Y C;  5ELO A;  2C35 B;  4A4I A;  1PH2 A;  4B3S L;  1KIX A;  1I50 H;  2K50 A;  3PGZ A;  3GTM H;  2Y0S E;  5FJ8 H;  4EQ5 A;  2MO0 A;  3S1N H;  4BA1 I;  1VQH A;  3G6E A;  1KD1 C;  1VQ5 A;  4A3G H;  4GNX C;  4X65 L;  2A8V A;  3CCE A;  4X6A H;  4LWC A;  4DR1 L;  4X62 L;  2WAQ E;  4MZ9 A;  1VQG A;  3TRE A;  1SRU A;  4QGU A;  3L0O A;  2V1C C;  1IZ6 A;  4DUY Q;  4JI7 L;  2VQE L;  3M3Y H;  3HKZ G;  1HNX L;  3F2D A;  1YIJ A;  1WI5 A;  3U58 A;  3VDY A;  3RZD H;  2YTV A;  4X66 L;  4DR7 Q;  3M4P A;  4OX9 Q;  3S1M H;  4QIW E;  1N33 L;  1SN8 A;  1VQI A;  2K4K A;  2BH2 A;  5LMN L;  1D7Q A;  1L1O A;  4NPS A;  1SMX A;  1V43 A;  4GKJ Q;  3CC7 A;  1VCI A;  2VZA A;  3RLF A;  3I4N H;  3KFU A;  1Q1E A;  2VUM H;  2A1A A;  5IYC G;  4H02 A;  3GTL H;  2R92 H;  1OXT A;  4GOP A;  1FL0 A;  1JJC B;  1JJ2 A;  1Y1W G;  3HOY G;  3A74 A;  1K83 H;  3CXC A;  2Z0S A;  2ZTC A;  2RCN A;  3A5U A;  1XPR A;  1HH2 P;  4DUY L;  2WAQ G;  1HZ9 A;  4AYB G;  5C44 H;  3CCS A;  2Q2U A;  3HOV G;  3J7A 5;  2B63 G;  2R93 H;  1Q12 A;  2Z6K A;  4JV5 Q;  1KQS A;  1M1K C;  1ASY A;  3I56 A;  3F2C A;  4DR7 L;  1L1O B;  1VQO A;  4POG A;  1B7Y B;  1NTG A;  4OX9 L;  1JMC A;  2JA5 G;  2UUB Q;  4JOI C;  4DR3 Q;  3UDX A;  5IWA Q;  4KHZ A;  1P8L A;  4L5R C;  3GTQ H;  1PH1 A;  2JE6 I;  4GKJ L;  1EYG A;  2KEN A;  3I2Z A;  2F52 A;  1E24 A;  1X3F A;  4JG2 A;  4A3K G;  1UE6 A;  4IO9 A;  4GOP B;  2CWP A;  3OYY A;  2JA8 H;  3W1B A;  4YWL A;  3LGJ A;  4P72 A;  1A62 A;  1EUJ A;  2QA4 A;  1Q46 A;  1VQE A;  1A0I A;  2WFW A;  3FP9 A;  2LSS A;  3KYH C;  4DPG A;  3J81 c;  4HJ9 A;  2VQF Q;  5IYC H;  1MJC A;  2OWO A;  4MNO A;  1EIF A;  4JYA Q;  2YV5 A;  1X56 A;  3MXN B;  3UE0 A;  5C3E G;  3D31 A;  4JV5 L;  1TWG H;  2XGT A;  2PMZ E;  2ES2 A;  4OWW B;  3PCO B;  3CQZ H;  4OON A;  2UXC L;  2AWO A;  4O0A A;  3Q8D A;  3HOV H;  2UUB L;  5IY0 A;  4DR3 L;  3DM3 A;  1WFQ A;  5IWA L;  4A3E G;  4BXX G;  4UY8 C;  4DR6 Q;  3F2B A;  4GN4 B;  3CD6 A;  2OTL A;  1IBM Q;  1L2F A;  3PUY A;  2JA5 H;  2K5V A;  2D0O A;  1EQQ A;  4JBJ A;  4JYA L;  1A63 A;  4KHP Q;  3WWV A;  4L5S A;  3CC4 A;  5JEA J;  1JT8 A;  1JJG A;  1CKO A;  1FJG Q;  5HGQ A;  2GN5 A;  4DAY B;  4A3M G;  3JC6 6;  2VQF L;  3HOW G;  2QGQ A;  3J80 i;  1KHI A;  1E1T A;  1LTL A;  1YZ6 A;  3H0G G;  4OWT B;  3GO5 A;  3W1G A;  4HJ8 A;  3TEH B;  3PIP A;  1G51 A;  2OQK A;  3CC2 A;  3CCV A;  1PV4 A;  2E2I H;  4NB3 A;  2Q2T A;  2JA9 A;  1NBW A;  2JA6 H;  2OQ0 A;  2CQO A;  3CW2 C;  3K7U C;  1Q81 C;  4LF8 Q;  1YBY A;  3PUX A;  4LFA Q;  5C3E H;  1WJJ A;  2HT1 A;  4R4C A;  1QUQ A;  3ULJ A;  1PH7 A;  4LNQ A;  4A76 A;  4DR6 L;  1HZA A;  4R1J A;  1YEZ A;  2IY5 B;  3I7F A;  1IBM L;  2B29 A;  4JC0 A;  2BH8 A;  1HJP A;  1JB7 A;  1CKN A;  1XMO Q;  4KHP L;  1X55 A;  3PV0 A;  4BXX H;  1YJ9 A;  2HIV A;  1QZG A;  4IJH A;  4DKA C;  3S1R H;  4GN3 B;  4JBM A;  3PUW A;  1CSQ A;  1B70 B;  4GLX A;  2FXQ A;  2UXB L;  2ZTD A;  4POF A;  1Y1V G;  1YHA A;  3NEL A;  4DR4 Q;  2EQS A;  4A3I G;  1LYL A;  1E3P A;  3EIV A;  3NEN A;  4K0K Q;  1S3O A;  4HID A;  3PUZ A;  4LF8 L;  1V1Q A;  4R4T A;  3K8A A;  4LFA L;  4ALP A;  4IOC A;  1CSP A;  4UP7 A;  1N33 Q;  5IYD H;  4R4I A;  1RIP A;  2N8N A;  2Q2H A;  2R92 G;  1Q8K A;  1CKN B;  1FJG L;  2NN6 G;  1FGU A;  3A0J A;  4QQB X;  4LUZ A;  5J3B A;  5GAD C;  1XMO L;  3EBE A;  1VQ6 A;  1AH9 A;  3ERS X;  4R4Q A;  4DK6 C;  5C44 G;  1U0L A;  1J6Q A;  4PZ8 A;  4A3C G;  2JEA I;  2JEB I;  2K5N A;  2ZJR A;  4LF5 Q;  1LM0 A;  4OO1 G;  3CCL A;  3J7Z C;  2ID0 A;  4DR4 L;  4K0K L;  1VQB A;  3G48 A;  1C9O A;  2Q2I A;  3CF5 A;  3S2H H;  2UXB Q;  3HOX G;  5C0X G;  4APV A;  4PMW A;  5JJK A;  2K14 A;  3L2P A;  1Y1V H;  2N49 A;  5C0X J;  2JA8 G;  4A3I H;  2Z6K C;  5E7N A;  1H95 A;  4RG1 A;  4DUZ Q;  1SFO H;  1W3S A;  3G4S A;  1X3E A;  2D0P A;  2RHQ B;  4A75 A;  1U5K A;  1S40 A;  1VQD A;  1P16 A;  2PNH A;  4JI1 Q;  2Y0S G;  4JBW A;  3PSI A;  3CP0 A;  1N8R C;  1HZC A;  1UE5 A;  4LF5 L;  4IFD G;  3GTO H;  1YHB A;  4DV6 Q;  1JE5 A;  4A3C H;  1K0R A;  3KJP A;  3KF8 B;  3F8T A;  1QVC A;  3GTP H;  1KAW A;  3TQY A;  3UDI A;  3CCR A;  1KC8 C;  1EWI A;  4JI0 Q;  5M3F G;  2ATW A;  4DUZ L;  4IPC A;  1BVS A;  1HZB A;  2OCE A;  1MIU A;  1I5F A;  4YCW A;  5IT9 c;  3HOX H;  4DV0 Q;  1YIT A;  3SGI A;  4JI5 Q;  3H3V I;  3PO3 G;  4YWK A;  3J81 j;  4WJ4 A;  4GLV B;  4L5Q A;  1VQ7 A;  4JI1 L;  3UE1 A;  1HNZ L;  4LFB Q;  2BA1 A;  2UUC Q;  2AHO B;  4A93 G;  1VQF A;  4DV2 Q;  2JA6 G;  3JAM i;  1Q86 C;  1OTC A;  4NXM L;  2PI2 A;  3UDF A;  4P75 A;  4DV6 L;  1YNX A;  4HIK A;  2CCZ A;  4LUV A;  1G6P A;  2PQA B;  2VL6 A;  1Z9F A;  1X6O A;  4TVA B;  4HIM A;  1XPU A;  1UWV A;  1E1O A;  3EN2 A;  1C0A A;  1Q82 C;  4QL5 A;  3GDE A;  4PZ6 A;  2LXK A;  4HIO A;  4JI0 L;  1VQN A;  2ALY B;  1I6H H;  2YTX A;  1FVI A;  2AMC B;  4DV7 Q;  4HJA A;  1IYJ B;  3UDG A;  4MTN A;  1PH4 A;  1C7Y A;  4LFC Q;  4DV0 L;  1GKH A;  2HHH Q;  3S14 H;  2HQL A;  1X3G A;  4JI5 L;  4LF9 Q;  5M3F H;  3CCQ A;  1AE2 A;  1YHQ A;  1PH5 A;  4IPG A;  3S24 A;  2E2H H;  4A3L G;  4LFB L;  1WCM G;  1DGS A;  1T9H A;  4DV3 Q;  1X65 A;  2UUC L;  1V9P A;  3H15 A;  4B3T Q;  3M85 A;  4DV2 L;  4JOI A;  1PH6 A;  4QY7 A;  3AEV A;  3U50 C;  4LF6 L;  3M7N A;  5IYD G;  2JK8 A;  3T1Y Q;  1PHJ A;  3GD7 A;  4HJ7 A;  1VS0 A;  4A93 H;  3RN5 A;  2VNU D;  1SRO A;  4R4O A;  1IBL Q;  1EIY B;  3DLL A;  2ZJQ A;  1SLJ A;  1VQK A;  4DV7 L;  3STB C;  1VQP A;  3CCU A;  4LFC L;  4UPA A;  2ASB A;  2HHH L;  4LF9 L;  2IHF A;  3TRZ A;  3OW2 A;  2N3S A;  5EAY A;  4BY7 G;  2K5H A;  1VQC A;  4AH6 A;  2I0Q A;  2CFM A;  1NE3 A;  1J5E Q; 
#chains in the Genus database with same CATH topology
 1LO5 D;  3S16 H;  1UNS A;  4DV3 L;  1IW7 D;  2AQ3 B;  1GUT A;  5K36 G;  2GVA A;  4JI3 Q;  1L0W A;  4ZLT F;  3K7A H;  2DJG C;  3W8H B;  1UAP A;  4KKT A;  1XXG A;  5C0X I;  2UXC Q;  5E4W C;  4XT3 B;  1VQA A;  3KOJ A;  1B1Z A;  5EJW A;  4FZW A;  4IZD A;  4XQJ A;  2K6A A;  5ELB A;  3RR5 A;  4A3B G;  2KCM A;  2Y0S B;  1Q1B A;  1SNC A;  5C6A A;  3OHX C;  3PUV A;  5HY6 A;  3J80 L;  1J5E L;  4YHH Q;  1VQL A;  1L1O C;  3D6C A;  4CJ1 B;  4TKO B;  1YNJ D;  4C1N I;  4DAP A;  1CKM A;  4JCS A;  3HS0 C;  1UEB A;  1NY4 A;  3S14 B;  3HRX A;  1SYB A;  2QF7 A;  2F03 A;  5IGC A;  2HT1 A;  4BBR H;  4GOP C;  5M3F B;  1DOL A;  2JA5 B;  2EYM A;  2O5I C;  2CQA A;  3KUP A;  3ZJY C;  1NMF A;  3MXU A;  5BR8 L;  1J9O A;  2B2U A;  4DXF A;  2YTY A;  5IT9 L;  2PNR C;  4K2N A;  1SE4 A;  1TWA H;  4HSV A;  2PCF B;  5ELN A;  3NEM A;  2O5J C;  2JA6 B;  3LWU A;  2VRE A;  3F1Z A;  2ZM6 L;  1XMQ L;  4A3J H;  2VS1 A;  3OOC A;  1QVG A;  1SNQ A;  4NXN L;  2R6G A;  2IJ0 A;  1PA6 A;  1ASZ A;  4RFB A;  2BE5 C;  2Z9H A;  1H9S B;  1WTX A;  3GV3 A;  4JBK A;  4IZC A;  1GVP A;  4RA8 A;  4RCO A;  5FLX c;  1AW7 A;  3I8Z A;  3MHB A;  4CJ2 C;  3T89 A;  3I47 A;  2CH4 A;  4DF7 A;  3ICE A;  1HNW Q;  2AQ1 B;  2CHB D;  2EYP A;  2F0T A;  3VYS A;  5KGU A;  4K6L A;  1N34 Q;  3R3O A;  1O80 A;  3BS1 A;  4XT1 B;  2EVB A;  2D62 A;  2NVY H;  2H5X A;  2UXD Q;  1JOQ A;  1EFW A;  2NZH A;  1SYD A;  1HA5 A;  3N6R A;  1A6X A;  3QOJ A;  3P1H A;  5DNF A;  1IYV A;  3GQB A;  2F0D A;  5I6Y A;  1SE8 A;  2EY6 A;  2ICI A;  1TY2 A;  5T1G A;  4YY3 Q;  3K0X A;  4B3M Q;  4JPB W;  5LMN W;  4LUO A;  3TS2 A;  4KLK A;  2R93 H;  2B2T A;  3KLR A;  2I46 A;  1C48 A;  2AKW B;  1YJW A;  1HFG A;  4GN5 A;  4A3D B;  2XIW A;  1YJN A;  2RQX A;  1QZH A;  1LLR D;  5EPJ A;  2JJQ A;  5LMU L;  1EYC A;  1F2Z A;  4YCV A;  4DK0 A;  4JI4 L;  4RGT A;  5ELF A;  4B3R Q;  4FO2 A;  3STB D;  5IOD A;  2X6G A;  4PG3 A;  4OL7 A;  4K8I A;  3TDQ A;  1I4Q A;  2ENB A;  4F87 A;  2B63 H;  4A3F H;  2ZJP A;  2A6E C;  4IOA A;  5C4X G;  2E2J H;  2A69 C;  1FNW A;  2A6H D;  3KJO A;  1MSH A;  4O2D A;  4AQY Q;  1X54 A;  2KHI A;  1A3V A;  4DV1 Q;  3IRB A;  4A3K H;  4XTC S;  3GTP B;  3D4D A;  3NQT A;  3NTI A;  4C3H G;  1CUK A;  5JOB A;  2OEO A;  5DM7 3;  3HG9 A;  4JI2 Q;  5JJI A;  4DR2 Q;  2F0P A;  4U19 A;  2K33 A;  1HTL D;  1EY0 A;  3AMU A;  2IX1 A;  3PIO A;  3AFQ A;  5NUC A;  4A3G G;  4WRD A;  3FKI B;  1RF2 D;  3URY A;  3RSI A;  2CKZ B;  3GTG B;  1GUO A;  4LF7 L;  4JI6 Q;  2O2L D;  2JA7 H;  5K5P A;  1WYD A;  3JAM c;  4DAV A;  1KXL A;  4NXM L;  3C2P A;  1I6H B;  5JEA H;  1PFM A;  3D0F A;  2WKD A;  3MXP A;  1BBU A;  1BKB A;  3H3V C;  3BDO A;  4P2C B;  1VQM A;  3HOW H;  1Y14 B;  3I4M H;  3HOU B;  3R2I A;  3H0G H;  1QUQ B;  2E74 C;  3MVV A;  3I4N G;  3S2D H;  5EKL A;  4NEK A;  5M3M H;  4RH6 A;  5GRO A;  5LMN Q;  1Q7Y C;  1M4V A;  5FJ8 H;  1EWH A;  1NR4 A;  4FXK C;  1VQH A;  1DCI A;  2KA7 A;  4ZYS A;  2QDL A;  4K2L A;  4X62 L;  2BE5 D;  2WAQ E;  3H09 A;  4MZ9 A;  2PZW A;  3TRE A;  1SRU A;  4DUY Q;  1EY3 A;  3E0J A;  3IAY A;  1WI5 A;  1PTO H;  3RZD H;  4X66 L;  4DR7 Q;  4OX9 Q;  3S1M H;  2SNS A;  1L1O A;  2LFN A;  4ILW A;  1I4H A;  4DU9 A;  2RVL A;  1Q52 A;  2A1A A;  3VA5 A;  1WCM B;  4GOP A;  2HD3 A;  3Q24 A;  3A74 A;  3J81 L;  2ZTC A;  4C3I B;  5F2D A;  2DUB A;  3QO2 A;  3J7A 5;  3HOV G;  3M7G A;  2B63 G;  4JV5 Q;  3ADC A;  3I56 A;  3KLS A;  3UI2 A;  2A74 C;  1B7Y B;  3VR2 A;  1JMC A;  4JOI C;  4BBS B;  3O13 A;  2EY5 A;  1P8L A;  4GKJ L;  4R9W A;  1EYG A;  4C2M B;  1E24 A;  4A3K G;  2QEJ C;  1HZD A;  3OWE B;  3TP7 A;  4YWL A;  4P72 A;  1LAB A;  4NNQ A;  1V1P A;  1A0I A;  4DPG A;  3MZ5 A;  1G2S A;  3N52 A;  5FLX E;  4MNO A;  1TWH B;  1PRT B;  4DAY A;  1X56 A;  2VB3 X;  3MXN B;  1RTO A;  2A6E D;  1BCP B;  2A69 D;  3PCO B;  2ZQQ A;  4A3B B;  5IY0 A;  4DR3 L;  3DM3 A;  3T51 B;  1WFQ A;  1EYA A;  2KUM A;  1R9T B;  4BXX G;  4UY8 C;  4DR6 Q;  1STN A;  1GXD C;  4GN4 B;  3CD6 A;  1STY A;  4I7A A;  3NUC A;  2QDB A;  3QG1 A;  1IBM Q;  2OTL A;  2JA5 H;  1JC7 A;  4JBJ A;  1KDA A;  3BVG A;  3JAM L;  1CKO A;  5EGT A;  3VR4 A;  3HOW G;  3H0G G;  3TEH B;  1G51 A;  1RHP A;  4NB3 A;  3FEW X;  2JA6 H;  2RA4 A;  4LF8 Q;  1YBY A;  5C3E H;  4MIU A;  2VXW A;  3U9O A;  3C1F A;  3ULJ A;  2IY5 B;  4KMU C;  4R1J A;  1D1K A;  3I4L A;  2FBM A;  4JYL A;  4JC0 A;  2BH8 A;  2MP1 A;  3MA2 B;  1XMO Q;  5M5X B;  2HDL A;  1F2L A;  2K05 A;  4DKA C;  4N9P A;  1LTG D;  4GN3 B;  1Y8N B;  1X3Q A;  3PUW A;  4L6T B;  1CSQ A;  3GTQ B;  2FXQ A;  2UXB L;  2ZTD A;  4FNF A;  1MJ3 A;  4ZUJ A;  1EY5 A;  3NEL A;  4DR4 Q;  2EQS A;  1E3P A;  1MHW C;  3PUZ A;  3K8A A;  3ND9 A;  4LFA L;  4IOC A;  4UP7 A;  5IYD H;  1PFB A;  2PW7 A;  2NVT B;  1Q8K A;  3R93 A;  3HOY B;  3D4R A;  1TWG B;  2B2V A;  3EBE A;  1VQ6 A;  4OG1 A;  2WAQ B;  4QII A;  3AM1 A;  1B4O A;  1J6Q A;  4AYB B;  3RD4 A;  4HCE A;  4LF5 Q;  1CQF A;  1LM0 A;  1LTA D;  5KJP A;  3T16 A;  1Y8O B;  3G48 A;  2Q2I A;  3S2H H;  2QIL A;  4PMW A;  1D1I A;  2K14 A;  1DOK A;  2C5C A;  5E7N A;  4XYQ A;  1H95 A;  1ZYR D;  1W3S A;  2RKS A;  1X3E A;  4CKE A;  1CHP D;  4A75 A;  3MAQ A;  4PNY A;  3BDL A;  1VQD A;  4WFN 3;  4CGY B;  2Y0S G;  4DFA A;  1T5E A;  2XRQ D;  1QIL A;  5CR3 A;  4DXG A;  3CP0 A;  1O7Z A;  3HIN A;  2HUG A;  4IFD G;  1EEI D;  1JE5 A;  1EY4 A;  2K32 A;  4A3C H;  4ZU2 A;  1K0R A;  4A3E B;  3KF8 B;  3F8T A;  3GTP H;  1U4M A;  1KAW A;  4JI0 Q;  5M3F G;  3OMC A;  2K5Q A;  1HZB A;  2QW7 A;  3H3V I;  1PVO A;  4JI5 Q;  1YIT A;  1S5F D;  2CH4 W;  4X3T A;  4WJ4 A;  1I4G A;  1EY8 A;  4C3H B;  4LFB Q;  3CRL C;  2UUC Q;  2NYZ D;  2JA6 G;  1DXM A;  3A4L A;  3W2D A;  1OTC A;  3UDF A;  1ONL A;  4DV6 L;  2PQE A;  4LUV A;  2SDF A;  1X6O A;  1LAC A;  2F0U A;  1C0A A;  4QL5 A;  1VDZ A;  4HIO A;  1RJT A;  2B2W A;  1I6H H;  1JWM D;  1C7Y A;  1GKH A;  4LF9 Q;  3NE5 B;  4LAA A;  1AE2 A;  1YHQ A;  1TU2 B;  1B3A A;  2BOS A;  1X65 A;  4B3T Q;  3M85 A;  3DEP A;  3T4A C;  1B44 D;  4JOI A;  1G6Z A;  2LY7 A;  4QY7 A;  4Q0F A;  3AEV A;  4F8M A;  5IYD G;  1E0B A;  1PHJ A;  1GUW A;  3GD7 A;  4A93 H;  2R92 B;  3KBX A;  2NZ1 D;  1EIY B;  4TRD A;  5J1Z A;  1IBL Q;  1XTC D;  3J7A F;  5C4Z A;  2F0K A;  4DV7 L;  2JP1 A;  3QJY A;  1GHK A;  2ASB A;  3X3N A;  3SWX A;  4BY7 G;  2PZT A;  3IKJ A;  2CFM A;  3E0E A;  4QF4 A;  2IW3 A;  5L37 A;  4P74 A;  1NCV A;  4A3D G;  1STE A;  3KF6 A;  3E6Z X;  5KNB A;  2XTI A;  5DEH A;  3CU7 A;  1WCM H;  4YWM A;  4M1U B;  3H02 A;  3OWF A;  3VYR A;  1M90 C;  4K5V A;  5IYB H;  3S15 H;  1EU4 A;  4C3I H;  3KLW A;  2AUK A;  3MXG A;  3BZK A;  1EF8 A;  3DUZ A;  3RLN A;  4AIM A;  4KTA A;  1PYW D;  3E9I A;  1XYI A;  1Q90 A;  1SE2 A;  4NKL A;  4BBS H;  3HKZ E;  1HR0 W;  1IL2 A;  1PYB A;  2WP8 J;  1IYU A;  3G6J B;  3EA6 A;  3RMH A;  2WB1 E;  2I5H A;  3RNU A;  3FMC A;  3CMA A;  3PIP 3;  1W6J A;  3P7J A;  1XNR Q;  2YU9 H;  4QIW B;  1QVF A;  3TSS A;  4QB4 A;  3RZO H;  5IP9 G;  1TWH H;  1PYS B;  4JI6 L;  3FKI G;  2E2I B;  2F3W A;  3M9B A;  2K75 A;  3J80 c;  4A3B H;  2SNM A;  4V19 0;  3HKS A;  5JVH 3;  5GAG C;  3K6O A;  1SNO A;  2F0H A;  5AJ3 L;  4U67 3;  1R9T H;  2B3G A;  1VQ8 A;  1EU3 A;  1H9R A;  1IBK L;  1IKM A;  4GKK Q;  3R9T A;  1XNQ L;  1PFS A;  2UUA L;  4IFD J;  1II3 A;  4FF1 A;  1VQ9 A;  2EY1 A;  3HOU G;  1QJO A;  4K2K A;  4GNX A;  4ID6 A;  2BA0 A;  2RBM A;  4X64 L;  1S4Z A;  1OXX K;  2PW5 A;  2QCP X;  2IT1 A;  4ME3 A;  2KOL A;  4R8N A;  1GUN A;  1S5D D;  1BBW A;  2VX2 A;  3DWP A;  1PDQ A;  2RF4 A;  2EYH A;  5M5X H;  2PMZ B;  4UP8 A;  4CDE C;  3BYT B;  1H9M A;  5D3I B;  2E5L L;  4LF4 L;  1B9N A;  3QB3 A;  4XYO A;  1TS5 A;  2A19 A;  4DR5 Q;  3VYU A;  3U4Z A;  1N32 Q;  1N36 Q;  1B53 A;  1GUS A;  3NWT A;  3PMF A;  1KRS A;  2EIF A;  3HFZ B;  2R7F A;  1WTV A;  1MSG A;  2YYZ A;  1HR0 Q;  2NVT H;  4HAE A;  2KHJ A;  3T1H Q;  1BDO A;  5EBC A;  2ZT9 C;  4DV4 L;  1SFO B;  2MJ8 A;  3HOY H;  5IYB G;  5ELD A;  2NZO A;  1TQO A;  5BN5 A;  1E22 A;  4OLQ A;  5CV8 A;  3S17 H;  3I3C A;  3OTO L;  3AQQ A;  1G91 A;  4DV5 Q;  2NN6 I;  4IUU A;  1TWC H;  2A73 B;  4MHE A;  4JI8 Q;  3Q0G A;  2F0O A;  3CRK C;  4BBS G;  1Y64 B;  5FO8 B;  2KBN A;  3CAM A;  3HP3 A;  2N78 A;  4EX5 A;  2GVB A;  3K80 C;  2JQO A;  5IOC A;  4J1M A;  1OO9 B;  1EZ8 A;  2G5D A;  1EQR A;  1GD7 A;  3BZD B;  1K8A C;  1G8Z D;  3NBH A;  3P20 A;  4IUN A;  3E9H A;  1YI2 A;  2UU9 L;  2UZF A;  4Y52 H;  3OIQ A;  4DNI A;  5DM6 3;  3DM1 A;  1RL2 A;  3MC0 B;  4P71 A;  4KKU A;  4A3E H;  2IWH A;  1I94 Q;  2F4V L;  5I4D A;  5C4X H;  1OXS C;  2MNA A;  1Y8P B;  3T88 A;  4OXP A;  2WB1 B;  4IPD A;  2F0N A;  2Z4I A;  1A2U A;  4C56 C;  1AE3 A;  1SNM A;  4C3H H;  2M2L A;  4LK1 C;  2RDH A;  1BNZ A;  2OT2 A;  2E2H B;  2B2Y C;  2IPK D;  5IE8 A;  3CPW A;  4QUF A;  5KEE A;  2C35 B;  4B3S L;  3PGZ A;  1C4Q A;  3S1N H;  3G6E A;  1KD1 C;  1VQ5 A;  4A3G H;  1GJX A;  4X65 L;  1I6V C;  3PO2 B;  5FOB B;  4LWC A;  4DR1 L;  3NTH A;  1SYE A;  4JI7 L;  2V1C C;  1IZ6 A;  2ZXR A;  3M3Y H;  2VQE L;  1ENF A;  1HNX L;  1YIJ A;  4FXG C;  3U58 A;  5ELE A;  1D5X C;  1PTO C;  5M9O A;  3R0O A;  4OEL B;  3M4P A;  3HOZ B;  2F0G A;  4PQX A;  4ELS A;  4NPS A;  3EFX D;  3MTS A;  2IL8 A;  4C1N K;  3I4N H;  1Q1E A;  4HED A;  1STB A;  2VB2 X;  5IYC G;  1HUN A;  1EY9 A;  3D3R A;  1R4Q B;  3K5M A;  2R92 H;  3L8I A;  4KN7 C;  4ZUI A;  3HOY G;  1K83 H;  4KN4 C;  2PYK A;  1HH2 P;  4F7X A;  2WAQ G;  5C4H A;  1HZ9 A;  4AYB G;  2Q2U A;  3ONA B;  2Z6K A;  1KQS A;  1M1K C;  3AB9 A;  3F2C A;  2P5Z X;  1HQR D;  4U1A A;  4EVO A;  5E3F A;  4ELW A;  3J80 E;  3UDX A;  4PV1 C;  3KK7 A;  3GTK B;  4BY7 B;  3PO3 B;  1PMR A;  1UE6 A;  2EOT A;  3OYY A;  1TWF B;  3VR5 A;  1A62 A;  1SJE D;  1X3P A;  1Q46 A;  1VQE A;  1G2T A;  2WFW A;  2RSN A;  5FO9 B;  5KYI A;  3J81 c;  4M8A A;  2OWO A;  1MJC A;  5CYU A;  1EIF A;  1KDC A;  2R7Z B;  1I50 B;  4DNR B;  3QK8 A;  1CA5 A;  2K04 A;  3NSW A;  3WOF A;  2XGT A;  4QMG A;  5IT9 E;  4OON A;  4ODG A;  5COR A;  5C4J B;  2UUB L;  3HOV H;  1UX5 A;  1JWU D;  5IWA L;  4A3E G;  2L1B A;  2K5V A;  1F9R A;  4KHP Q;  1SBB B;  1JJG A;  3LNN A;  5HGQ A;  4ELX A;  2VQF L;  1QE6 A;  1WTH A;  2QGQ A;  4JYA L;  1YZ6 A;  4BY1 B;  3A4M A;  3CCV A;  4RHR A;  2E2I H;  2VUM B;  5M5Y B;  2JA9 A;  1KDB A;  3TLF A;  3GTL B;  3CW2 C;  1YNN C;  1Z7T A;  3PUX A;  4OEM B;  2F4I A;  2BCO A;  1ILP A;  1PH7 A;  4A76 A;  1JQY D;  1YEZ A;  4CKC A;  2B29 A;  1RDP D;  2XVS A;  1HJP A;  2OXP A;  1CKN A;  1X55 A;  1MBY A;  3PV0 A;  4PMC A;  4BXX H;  2HIV A;  1QZG A;  4IJH A;  4HR7 B;  3PQI A;  4IUV A;  2NVX B;  1FD7 D;  3FRP B;  2M00 A;  4FXD A;  1XWE A;  4GLX A;  2IX3 A;  1I4X A;  4GZY C;  1ML0 D;  4A3I G;  3NEN A;  3EIV A;  2DY8 A;  2JXM B;  1S3O A;  5CBE E;  5CV4 A;  4HID A;  2R92 G;  2J7Z A;  1ILQ A;  2NBF A;  4JK1 C;  4LUZ A;  1AH9 A;  3FDU A;  1UEA B;  1U0L A;  4PZ8 A;  5JPM C;  1PTO D;  3OC7 A;  1LV9 A;  1I3Q B;  3MWY W;  4OO1 G;  4OIJ A;  5M5W B;  2ID0 A;  1EY7 A;  4K0K L;  3EQL C;  3SK8 A;  4QIJ A;  3KQF A;  1VQB A;  2DNE A;  1EY6 A;  1C9O A;  1C8C A;  4H7B A;  1H9J A;  5JJK A;  4ZCK A;  5C0X J;  4PMB A;  4DUZ Q;  2E2D C;  2HCC A;  1SFO H;  3C3L A;  1HHV A;  1U5K A;  3DWQ A;  2D2C C;  1S40 A;  1D5Z C;  2DN8 A;  5FO7 B;  5IGG A;  3TZD A;  4JBW A;  1JR0 D;  3PSI A;  2LKV A;  4XQN A;  1LT3 D;  3HEJ A;  1N8R C;  1U9R A;  4MN3 A;  1WTO A;  1YHB A;  4JVZ A;  1HRJ A;  2RCF A;  3OMG A;  4FF3 A;  3CCR A;  3TQY A;  1EWI A;  3QXZ A;  1TII D;  1ICF B;  4KV6 A;  2RDG A;  2ATW A;  4Z9C B;  1A3T A;  1I5F A;  2EE1 A;  1PZI D;  1SDF A;  1KNE A;  4JI1 L;  2TSS A;  3M4O B;  2F6Q A;  1HPC A;  2G9D A;  1HCZ A;  1KAA A;  4K5W A;  4G7H C;  3JAM i;  4K5X A;  5D3D A;  3EVQ A;  2R3Z A;  1DCZ A;  4P75 A;  1R4P B;  1G6P A;  2CCZ A;  2EYJ A;  1Z9F A;  1Q3L A;  4L8J A;  1EYD A;  1E1O A;  1UWV A;  3DXJ C;  1Q82 C;  3BYY B;  4IFD H;  3ADD A;  1PXU A;  5J22 A;  2EYF A;  1HQM C;  4MTN A;  1PH4 A;  3S14 H;  4DV0 L;  1X3G A;  1MGS A;  4L63 B;  5M3F H;  1QG7 A;  3V05 A;  4IPG A;  4ME5 A;  3S24 A;  2E2H H;  4A3L G;  2KCN A;  4DV3 Q;  1Y1V B;  1V9P A;  3H15 A;  4DV2 L;  1JB3 A;  3GV6 A;  4EQO A;  4IN3 A;  4IZ8 A;  2KCC A;  1DJR D;  3SHL A;  4GEH B;  2EJG C;  2ZJQ A;  4R4O A;  4U18 A;  1VQK A;  5IGE A;  3J81 E;  1VQP A;  1BXT A;  2K7V A;  4LFC L;  4UPA A;  2HHH L;  5C44 B;  3TRZ A;  3OW2 A;  1BF4 A;  2K5H A;  1VQC A;  1NE3 A;  1J5E Q;  1BBX C;  2F3I A;  5CV5 A;  1EOT A;  4N9T A;  3CKI B;  5I2X A;  5IP7 G;  1LUZ A;  3T56 B;  3BZC A;  1UE7 A;  4FYD A;  3HOX B;  1RCV D;  1Z47 A;  3T1Y L;  2JA8 B;  3Q23 A;  5FLM G;  2FFK B;  2GTR A;  2NUC A;  1K28 A;  1XTD A;  4I52 A;  1ICW A;  2AUJ D;  5BR8 Q;  4NDX A;  5COY A;  1GUG A;  1WTW A;  3SK4 A;  1TR5 A;  2EYO A;  2IX0 A;  2ZM6 Q;  3IL8 A;  1TT2 A;  1XMQ Q;  3GTK H;  4JI3 L;  1X9N A;  3PO3 H;  4KHV A;  4BY7 H;  1VF7 A;  1TY0 A;  2X69 A;  4UP9 A;  5I6W A;  2VY3 A;  4NXN Q;  1SYG A;  2UXC L;  1TWF H;  3I70 A;  4A3D H;  2PO4 A;  1O78 A;  3L3O C;  5GQO A;  1B8A A;  1MD2 D;  1GO3 E;  4J8Q A;  1U4L A;  1H9S A;  4ZKC B;  3JAM E;  2WV6 D;  2R7Z H;  2EJM A;  3R2T A;  1JXZ A;  1PRT C;  2ZTE A;  1DD2 A;  2WII B;  1D8L A;  1BCP C;  1PH8 A;  1I94 L;  1EF9 A;  3FDT A;  4YHH L;  5C4J H;  1Q8I A;  3H81 A;  3K81 C;  3Q6S A;  3TRR A;  3CCJ A;  1XPO A;  2KCT A;  2I5M X;  2F0Q A;  3ER0 A;  3E5S A;  2D5D A;  2EXZ A;  2WB1 G;  3RN2 A;  3CPF A;  4DN4 M;  3S16 B;  2PQA A;  1ZXT A;  1B3Q A;  3SR1 A;  4J15 A;  4BY1 H;  2MUY A;  4L5T A;  2DGY A;  5M5Y H;  1W2B A;  2WAC A;  4UAI A;  3VA7 A;  3Q0A A;  1NJI C;  5IP9 H;  3A55 A;  2IHE A;  2N55 A;  3E3X A;  3FVQ A;  2B8F A;  5LMU Q;  2EJF C;  4B9W A;  2QQ3 A;  3FKI H;  3PO2 G;  4JI4 Q;  3GTG H;  1ESR A;  1FR3 A;  4LF6 Q;  1J8I A;  3FHW A;  3U9S A;  4JFC A;  2NVX H;  1N9W A;  3QWN A;  3W5O A;  4BA2 I;  1HNW L;  4CKB A;  3PF4 A;  1O7L A;  3HOZ G;  2CWA A;  2OTJ A;  3BU2 A;  1CT1 D;  5GAH C;  4BBR B;  1N34 L;  1K3R A;  3HOU H;  4KJO A;  1CK1 A;  4KY6 A;  4JWV A;  3RLO A;  4BS9 A;  3R8B A;  2UXD L;  3ULL A;  4FP5 D;  3O4X E;  4WJW A;  3TME A;  4A3I B;  3I55 A;  4XQQ A;  1CFM A;  1SMY C;  2DUD A;  4LMQ D;  1TWA B;  2EYL A;  4FDB A;  4G4K A;  1UE1 A;  4YY3 L;  4B3M L;  2MO1 A;  1EFI D;  1I3Q H;  3NP8 A;  1JWS D;  1LTI D;  5M5W H;  3QIA A;  3MEH A;  1WTP A;  4MTK A;  3GTO B;  1U4P A;  4LF7 Q;  2I5L X;  3PO3 G;  2EXD A;  1JOR A;  3ERO A;  4N8X 1;  1JCK B;  4NXM Q;  3F2U A;  2RHS B;  2K5W A;  1PH9 A;  2SEB D;  1DZ1 A;  4B3R L;  3L7Z C;  5A2Q L;  1CI3 M;  4LW1 A;  5C3W A;  5H1S E;  2OF1 A;  2R7Z G;  4HSP A;  5EPK A;  4F88 A;  1H9K A;  1ESF A;  3MOY A;  5J39 A;  1NNX A;  4EQN A;  3T13 A;  4IUP A;  4AQY L;  4FF2 A;  4DV1 L;  3CCM A;  3W8I B;  2B2U C;  2LXJ A;  4X62 Q;  5CC4 A;  3H6M A;  1JOK A;  3TS0 A;  3AYH B;  4ZAI A;  4C2M H;  4DK3 C;  5D14 A;  1D2B A;  2XSC A;  4JI2 L;  1IW7 C;  4ULL A;  3MEF A;  4DR2 L;  2FHT A;  1A2T A;  3KDF A;  3NXW A;  4BY1 G;  4X66 Q;  3M4O H;  1PRT D;  4JW0 A;  2VUM G;  3A8J E;  4RMF A;  1SSO A;  4TQU S;  2VW9 A;  4I42 A;  1D6E C;  1PH2 A;  3WDN A;  1KIX A;  1AP0 A;  1TS4 A;  2Y0S E;  1BQQ T;  4DGZ A;  2MO0 A;  4EQ5 A;  4EGV A;  1ET9 A;  3FPU B;  3R9S A;  1UIY A;  4X6A H;  1QOH A;  3M4Y A;  1LT6 D;  1VQG A;  4QGU A;  3L0O A;  1Q51 A;  5CBA E;  1Z6H A;  1YNJ C;  4ZK9 B;  4HMI A;  4O1N A;  2YTV A;  3G7L A;  2K5D A;  2FMM A;  1DM0 B;  3OW7 A;  5LMN L;  1D7Q A;  1SMX A;  1V43 A;  5FKA C;  4GKJ Q;  3CC7 A;  1EQV A;  3RLF A;  2VZA A;  3KFU A;  1EIG A;  2CW0 C;  1E2W A;  4H02 A;  1PZK D;  2K1B A;  1FL0 A;  2B2T C;  1QWY A;  1JJ2 A;  2KVM A;  2Z4H A;  2ZQR A;  1L0Y B;  4RAU C;  5KIX A;  4DUY L;  3RQF A;  5C44 H;  3L8J A;  1ENA A;  1Q12 A;  1HXY D;  1GOZ A;  4DR7 L;  3K5N A;  1L1O B;  1VQO A;  4POG A;  4OX9 L;  1NTG A;  4HTH A;  1AZQ A;  4WCZ A;  4DR3 Q;  2Z6B A;  4KHZ A;  3GTQ H;  1HA6 A;  1PH1 A;  2JE6 I;  4CDC C;  5C0X H;  4K6D A;  2NVQ B;  2FMC A;  4GOP B;  2CWP A;  3A54 A;  2JA8 H;  3ADB A;  2F0I A;  3I73 A;  1EUJ A;  5G3L F;  3S2D B;  3BVM A;  1SMY D;  3KYH C;  3FP9 A;  2LSS A;  2A68 C;  4HJ9 A;  4QCL A;  5M3M B;  2KEE A;  1HUM A;  2NB0 A;  3ND8 A;  5IYC H;  4RKB A;  1TVX A;  2YV5 A;  1A15 A;  3D31 A;  4JV5 L;  5IGD A;  3RQE A;  1TWG H;  4OWW B;  2AWO A;  4O0A A;  4F47 A;  1SAP A;  4ZQ3 A;  1E2Z A;  1WTR A;  3F2B A;  1V1P B;  5I9P A;  3PUY A;  2D0O A;  4C3J B;  3WWV A;  3SVM A;  1FJG Q;  2GN5 A;  4DAY B;  1RJN A;  1EEF D;  5LL6 X;  3J80 i;  1KHI A;  1E1T A;  1LTL A;  3W1G A;  2UXB Q;  3CC2 A;  3PIP A;  1LTS D;  4DA2 A;  1LT5 D;  2Q2T A;  1NBW A;  1B2T A;  1K8M A;  2OQ0 A;  3K7U C;  1SXT A;  4LFA Q;  2A5H A;  4KY5 A;  1WJJ A;  2L0C A;  3HRZ C;  5HGT A;  4DR6 L;  1HZA A;  3SE0 A;  3I7F A;  4RGM A;  3TZU A;  1IBM L;  1WD0 A;  4I4Z A;  4X3U A;  4E6I A;  3HKZ B;  2A6H C;  4JBM A;  2WKC A;  5CV9 A;  4ABN A;  2F0W A;  3A7A B;  5CV7 A;  4POF A;  2GA4 B;  1Y1V G;  2HDM A;  4Q5V A;  2PZU A;  5G3L D;  4KNP A;  4LF8 L;  4Y7N B;  4ALP A;  1CSP A;  1CA6 A;  1N33 Q;  5EPL A;  4R4I A;  1RIP A;  2N8N A;  5HUR A;  1KLU D;  2NWG A;  2NN6 G;  3H94 A;  1FGU A;  2Q8I B;  1Y1W B;  3D4W A;  3A0J A;  3K59 A;  1SNP A;  1XMO L;  1RJM A;  3ERS X;  4R4Q A;  5C44 G;  3A8I E;  3S9W A;  2JEA I;  1F2M A;  4B9X A;  2JEB I;  2K5N A;  2ZJR A;  3GTJ B;  2PBP A;  3CCL A;  4YIJ A;  1CM9 A;  5EKI A;  3A8K E;  5JBX A;  3SXH A;  1WTQ A;  4DR4 L;  3MYB A;  2K03 A;  1BR9 A;  3CF5 A;  2CW0 D;  3HOX G;  5C0X G;  1QNU A;  4APV A;  3L2P A;  2N49 A;  2JA8 G;  3KF8 A;  2JSO A;  2Z1C A;  4A3I H;  3PIO 3;  1SEB D;  3G4S A;  1RD9 D;  2RHQ B;  2K01 A;  2PNH A;  2F0S A;  3C46 A;  4N8F A;  5C3E B;  3A56 A;  2G9H D;  4S3S A;  4LF5 L;  3GTO H;  3QOL A;  5IGF A;  4DV6 Q;  4CBV A;  1KNA A;  2P63 A;  1KC8 C;  4OO1 H;  4DK1 A;  4IPC A;  2A68 D;  1UUP A;  1LTR D;  1MIU A;  1EQT A;  4YCW A;  3S1Q B;  3SGI A;  2Q8R E;  1NSN S;  4YWK A;  2IEX A;  4A3M B;  1VQ7 A;  3UE1 A;  2BA1 A;  3RUZ A;  4LJZ C;  2AHO B;  1Q86 C;  4HIK A;  4K8J A;  2L9H A;  2MPM A;  3NK9 A;  5JBW A;  3GTM B;  2PQA B;  2VL6 A;  1S5C D;  2DY7 A;  3DMU A;  3GDE A;  2LXK A;  1SYF A;  2J4X A;  4JI0 L;  2ALY B;  1FVI A;  2AMC B;  4DV7 Q;  4HJA A;  1IYJ B;  2KJX A;  5CGK A;  1PTO F;  4JI5 L;  5KNC A;  3CCQ A;  1PZJ D;  3VR6 A;  1HTP A;  4KD4 A;  3S2H B;  4LFB L;  2F0E A;  4K3W A;  2UUC L;  1V1O A;  1NZY A;  2EJ5 A;  3K57 A;  2M9V A;  1PH6 A;  1NR2 A;  3SEB A;  2J0T D;  5AFW A;  3BG3 A;  3U50 C;  2EZV A;  5KRU A;  4LF6 L;  4IQZ A;  2H4O A;  4RKL A;  1BOS A;  1SRO A;  1F77 A;  1XX8 A;  1JIC A;  3TP8 A;  2TMP A;  4I7Z C;  5EKK A;  3CCU A;  3PZK A;  1SND A;  5IGB A;  4LF9 L;  2B8G A;  2NTS A;  2N3S A;  5EAY A;  4AH6 A;  3VYT A;  1KLG D;  2I0Q A;  3NTK A;  2L15 A;  1K9M C;  2FIN B;  4OO1 I;  4BBR G;  5JJZ A;  1K73 C;  2PI2 E;  3EJI A;  2XWB B;  4B3T L;  1X32 A;  1FGB D;  2ZXP A;  3KLS X;  1Y69 U;  2L11 A;  5C5L A;  4A3L H;  2B2V C;  2F0F A;  2BDO A;  4QJF A;  4RWS C;  3TP5 A;  4MI2 A;  3I91 A;  5E1F A;  4XIG S;  1LT4 D;  2SOB A;  2FW2 A;  1IBL L;  3HGB A;  2RDF A;  2PPB C;  3X3M A;  2HCI A;  1OXV A;  3OIP A;  5JJL A;  4GLA C;  1MI2 A;  2E8G A;  4A3J G;  1K8G A;  1A8V A;  1O7I A;  2JN4 A;  3KF6 B;  3CQZ B;  5JVG 3;  5AJ3 Q;  5ELC A;  3SK6 A;  3CME A;  5KND A;  4HN7 A;  4PZ7 A;  4HCS A;  1IBK Q;  2NVQ H;  3SDZ A;  4JOT A;  4V0B A;  4TSS A;  1SJH D;  4GS3 A;  3KBG A;  1KL9 A;  3J81 i;  1XNQ Q;  2UUA Q;  5DAU A;  1ROD A;  1XJV A;  5IP7 H;  2EY2 A;  5FLX L;  4OGQ C;  2L4N A;  4RHS A;  3B6Y A;  3ERQ A;  1K0S A;  2O4X A;  4X64 Q;  1E7Z A;  5FLM H;  2BDN A;  2R7D A;  4CDF C;  4EML A;  2MQH A;  1ENC A;  4WJ3 M;  1VMC A;  3A7L A;  1MJE A;  3IFD A;  4A93 B;  2K28 A;  1MKH A;  4JCV E;  1HNZ Q;  3A5Z B;  4AYB E;  1G29 1;  2B2Y A;  3KDF B;  4KK7 A;  3ULP A;  1WOC A;  5CV6 A;  4C3J H;  2R93 G;  4IJL A;  4NP5 A;  1XNR L;  4UHV A;  3U4V A;  3M4Q A;  3MFG A;  1AZP A;  3S1R B;  1QCB D;  1VQ4 A;  2E5L Q;  1TS3 A;  4LF4 Q;  1DOM A;  3FPP A;  3BJU A;  3D6W A;  4OIK A;  1VQJ A;  2B2W C;  2E76 C;  1KRT A;  1KAB A;  1ZYR C;  3VR3 A;  4FF4 A;  1IKL A;  3S15 B;  1F2Y A;  1PH3 A;  2R61 A;  3I4O A;  4YCU A;  1WVL A;  1JE4 A;  4DV4 Q;  4A3F G;  1JOO A;  4GKK L;  2NTT A;  1L0X B;  2F0J A;  4GNX B;  3OTO Q;  3LX0 A;  3PF5 A;  4OWX B;  2QEX A;  2K52 A;  4H44 C;  1GM5 A;  2V4D A;  4IUQ A;  1V8Q A;  5T1I A;  5FK9 C;  4XDX A;  1PLF A;  2YU9 B;  4Y7N H;  1S72 A;  2E75 C;  4P73 A;  1KTK A;  3G71 A;  1SE3 A;  1TXY A;  3BDC A;  4RGN A;  3RZO B;  2KED A;  4K14 A;  1YNN D;  1EZ6 A;  1IXR A;  1Y1W H;  5GAE C;  2UU9 Q;  1D5M C;  4X3K A;  3PO2 H;  3K58 A;  4KI0 A;  4H0L C;  1RKN A;  5DLQ E;  2JA7 G;  3GTJ H;  1EOV A;  4KKS A;  1WZ8 A;  1I4P A;  4DR5 L;  4KY7 A;  4NW2 A;  5JEA G;  1N32 L;  1N36 L;  4IPH A;  5I9O A;  2F4V Q;  2MFI A;  3HOZ H;  2HIX A;  1UX4 A;  4HJ5 A;  3I4M G;  1NMG A;  1HR0 L;  1OXU A;  2AWN A;  4DNT B;  3QXI A;  3T1H L;  5M3M G;  4IZB A;  4O42 A;  4IAL A;  3K5L A;  4MOU A;  2B39 A;  1SR3 A;  5FJ8 G;  4DV5 L;  1VMP A;  3K0Y A;  1S5B D;  3DHQ A;  3ZYY X;  4FVM A;  1K3B C;  5LHY 1;  4DAM A;  4B3S Q;  1AN8 A;  4JI8 L;  2F1M A;  4CJ0 B;  2ICE C;  3QR8 A;  1YVC A;  2XWJ B;  4X65 Q;  1FJG L;  3AFP A;  4DR1 Q;  2L5T A;  4C3J G;  4IFD I;  2Q8T A;  4ZKB B;  4JI7 Q;  3NBH B;  2VQE Q;  1TKW B;  3H3V H;  3S1Q H;  1HNX Q;  1E2V A;  4A3M H;  2DNC A;  1DUB A;  5EQ0 A;  2LMC B;  3P75 A;  1RTN A;  4X3S A;  3SK5 A;  4G7Z C;  5ELO A;  4B08 A;  4A4I A;  5JAV A;  1CZG A;  1I50 H;  2K50 A;  3GTM H;  1GHJ A;  3NQI A;  4BA1 I;  4GNX C;  3S17 B;  1FNU A;  3CCE A;  2A8V A;  1BUV T;  1QB5 D;  1STH A;  3NBI A;  1TWC B;  3HKZ G;  1M8A A;  3F2D A;  3A4N A;  3T53 B;  3VDY A;  2QKI C;  2HQE A;  2X6L A;  4QIW E;  1N33 L;  1SN8 A;  1VQI A;  5D65 A;  2K4K A;  2F3V A;  2BH2 A;  5C3X A;  3TBI B;  1ZEQ X;  1VCI A;  2WIN B;  3K7A B;  2VUM H;  1DYQ A;  3MFY A;  4RCN A;  3GTL H;  1OXT A;  4OHJ A;  1JJC B;  1Y1W G;  3CXC A;  3J7A V;  2Z0S A;  3A5U A;  2RCN A;  1XPR A;  1B50 A;  3CCS A;  2PPY A;  1STG A;  1ASY A;  5BN3 A;  1EL0 A;  5C4X B;  2JA5 G;  2UUB Q;  4KD3 A;  5IWA Q;  4L5R C;  4FJW D;  2KEN A;  3I2Z A;  3SLL A;  1X3F A;  2F52 A;  4JG2 A;  4IO9 A;  1ET6 A;  3W1B A;  3LGJ A;  2JYO A;  2QA4 A;  5ISR A;  4BWG B;  2C9O A;  3K5O A;  2VQF Q;  1PRT F;  4ZRZ A;  4JYA Q;  1CHQ D;  5BN4 A;  1BCP F;  2XN9 C;  3UE0 A;  5C3E G;  5EBD A;  3S1N B;  2PMZ E;  2ES2 A;  4A3G B;  3CQZ H;  3Q8D A;  2FJ2 A;  1AEX A;  3LWE A;  3RQG A;  4A3J B;  3M3Y B;  3Q22 A;  1TS2 A;  1L2F A;  1EQQ A;  1F9Q A;  4J6H A;  1A63 A;  4FZW C;  4L5S A;  3CC4 A;  5JEA J;  1JT8 A;  3CHB D;  4CHT B;  1HFN A;  2EPB A;  1F9P A;  4IUT A;  3TP6 A;  4A3M G;  4EQP A;  3JC6 6;  2HW5 A;  4CDD C;  2KQ3 A;  1YJ9 A;  4OWT B;  4HJ8 A;  3GO5 A;  3GP7 A;  4I65 A;  2OQK A;  3I4N B;  1PV4 A;  2CQO A;  1Q81 C;  5A35 A;  1NAP A;  2ZXO A;  4XXE A;  2NVY B;  1CQV A;  1K83 B;  3L9A X;  3I90 A;  4R4C A;  1QUQ A;  4LNQ A;  5LL6 S;  4U68 A;  1IHZ A;  4HMJ A;  2LS0 1;  1NZY B;  4H13 C;  1JB7 A;  4KHP L;  3NWS A;  3T8A A;  5C5M A;  3S1R H;  1EIH A;  5I2Y A;  5IIF A;  3NPP A;  1B70 B;  2R93 B;  2N88 A;  4KJN A;  1YHA A;  2KEC A;  4K0K Q;  1LYL A;  2XNA C;  1V1Q A;  4R4T A;  5E4X A;  3H91 A;  1BCP D;  2Q2H A;  2XRS D;  3TN2 A;  5CMD A;  1CKN B;  2F0V A;  4QQB X;  5J3B A;  5GAD C;  1A3U A;  3D8G A;  4DK6 C;  4A3C G;  3HOV B;  2B63 B;  4A3F B;  4G7O C;  2Z8L A;  3HZX A;  3J7Z C;  3G64 A;  2E2J B;  5K36 H;  1ZKO A;  1Y1V H;  4A3K B;  3WOE A;  3J7Y W;  3DWA A;  1VF5 C;  1FNV A;  2Z6K C;  4RG1 A;  4NMZ A;  3V96 A;  2D0P A;  5A2Q E;  2CVR A;  3V2T A;  1O7Y A;  1P16 A;  2RSO A;  4JI1 Q;  2F0L A;  2MHV A;  1NUC A;  4IUR A;  3P5M A;  2NN6 H;  1HZC A;  1UE5 A;  1CZW A;  1EWC A;  1SYC A;  1CTM A;  3KJP A;  2JA7 B;  1QVC A;  3MXN A;  3UDI A;  1LTB D;  2L55 A;  3OPO A;  4G57 A;  3I72 A;  4DUZ L;  4QUC A;  1BVS A;  2D9U A;  2EDG A;  2OCE A;  5IT9 c;  4DV0 Q;  3HOX H;  3J81 j;  1T5X D;  4GLV B;  4L5Q A;  3ITP A;  3I4M B;  3HOW B;  2MGS A;  1DON A;  1HNZ L;  3H0G B;  3Q1T A;  1W6K A;  3IFT A;  5TSS A;  4A93 G;  1VQF A;  4DV2 Q;  3Q0J A;  3DEO A;  5JPN C;  2H1E A;  2PI2 A;  1YNX A;  4WOR A;  4TVA B;  4HIM A;  1XPU A;  1AFP A;  3EN2 A;  1B9M A;  2KHS A;  4PZ6 A;  4R8I A;  1STA A;  1BO0 A;  1VQN A;  5C9G A;  2L12 A;  2YTX A;  3UDG A;  4LFC Q;  2I07 B;  2HHH Q;  2HQL A;  3BVZ A;  1PTO B;  3RZD B;  1PH5 A;  2DJF C;  3OSO A;  3AJM A;  1DGS A;  1F9S A;  1T9H A;  1WCM G;  3S1M B;  1S5E D;  1LTT D;  1K8O A;  1PFN A;  4C3I G;  3AU7 A;  3M7N A;  5KYL A;  2JK8 A;  3T1Y Q;  4HJ7 A;  1VS0 A;  3RN5 A;  2VNU D;  1FYC A;  1WD1 A;  1I4R A;  4UDU C;  3DLL A;  4RGO S;  1SLJ A;  3STB C;  1QNK A;  3C1E A;  2F0M A;  1IL8 A;  3NHH A;  1U4R A;  2AQ2 B;  2IHF A;  3W3A A; 
#chains in the Genus database with same CATH homology
 2L15 A;  3E0E A;  1K9M C;  4OO1 I;  2F3I A;  4BBR G;  4DV3 L;  3S16 H;  4P74 A;  2PI2 E;  1K73 C;  4B3T L;  4A3D G;  2GVA A;  4JI3 Q;  1L0W A;  5K36 G;  3KF6 A;  5IP7 G;  1LUZ A;  2XTI A;  3K7A H;  4A3L H;  3BZC A;  3W8H B;  1UE7 A;  5C0X I;  4QJF A;  2UXC Q;  1WCM H;  1Z47 A;  4YWM A;  3T1Y L;  1VQA A;  5FLM G;  3KOJ A;  4XIG S;  1M90 C;  1XTD A;  5IYB H;  1IBL L;  3S15 H;  4C3I H;  3KLW A;  5BR8 Q;  3RR5 A;  4A3B G;  1OXV A;  3BZK A;  5JJL A;  2KCM A;  1Q1B A;  4GLA C;  2E8G A;  3RLN A;  3PUV A;  4AIM A;  4A3J G;  5HY6 A;  1K8G A;  3E9I A;  1J5E L;  4YHH Q;  1A8V A;  1VQL A;  1O7I A;  3KF6 B;  1L1O C;  4BBS H;  2IX0 A;  3HKZ E;  5AJ3 Q;  2ZM6 Q;  1HR0 W;  3CME A;  1XMQ Q;  1CKM A;  1IL2 A;  3GTK H;  1PYB A;  2WP8 J;  4JI3 L;  1X9N A;  3PO3 H;  1UEB A;  1NY4 A;  4PZ7 A;  4BY7 H;  1IBK Q;  4UP9 A;  2NVQ H;  2WB1 E;  2I5H A;  2VY3 A;  4GS3 A;  3RNU A;  1KL9 A;  1TWF H;  3J81 i;  4BBR H;  3CMA A;  2UUA Q;  4NXN Q;  1XNQ Q;  4GOP C;  4A3D H;  1XNR Q;  2YU9 H;  1XJV A;  5IP7 H;  5GQO A;  1B8A A;  1QVF A;  1GO3 E;  3ZJY C;  1NMF A;  5BR8 L;  3RZO H;  3B6Y A;  5IP9 G;  1TWH H;  1PYS B;  2R7Z H;  4X64 Q;  1E7Z A;  5FLM H;  2YTY A;  2R7D A;  2ZTE A;  4JI6 L;  2MQH A;  4WJ3 M;  3FKI G;  1D8L A;  1TWA H;  1MJE A;  1PH8 A;  3M9B A;  1I94 L;  2K75 A;  5ELN A;  3NEM A;  3J80 c;  4A3B H;  4YHH L;  5C4J H;  1MKH A;  3HKS A;  4JCV E;  1HNZ Q;  3A5Z B;  3K81 C;  3F1Z A;  4AYB E;  5GAG C;  5AJ3 L;  2ZM6 L;  1G29 1;  1R9T H;  1XMQ L;  2B3G A;  4A3J H;  2VS1 A;  3CCJ A;  1VQ8 A;  1KXL A;  1QVG A;  1IBK L;  3KDF B;  3ULP A;  1XPO A;  2KCT A;  4GKK Q;  2I5M X;  1N32 L;  1WOC A;  3ER0 A;  2R6G A;  4NXN L;  1XNQ L;  1PFS A;  2R93 G;  4C3J H;  2UUA L;  4IJL A;  4IFD J;  2WB1 G;  1PA6 A;  1ASZ A;  3RN2 A;  1XNR L;  1VQ9 A;  3CPF A;  3U4V A;  4JBK A;  3M4Q A;  2PQA A;  1GVP A;  5FLX c;  3HOU G;  4GNX A;  1VQ4 A;  2E5L Q;  4LF4 Q;  3ICE A;  1HNW Q;  4J15 A;  4BY1 H;  2BA0 A;  4X64 L;  2F4V L;  4L5T A;  3BJU A;  2DGY A;  5M5Y H;  1W2B A;  1N34 Q;  1OXX K;  1VQJ A;  1NJI C;  1KRT A;  5IP9 H;  2D62 A;  2NVY H;  2IT1 A;  4ME3 A;  2H5X A;  2IHE A;  2UXD Q;  5LMU Q;  2NZH A;  1EFW A;  3FKI H;  1PH3 A;  1BBW A;  3I4O A;  3PO2 G;  4YCU A;  4JI4 Q;  4GKK L;  4DV4 Q;  4A3F G;  3GTG H;  2RF4 A;  5M5X H;  4LF6 Q;  4UP8 A;  1SE8 A;  4GNX B;  3FHW A;  3OTO Q;  4YY3 Q;  3K0X A;  2NVX H;  1N9W A;  4B3M Q;  5LMN W;  4LUO A;  3TS2 A;  3W5O A;  4KLK A;  3PF5 A;  4OWX B;  2QEX A;  2K52 A;  1GM5 A;  2E5L L;  4LF4 L;  4BA2 I;  1HNW L;  3PF4 A;  3HOZ G;  2CWA A;  2OTJ A;  2AKW B;  1YJW A;  2A19 A;  4DR5 Q;  3BU2 A;  5GAH C;  1N34 L;  1K3R A;  4GN5 A;  3HOU H;  3U4Z A;  1N32 Q;  1N36 Q;  4Y7N H;  3RLO A;  1YJN A;  1S72 A;  4P73 A;  1KRS A;  2EIF A;  3HFZ B;  3ULL A;  3G71 A;  1QZH A;  2R7F A;  2UXD L;  2JJQ A;  3O4X E;  1TXY A;  2YYZ A;  5LMU L;  1HR0 Q;  2NVT H;  2KHJ A;  4YCV A;  3I55 A;  3T1H Q;  4JI4 L;  4DV4 L;  1IXR A;  1Y1W H;  3HOY H;  4B3R Q;  5IYB G;  2NZO A;  3STB D;  2DUD A;  4PG3 A;  1E22 A;  5GAE C;  2UU9 Q;  3S17 H;  4FDB A;  3OTO L;  3PO2 H;  1UE1 A;  3AQQ A;  4KI0 A;  4YY3 L;  2B63 H;  4A3F H;  4DV5 Q;  4B3M L;  2MO1 A;  5DLQ E;  2JA7 G;  2NN6 I;  1I3Q H;  3GTJ H;  2ZJP A;  1EOV A;  1TWC H;  5M5W H;  4JI8 Q;  4IOA A;  5C4X G;  2E2J H;  4DR5 L;  4BBS G;  1Y64 B;  3KJO A;  4LF7 Q;  4O2D A;  2KBN A;  5JEA G;  4AQY Q;  2I5L X;  1X54 A;  2KHI A;  2EXD A;  2N78 A;  3CAM A;  4IPH A;  4EX5 A;  2GVB A;  3K80 C;  4DV1 Q;  1N36 L;  2MFI A;  2JQO A;  4NXM Q;  3IRB A;  4A3K H;  2RHS B;  4XTC S;  2HIX A;  2F4V Q;  3HOZ H;  1UX4 A;  4HJ5 A;  3I4M G;  1CUK A;  1NMG A;  1HR0 L;  1PH9 A;  1EQR A;  1OXU A;  1GD7 A;  2AWN A;  3T1H L;  4B3R L;  3L7Z C;  5M3M G;  1K8A C;  4JI2 Q;  1PVO A;  4LW1 A;  5JJI A;  5H1S E;  4DR2 Q;  3E9H A;  1SR3 A;  1YI2 A;  2UU9 L;  2R7Z G;  5FJ8 G;  4DV5 L;  2IX1 A;  3PIO A;  3AFQ A;  4A3G G;  4Y52 H;  4DNI A;  4DAM A;  4B3S Q;  4JI8 L;  2CKZ B;  1RL2 A;  4P71 A;  4LF7 L;  4JI6 Q;  4AQY L;  4A3E H;  2JA7 H;  1WYD A;  1YVC A;  4X65 Q;  3JAM c;  3CCM A;  4DV1 L;  1I94 Q;  3AFP A;  4DR1 Q;  3W8I B;  1OXS C;  2LXJ A;  5C4X H;  4X62 Q;  2MNA A;  4IFD I;  3TS0 A;  4OXP A;  4JI7 Q;  4IPD A;  3AYH B;  3NBH B;  2VQE Q;  3H3V H;  4C2M H;  4DK3 C;  3D0F A;  1HNX Q;  3S1Q H;  4JI2 L;  1BBU A;  4A3M H;  1BKB A;  1AE3 A;  4C3H H;  1VQM A;  3MEF A;  1Y14 B;  4DR2 L;  3HOW H;  3I4M H;  3KDF A;  3H0G H;  4BY1 G;  4X66 Q;  1QUQ B;  3I4N G;  3M4O H;  3S2D H;  2VUM G;  4RMF A;  5IE8 A;  3CPW A;  5M3M H;  4TQU S;  5GRO A;  2VW9 A;  5LMN Q;  1Q7Y C;  5ELO A;  2C35 B;  4A4I A;  1PH2 A;  4B3S L;  1KIX A;  1I50 H;  2K50 A;  3PGZ A;  3GTM H;  2Y0S E;  5FJ8 H;  4EQ5 A;  2MO0 A;  3S1N H;  4BA1 I;  1VQH A;  3G6E A;  1KD1 C;  1VQ5 A;  4A3G H;  4GNX C;  4X65 L;  2A8V A;  3CCE A;  4X6A H;  4LWC A;  4DR1 L;  4X62 L;  2WAQ E;  4MZ9 A;  1VQG A;  3TRE A;  1SRU A;  4QGU A;  3L0O A;  2V1C C;  1IZ6 A;  4DUY Q;  4JI7 L;  2VQE L;  3M3Y H;  3HKZ G;  1HNX L;  3F2D A;  3A4N A;  1YIJ A;  1WI5 A;  3U58 A;  3VDY A;  3RZD H;  2YTV A;  4X66 L;  4DR7 Q;  3M4P A;  4OX9 Q;  3S1M H;  4QIW E;  1N33 L;  1SN8 A;  1VQI A;  2K4K A;  2BH2 A;  5LMN L;  1D7Q A;  1L1O A;  4NPS A;  1SMX A;  1V43 A;  4GKJ Q;  3CC7 A;  1VCI A;  2VZA A;  3RLF A;  3I4N H;  3KFU A;  1Q1E A;  2VUM H;  2A1A A;  5IYC G;  4H02 A;  3GTL H;  2R92 H;  1OXT A;  4GOP A;  3L8I A;  1FL0 A;  1JJC B;  1JJ2 A;  1Y1W G;  3HOY G;  3A74 A;  1K83 H;  3CXC A;  2Z0S A;  2ZTC A;  2RCN A;  3A5U A;  1XPR A;  1HH2 P;  4DUY L;  2WAQ G;  1HZ9 A;  3RQF A;  4AYB G;  5C44 H;  3L8J A;  3CCS A;  2Q2U A;  3HOV G;  2B63 G;  3J7A 5;  2R93 H;  1Q12 A;  3ADC A;  2Z6K A;  1KQS A;  1M1K C;  4JV5 Q;  1ASY A;  3I56 A;  3F2C A;  4DR7 L;  1L1O B;  1VQO A;  4POG A;  1B7Y B;  1NTG A;  4OX9 L;  1JMC A;  2JA5 G;  2UUB Q;  4JOI C;  4DR3 Q;  3UDX A;  5IWA Q;  4KHZ A;  1P8L A;  4L5R C;  3GTQ H;  1PH1 A;  2JE6 I;  4GKJ L;  1EYG A;  2KEN A;  3I2Z A;  2F52 A;  1E24 A;  1X3F A;  4JG2 A;  4A3K G;  1UE6 A;  4IO9 A;  4GOP B;  2CWP A;  3OYY A;  2JA8 H;  3W1B A;  4YWL A;  3LGJ A;  4P72 A;  1A62 A;  3ADB A;  4NNQ A;  1EUJ A;  2QA4 A;  1Q46 A;  1VQE A;  1A0I A;  2WFW A;  3FP9 A;  2LSS A;  3KYH C;  4DPG A;  3J81 c;  4HJ9 A;  2VQF Q;  5IYC H;  1MJC A;  2OWO A;  4MNO A;  1EIF A;  4JYA Q;  2YV5 A;  1X56 A;  3MXN B;  3UE0 A;  5C3E G;  3D31 A;  4JV5 L;  3RQE A;  1TWG H;  2XGT A;  2PMZ E;  2ES2 A;  4OWW B;  3PCO B;  3CQZ H;  4OON A;  2UXC L;  2AWO A;  4O0A A;  3Q8D A;  3HOV H;  2UUB L;  1UX5 A;  5IY0 A;  4DR3 L;  3DM3 A;  1WFQ A;  5IWA L;  4A3E G;  4BXX G;  3RQG A;  4UY8 C;  4DR6 Q;  3F2B A;  4GN4 B;  3CD6 A;  2OTL A;  1IBM Q;  1L2F A;  3PUY A;  2JA5 H;  2K5V A;  2D0O A;  1EQQ A;  4JBJ A;  4JYA L;  1A63 A;  4KHP Q;  3WWV A;  4L5S A;  3CC4 A;  5JEA J;  1JT8 A;  1JJG A;  1CKO A;  1FJG Q;  5HGQ A;  2GN5 A;  4DAY B;  4A3M G;  3JC6 6;  2VQF L;  3HOW G;  2QGQ A;  3J80 i;  1KHI A;  1E1T A;  1LTL A;  1YZ6 A;  3H0G G;  4OWT B;  3GO5 A;  3W1G A;  4HJ8 A;  3TEH B;  3PIP A;  1G51 A;  2OQK A;  3A4M A;  3CCV A;  1PV4 A;  2E2I H;  4NB3 A;  2Q2T A;  2JA9 A;  1NBW A;  2JA6 H;  2OQ0 A;  2CQO A;  3CW2 C;  3K7U C;  1Q81 C;  4LF8 Q;  1YBY A;  3PUX A;  4LFA Q;  5C3E H;  1WJJ A;  2HT1 A;  4R4C A;  1QUQ A;  3ULJ A;  1PH7 A;  4LNQ A;  4A76 A;  4DR6 L;  1HZA A;  4R1J A;  1YEZ A;  2IY5 B;  3I7F A;  1IBM L;  2B29 A;  4JC0 A;  2BH8 A;  1HJP A;  1JB7 A;  1CKN A;  1XMO Q;  4KHP L;  1X55 A;  3PV0 A;  4BXX H;  1YJ9 A;  2HIV A;  1QZG A;  4IJH A;  4DKA C;  3S1R H;  4GN3 B;  4JBM A;  3PUW A;  1CSQ A;  1B70 B;  4GLX A;  2FXQ A;  2UXB L;  2ZTD A;  4POF A;  1Y1V G;  1YHA A;  3NEL A;  4DR4 Q;  2EQS A;  4A3I G;  1LYL A;  1E3P A;  3EIV A;  3NEN A;  4K0K Q;  1S3O A;  4HID A;  3PUZ A;  4LF8 L;  1V1Q A;  4R4T A;  3K8A A;  4LFA L;  4ALP A;  4IOC A;  1CSP A;  4UP7 A;  1N33 Q;  5IYD H;  4R4I A;  1RIP A;  2N8N A;  2Q2H A;  2R92 G;  1Q8K A;  1CKN B;  1FJG L;  2NN6 G;  1FGU A;  3A0J A;  4QQB X;  4LUZ A;  5J3B A;  5GAD C;  1XMO L;  3EBE A;  1VQ6 A;  1AH9 A;  1RJM A;  3ERS X;  4R4Q A;  4DK6 C;  3AM1 A;  5C44 G;  1U0L A;  1J6Q A;  4PZ8 A;  4A3C G;  2JEA I;  2JEB I;  2K5N A;  2ZJR A;  4LF5 Q;  1LM0 A;  4OO1 G;  3CCL A;  3J7Z C;  2ID0 A;  4DR4 L;  4K0K L;  1VQB A;  3G48 A;  1C9O A;  2Q2I A;  3CF5 A;  3S2H H;  2UXB Q;  3HOX G;  5C0X G;  4APV A;  4PMW A;  5JJK A;  2K14 A;  3L2P A;  1Y1V H;  2N49 A;  5C0X J;  2JA8 G;  4A3I H;  2Z6K C;  5E7N A;  1H95 A;  4RG1 A;  4DUZ Q;  1SFO H;  1W3S A;  3G4S A;  1X3E A;  2D0P A;  2RHQ B;  4A75 A;  1U5K A;  1S40 A;  1VQD A;  1P16 A;  2PNH A;  4JI1 Q;  2Y0S G;  4JBW A;  3PSI A;  3CP0 A;  1N8R C;  1HZC A;  1UE5 A;  4LF5 L;  4IFD G;  3GTO H;  1YHB A;  4DV6 Q;  1JE5 A;  4A3C H;  1K0R A;  3KJP A;  3KF8 B;  2P63 A;  3F8T A;  1QVC A;  3GTP H;  1KAW A;  3TQY A;  3UDI A;  3CCR A;  1KC8 C;  1EWI A;  4JI0 Q;  5M3F G;  2ATW A;  4DUZ L;  4IPC A;  1BVS A;  1HZB A;  2OCE A;  1MIU A;  1I5F A;  4YCW A;  5IT9 c;  3HOX H;  4DV0 Q;  1YIT A;  3SGI A;  4JI5 Q;  3H3V I;  3PO3 G;  4YWK A;  3J81 j;  4WJ4 A;  4GLV B;  4L5Q A;  1VQ7 A;  4JI1 L;  3UE1 A;  1HNZ L;  4LFB Q;  2BA1 A;  2UUC Q;  2AHO B;  4A93 G;  1VQF A;  4DV2 Q;  2JA6 G;  3JAM i;  3A4L A;  1Q86 C;  1OTC A;  4NXM L;  2PI2 A;  3UDF A;  4P75 A;  4DV6 L;  1YNX A;  4HIK A;  2CCZ A;  4LUV A;  1G6P A;  2PQA B;  2VL6 A;  1Z9F A;  1X6O A;  4TVA B;  4HIM A;  1XPU A;  1UWV A;  1E1O A;  3EN2 A;  1C0A A;  1Q82 C;  4QL5 A;  3GDE A;  4PZ6 A;  2LXK A;  4HIO A;  4JI0 L;  1VQN A;  3ADD A;  2ALY B;  1I6H H;  2YTX A;  1FVI A;  2AMC B;  4DV7 Q;  3CC2 A;  4HJA A;  1IYJ B;  3UDG A;  4MTN A;  1PH4 A;  1C7Y A;  4LFC Q;  4DV0 L;  1GKH A;  2HHH Q;  3S14 H;  2HQL A;  1X3G A;  4JI5 L;  4LF9 Q;  5M3F H;  3CCQ A;  1AE2 A;  1YHQ A;  1PH5 A;  4IPG A;  3S24 A;  2E2H H;  4A3L G;  4LFB L;  3AJM A;  1DGS A;  1T9H A;  1WCM G;  4DV3 Q;  1X65 A;  2UUC L;  1V9P A;  3H15 A;  4B3T Q;  3M85 A;  4DV2 L;  4JOI A;  1PH6 A;  4QY7 A;  3AEV A;  3U50 C;  4LF6 L;  3M7N A;  5IYD G;  2JK8 A;  3T1Y Q;  1PHJ A;  3GD7 A;  4HJ7 A;  1VS0 A;  4A93 H;  3RN5 A;  2VNU D;  4GEH B;  1SRO A;  4R4O A;  1IBL Q;  1EIY B;  3DLL A;  2ZJQ A;  1SLJ A;  1VQK A;  4DV7 L;  3STB C;  1VQP A;  3CCU A;  4LFC L;  4UPA A;  2ASB A;  2HHH L;  4LF9 L;  2IHF A;  3TRZ A;  3OW2 A;  2N3S A;  5EAY A;  4BY7 G;  2K5H A;  1VQC A;  4AH6 A;  2I0Q A;  2CFM A;  1NE3 A;  1J5E Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...