3IRBA

Crystal structure of protein with unknown function from duf35 family (13815350) from sulfolobus solfataricus at 1.80 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
KEGSLLRWYDVMEAERYEYTVGPAGEQFFNGLKQNKIIGSKCSKCGRIFVPARSYCEHCFVKIENYVEINKDEAYVDSYTIIYNDDEGNKLAQPVYIALIRFPNIEGGLLCYAEGNVKVGAKAKILSFQWPLRVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acyl-coa binding protein
molecule keywords uncharacterized protein from DUF35 family
publication title The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 27
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01796 OB_aCoA_assoc DUF35 OB-fold domain, acyl-CoA-associated
A PF12172 DUF35_N Rubredoxin-like zinc ribbon domain (DUF35_N)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.20 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3irbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3irbA02
1YJ9A 4DR7L 1VQ4A 4JYAQ 4YWMA 4AYBE 4LUVA 3STBD 1Q46A 1CSPA 1SMXA 5IYCH 1EIYB 2VY3A 2Z6KA 4A3BG 4DV7Q 3HOXG 1JMCA 3VDYA 2R93G 1EQRA 2BA1A 4DV4Q 3G4SA 4BBSG 3PO2G 1K9MC 4IPDA 1GM5A 4X66Q 4QGUA 1MJCA 4MTNA 3CCMA 4DV0L 1VQIA 1SFOH 4LF8Q 3BJUA 5C4XH 5M3MH 5GADC 5C3EH 3S1NH 3TS0A 4DR4L 4K0KQ 4L5TA 2VNUD 4AQYQ 1C7YA 3RZOH 4JI0L 1K83H 2DGYA 1N34L 2Q2UA 4JG2A 4NXMQ 4UP8A 3CCVA 3G71A 2UXBQ 2A1AA 3PIOA 2OQKA 4A76A 1PV4A 2EXDA 1Z47A 1KL9A 3EIVA 1EIFA 4HIDA 4DPGA 4DR2L 4X64L 1B70B 5M5YH 2YV5A 2L15A 3CC4A 1N32L 4C3JH 4IOCA 2OCEA 2RF4A 4LF6Q 1MIUA 2Q2TA 4R4QA 5M3FG 1E1OA 3K80C 3HFZB 2CWAA 2JA8G 4YHHQ 5E7NA 1YHQA 3F2CA 3D31A 1Q1EA 3PUXA 4JI7Q 1CSQA 4QIWE 2VW9A 2UUCL 1QVFA 1XNQQ 4LFBL 3J80i 2Q2IA 5IYCG 1IYJB 1Q8KA 1TXYA 3B6YA 4LF9L 4A3KG 1A63A 2KBNA 5JJKA 2NN6I 3CCSA 2HIXA 3E0EA 4GKKL 1EYGA 2BH2A 2PQAB 1TWHH 3HOVG 4R4OA 2FXQA 1LTLA 4IO9A 3M4PA 3MEFA 4J15A 5LMUL 1GD7A 1KRTA 2Y0SG 5IWAL 4GLXA 3T1YL 2ZTDA 4DR1Q 3FKIH 1WOCA 2NVXH 3M4QA 1N33Q 1IBKL 1XNRL 4P73A 3KDFA 3NELA 1L1OB 4ME3A 5IY0A 3I4MG 4LF4L 5GAEC 3KF8B 3S1RH 5FJ8H 4A3DG 1Y14B 1J6QA 3I4NH 1VQNA 1OXSC 4IJHA 4DV1Q 3GTKH 1JE5A 1U0LA 5GQOA 1V1QA 3TREA 2I5HA 5FLMG 3I7FA 4JI1L 1QZHA 1N9WA 2VS1A 3D0FA 3F2BA 4A3MH 4JYAL 4IFDJ 1ASYA 1KIXA 4BBRG 2Z6KC 3S14H 2K14A 1GO3E 5IP7G 3STBC 2GVBA 1FL0A 5C4JH 4RG1A 2K4KA 3PGZA 4YCUA 4DV7L 2F52A 4A3CH 1TWGH 2KCTA 4DV4L 4A3EH 1VQPA 4HJ5A 3KDFB 3RLOA 1P8LA 1OXXK 4P72A 1LM0A 3BZCA 4X66L 1K8AC 4DR6Q 2JA9A 1N32Q 1I5FA 5C44G 2Z0SA 5K36G 1VQ5A 1WCMH 2MNAA 1TWAH 4K0KL 5IE8A 5H1SE 1PFSA 4AQYL 3S1MH 1PYSB 3H15A 4DK6C 3AFPA 3FHWA 2KHJA 4JI4Q 2IHFA 2UXBL 3RR5A 3GDEA 1L2FA 1KHIA 4DK3C 3L0OA 3S16H 4A3BH 1JJCB 1YITA 1B7YB 2R93H 4LF9Q 2HHHQ 3I2ZA 4OWWB 4BBSH 3PO2H 4A3GG 4KHPQ 3UDIA 4GN4B 2LXKA 4A3IG 4DV6L 5C0XI 3HOWG 3E9HA 1D8LA 2K5HA 4HIOA 4GLVB 1T9HA 4JI7L 3U50C 3E9IA 3T1YQ 2YU9H 1B8AA 1L0WA 4DV2L 3CC2A 1VQJA 3H3VI 4YCVA 3MXNB 1X65A 4JBWA 3T1HQ 3HOYG 2AWNA 4XIGS 5ELNA 4QJFA 3GO5A 2KCMA 4C3IH 1E24A 1Q7YC 2NN6G 1UE1A 2WB1G 4XTCS 1YHAA 4Y7NH 5M3FH 4MNOA 2AKWB 4JI1Q 3TQYA 5GROA 2V1CC 1X9NA 1WI5A 2JA8H 1D7QA 1X6OA 3I55A 3DM3A 4MZ9A 4DR1L 1YIJA 1TWCH 1PHJA 2OTJA 1N33L 1PVOA 1PYBA 1N36L 1HH2P 2CKZB 4LUOA 3S17H 5JJIA 1IBLQ 1RL2A 3W5OA 4C2MH 2NVQH 1G51A 1X3EA 2H5XA 4DUZQ 3JC66 4DAYB 2E8GA 2E5LQ 2A19A 4WJ4A 4A3KH 1PH4A 1VQ8A 2VQEQ 5GAGC 3J81j 1X3FA 4KLKA 4OXPA 2K52A 4DV1L 3M7NA 4GN3B 1H95A 2OTLA 1X56A 4YCWA 1SRUA 3HOVH 4OO1G 1HZBA 4DAMA 4EX5A 4HIKA 3RN2A 1X55A 3CC7A 4JV5L 2QGQA 1KRSA 2CFMA 4A75A 2WB1E 3ULLA 2MO0A 4BXXG 4OWXB 4POFA 1PH9A 5HGQA 3S2HH 1WFQA 5IP9G 1EOVA 1XMQQ 1VQFA 3I4MH 2IHEA 4HJ7A 1YJWA 2K5VA 5IYDG 4A3DH 4B3MQ 2UXDQ 2UU9Q 2JA5G 3GTOH 1UWVA 2D0OA 4DR6L 3CD6A 1DGSA 2YTYA 2I5LX 5FLMH 4GS3A 1AH9A 1KXLA 1VQBA 3CP0A 4LUZA 4OO1I 3CCUA 1K73C 3ERSX 4DV6Q 5HY6A 4RMFA 4BBRH 1Y1WG 2E2IH 1Y1VG 4JI4L 5FLXc 4JI5Q 4OX9Q 5IP7H 1S40A 1W3SA 5M5WH 1YEZA 5AJ3L 3CCRA 4DV2Q 1Q1BA 4DV5Q 2HHHL 4KHPL 2IT1A 3CMEA 4JBJA 1IXRA 2YTVA 2QEXA 1NTGA 1XPRA 4C3HH 1ASZA 2JK8A 4FDBA 4HJ9A 4DR3Q 5M5XH 1PH5A 4LF7Q 1HJPA 4P74A 5C44H 3CMAA 2VL6A 3CCEA 3G6EA 3CQZH 1PH7A 3RLFA 3OTOQ 4Y52H 3PUWA 2NZOA 2VZAA 5JEAG 5C0XG 3CCJA 1AE3A 4L5RC 4DUYL 2A8VA 3KYHC 1YI2A 1HNZQ 1N36Q 2N8NA 4BY1G 3KOJA 1BBWA 2PMZE 4O2DA 3PUVA 4IPHA 1X3GA 3T1HL 1VQEA 1X54A 4NXNL 1VQOA 2NVYH 1XTDA 2ASBA 3PO3H 4JBMA 2PI2A 3K81C 2LXJA 4A3GH 2K5NA 1C9OA 1VQKA 1PH1A 1G291 2ZJPA 4A3IH 3K8AA 2VQFQ 3FP9A 4A3FG 3PUZA 3KFUA 4QY7A 2WAQG 3HOWH 4JV5Q 4A3LG 3CCLA 4GOPA 2WP8J 3S24A 1KC8C 3W1BA 1R9TH 1IBLL 2UUAL 2ID0A 1OTCA 2Y0SE 1KAWA 2HQLA 2JE6I 4DUZL 2E5LL 2B63G 2JA7G 1XPOA 1BBUA 2R7DA 2VUMG 3HOYH 4BY7G 2VQEL 4UP7A 1HNWQ 4DR5Q 2R7ZG 1K0RA 1YNXA 2ZM6Q 5GAHC 2ZTCA 3HKZG 2AMCB 1LUZA 3RLNA 2Q2HA 1QUQA 1Q12A 3TS2A 4LNQA 2E2JH 2WAQE 4GKJQ 2MO1A 1XMQL 4BA1I 4WJ3M 4P71A 4HJ8A 1J5EL 1XJVA 1EQQA 1I3QH 4GOPB 2UXDL 4B3ML 5AJ3Q 2UU9L 5BR8Q 1XMOL 3PO3G 3OYYA 4IJLA 1HR0W 4AH6A 3AQQA 2MQHA 1QZGA 2HT1A 2RHQB 1WYDA 1QVGA 1I94Q 1MJEA 4ALPA 4JI5L 4OX9L 4BXXH 2F3IA 2I5MX 1E1TA 4TQUS 4DUYQ 1QUQB 4B3TQ 2YYZA 5IP9H 4DV5L 2R92G 4A3JG 1LYLA 2B29A 5IYDH 1PA6A 4NXNQ 1FJGQ 4R1JA 2N3SA 4HJAA 1BVSA 2JA5H 1YJNA 2IY5B 4DR3L 3M85A 4LF7L 2RCNA 1K3RA 3F2DA 3ICEA 2R6GA 1Z9FA 1GKHA 1HZCA 1Q82C 2HIVA 3OTOL 2JA6G 3CF5A 1NMFA 1Y1WH 4JI2L 2C35B 2UUBQ 1Y1VH 4IPCA 4AYBG 3PF5A 4UPAA 1U5KA 4GNXC 4EQ5A 3U58A 1HNZL 2E2HH 3L2PA 4JI3Q 5ELOA 1NY4A 3EN2A 2UUAQ 3EBEA 2EIFA 3A5UA 3AYHB 4DKAC 2MFIA 1SN8A 3UDXA 1VQDA 2D0PA 4X6AH 1MKHA 4IPGA 2K75A 1SLJA 2VQFL 1EFWA 1SE8A 4GOPC 3PUYA 3CCQA 1JJ2A 3M4OH 3PV0A 4BA2I 2N49A 1O7IA 1JJGA 3TEHB 3RN5A 3GTGH 1VS0A 1M90C 4BY1H 3K0XA 4JI6L 4KI0A 2JEAI 4YWLA 5IYBG 5JEAJ 5C0XJ 3H3VH 4A93G 1J5EQ 1HNWL 1VQGA 3A5ZB 4DR5L 3J7A5 3K7AH 1HR0Q 4LF5Q 1PH2A 3HOZG 2ZM6L 2CQOA 2ZTEA 1IZ6A 1XMOQ 3G48A 1VQAA 1IBMQ 1OXVA 3J80c 3KLWA 4NPSA 4A3FH 3GTLH 4PZ6A 4PG3A 4A3LH 3GTPH 4GKJL 4OWTB 4LFCQ 4DV3Q 4QQBX 3ULJA 2ATWA 1A0IA 1SR3A 3KJPA 4X62Q 2XTIA 2NZHA 3WWVA 1OXUA 2B63H 2JA7H 2VUMH 2IX0A 1YBYA 5BR8L 2ZJQA 1CKMA 4BY7H 2D62A 4B3RQ 4YY3L 3GTJH 1VQLA 2R7ZH 2NVTH 4YWKA 5DLQE 1S72A 1I50H 1N8RC 3HOUG 2PQAA 1BKBA 2IX1A 3ULPA 3AFQA 4HIMA 4IFDI 1YZ6A 1CKOA 3H0GG 1I94L 4LFAL 1UEBA 1P16A 3F8TA 4JCVE 4A4IA 3CAMA 3J7ZC 4JOIC 2ES2A 3NENA 4JI2Q 4L5QA 4B3TL 1L1OA 4X65Q 4IOAA 1HNXQ 1Q81C 2JQOA 3CW2C 3J81c 4JI8L 3K7UC 4B3SL 1FJGL 1UE5A 1V9PA 4AIMA 4GNXA 3I56A 5J3BA 1EUJA 2UXCL 3PIPA 1QVCA 5EAYA 3CPFA 2I0QA 4LWCA 1V43A 4R4TA 3S1QH 4PZ8A 3ZJYC 4QL5A 3UE0A 4JBKA 3HKSA 1NBWA 2UUBL 2YTXA 3CXCA 4P75A 1VQCA 2CCZA 1HZAA 3F1ZA 4JI3L 2QA4A 5M3MG 1NJIC 1KD1C 5C3EG 5C4XG 2F4VL 4OONA 3GTQH 2XGTA 2R92H 4DR7Q 1OXTA 1S3OA 5JJLA 4POGA 2CWPA 2KHIA 4A3JH 4JI6Q 5LMNL 3PF4A 1NMGA 2PI2E 1VQHA 3PSIA 1NE3A 3A0JA 3NBHB 1KQSA 2AWOA 1JT8A 3SGIA 5LMNW 4UP9A 1GVPA 3A74A 1HZ9A 4GN5A 4GNXB 1K8GA 2KENA 2ZJRA 3S15H 3JAMc 3CPWA 3TRZA 1UE6A 1PH3A 2JA6H 3M3YH 1WJJA 2EQSA 3J81i 3GD7A 1I6HH 4DV0Q 3UDGA 2AHOB 3I4OA 1YVCA 3OW2A 4DR4Q 1C0AA 1M1KC 1HR0L 4LF5L 4JI0Q 2R7FA 1N34Q 1VQ7A 2GVAA 2ALYB 4LW1A 1IBML 4YY3Q 3Q8DA 1YHBA 3RNUA 2BA0A 2OQ0A 4X64Q 2LSSA 1VCIA 4DR2Q 1A62A 1E22A 3KJOA 3HKZE 3L7ZC 4LFAQ 4LFCL 4DV3L 4LF8L 1CUKA 2K50A 4H02A 2OWOA 4UY8C 2JEBI 4X62L 4APVA 3ER0A 1VQMA 4NXML 1AE2A 5IYBH 3FKIG 4JOIA 4A93H 4B3RL 1FVIA 2DUDA 3KF6A 4PMWA 3BU2A 3PCOB 1E7ZA 2GN5A 2B3GA 4R4CA 4GLAC 4JI8Q 2UUCQ 2PNHA 3UE1A 4B3SQ 4L5SA 3HOZH 1A8VA 3JAMi 4LFBQ 3HOXH 1EWIA 2UXCQ 5FJ8G 1SROA 3I4NG 3U4VA 1CKNA 3DLLA 4PZ7A 4LF6L 1L1OC 4O0AA 1PH8A 3AEVA 4IFDG 4GKKQ 4R4IA 2RHSB 1XPUA 2N78A 4YHHL 4A3MG 1PH6A 2JJQA 3BZKA 4X65L 1HNXL 3S2DH 3LGJA 5LMUQ 2F4VQ 5IWAQ 1XNQL 3NEMA 5IT9c 1UE7A 1W2BA 1E3PA 1IL2A 1FGUA 2WFWA 4JC0A 4KHZA 4TVAB 1IBKQ 1Q86C 5LMNQ 1XNRQ 4A3CG 3HOUH 3W1GA 4LF4Q 3KF6B 4DNIA 3IRBA 4NB3A 3M9BA 4A3EG 1RIPA 3U4ZA 3H0GH 1G6PA 1VQ6A 1JB7A 3GTMH 1TWFH 3RZDH 3UDFA 1VQ9A 2BH8A 1WCMG 1CKNB
chains in the Genus database with same CATH superfamily
3S1RB 4JYAQ 1GUSA 2CQAA 1YNJC 5KEEA 2QW7A 3GTKB 3MAQA 2HW5A 2K33A 2EY1A 4DV7Q 4RCOA 1JMCA 2R93G 2BA1A 3G4SA 3PO2G 4IPDA 5JBXA 4RH6A 3D4RA 3TLFA 4MTNA 4DV0L 3PF4A 1CT1D 3BJUA 3I90A 3Q6SA 2Q8IB 3TDQA 5C4XH 3Q0AA 3S1NH 4K0KQ 1SNMA 2EDGA 1N34L 4NXMQ 2OEOA 4UP8A 3CCVA 3G71A 2UXBQ 1RF2D 1CQFA 4G7OC 1KL9A 3EIVA 3K5OA 4DR2L 1NCVA 2L11A 2M00A 4C3IG 2YV5A 2L15A 4C3JH 2QDBA 4IOCA 2EE1A 1MIUA 1SAPA 3D6CA 1VMCA 1F2ZA 3HFZB 3NQTA 1FNWA 2R93B 5E7NA 3SK5A 4RGMA 4DAVA 2EYHA 2JXMB 1CSQA 3NBIA 4QIWE 2UUCL 2Q2IA 3A7LA 1IYJB 4DGZA 2Z9HA 4K8JA 3K58A 1Y8NB 2BCOA 1B44D 1QWYA 1TY0A 4R4OA 1GJXA 1LACA 4I42A 1ET6A 1LTLA 3MEFA 5IWAL 2Y0SG 3BS1A 1G6ZA 1N33Q 4TRDA 4CGYB 1LTRD 4V0BA 3GQBA 5FJ8H 3VYSA 3IAYA 1OXSC 3M4YA 4HSVA 4IFDH 2B2YA 4PMCA 2I5HA 2B2TC 4C2MB 2VS1A 4JYAL 1PZKD 2Z6KC 1HUMA 3S14H 5E4WC 1GO3E 5IP7G 2MJ8A 3STBC 2F0SA 5F2DA 1STAA 2E2DC 4DV7L 1TY2A 4RA8A 1TWGH 3TP8A 2Y0SB 1K8AC 4DR6Q 4BY1B 5C44G 2Z0SA 4HR7B 1CA6A 1VQ5A 2AUJD 4K0KL 1F2LA 3AFPA 1Q90A 2KHJA 1W6KA 4RFBA 2IHFA 4JI4Q 2UXBL 3RR5A 3NWTA 2K5DA 4CJ0B 3S16H 5FLXL 4A3BH 1B7YB 4B9WA 1MI2A 4OWWB 4Q0FA 2E75C 3NHHA 3BVZA 2L4NA 2EY5A 4KD4A 1VDZA 1PFNA 4NW2A 4BY7B 3HOWG 4KY5A 3I73A 4K14A 4JBWA 3DMUA 3MC0B 3HOYG 2AWNA 5ELNA 2KCMA 2EYLA 3M7GA 1U4MA 1RDPD 1E24A 1NSNS 2WB1G 2LFNA 4XTCS 5M3FH 2IPKD 4JI1Q 2F6QA 2V1CC 1X9NA 1WI5A 1X6OA 1PHJA 2DJFC 1TWCH 1N33L 1N36L 3S17H 5JJIA 1IBLQ 3W5OA 2PO4A 2NVQH 1SEBD 4DUZQ 2FMCA 1VQ8A 4DU9A 4B08A 3M7NA 1H95A 4OXPA 1EZ8A 1SDFA 1ONLA 2R92B 4DAMA 3CC7A 3HOYB 1CK1A 1KRSA 2QGQA 2G9DA 4JFCA 1I4RA 1DXMA 1XMQQ 1IKMA 1MSHA 3DUZA 1YJWA 3S15B 4A3DH 3DEPA 1SNOA 3R0OA 1Z6HA 2JA5G 4DR6L 1H9SB 2EYPA 3E5SA 1I3QB 4DV6Q 4JI4L 2NYZD 4JI5Q 2L55A 4OIJA 2KOLA 3KQFA 1PTOC 3CCRA 4DV2Q 4DV5Q 4DN4M 3MWYW 1JWUD 1R4QB 3TZDA 1NTGA 5KYIA 4XQNA 4LF7Q 1HJPA 4MIUA 1LTAD 1RJTA 1BR9A 2O4XA 3G6EA 3CQZH 4Y52H 2VZAA 2K28A 1YI2A 1HNZQ 4IPHA 1X3GA 1VQEA 2NVYH 1RTOA 1EYDA 4ULLA 3PO3H 2PI2A 4A3GH 1VQKA 1HZDA 4I52A 1G291 1TS4A 3FP9A 3RMHA 2CW0C 4A3LG 1BXTA 2WP8J 2QF7A 2F0PA 2AQ1B 1IBLL 5BN4A 3BDLA 2UUAL 4F87A 2Y0SE 2DNEA 1OTCA 2HQLA 3K6OA 4DUZL 2B63G 2JA7G 3FDUA 1TWFB 4K2KA 1LTGD 2J7ZA 2EYJA 2R7ZG 1YNXA 2WV6D 5FKAC 1FNUA 2K5QA 2ZM6Q 5GAHC 4EMLA 4CDCC 3WOFA 1Q12A 3OHXC 2E2JH 1HQMC 3QXZA 4C1NK 4U673 1XMQL 4CJ1B 4WJ3M 4JOTA 4ZAIA 2F0LA 1J5EL 2B8GA 1EQQA 4WORA 5M3MB 3EJIA 2MQHA 1LABA 1D5XC 2RHQB 5C3WA 2B63B 5I2YA 1I94Q 3IL8A 4JI5L 4ALPA 3GTJB 2F3IA 1SYBA 2OXPA 2YYZA 4DV5L 2LKVA 4XT3B 4IZDA 1FJGQ 4R1JA 1DD2A 1KDAA 1RD9D 2DN8A 4H13C 3J81L 3M85A 4LF7L 5C6AA 3F2DA 2VB3X 4UHVA 1Q82C 4S3SA 4JI2L 2UUBQ 1Y1VH 5JAVA 4IPCA 4RCNA 4UPAA 1U5KA 1HNZL 2E2HH 2PPYA 3L2PA 1I4HA 3SK4A 2KJXA 3S1QB 3T8AA 3KUPA 3A5UA 4RHSA 4DKAC 2MFIA 1BBXC 1TWHB 1V1OA 3W3AA 4IN3A 2Z6BA 1EFWA 2K75A 4IUQA 2WACA 2PBPA 3T56B 2L12A 4M8AA 2NVXB 3MTSA 3RN5A 1IKLA 1KABA 5IIFA 5C0XH 3ADCA 3Q24A 3VYUA 5IGBA 4BY1H 2F0EA 4YWLA 3TSSA 4XQJA 2RDGA 3C2PA 3J7A5 5ELEA 1HR0Q 1PH2A 1A2UA 3T89A 2ZM6L 3A8JE 1VQAA 3ITPA 4KJNA 1OXVA 1JE4A 2RA4A 4ZKBB 3MYBA 3PIO3 2ENBA 4PZ6A 4PG3A 4ZYSA 4ELSA 3QWNA 1G91A 4OWTB 4LFCQ 4WFN3 2A6HC 2A68C 2NTTA 4X62Q 1PMRA 1QCBD 1QOHA 4BY7H 4ZKCB 4QF4A 1VQLA 4Q5VA 2NVTH 3FPPA 2F0VA 1N8RC 4K5XA 1UNSA 1I94L 3I8ZA 1P16A 3TRRA 1H9RA 2L1BA 1PRTC 4JOIC 1SXTA 3ERQA 3HOXB 2EJ5A 1KDBA 4BBSB 2JQOA 5BN5A 3HS0C 4R8NA 1IHZA 1FJGL 4B3SL 1UE5A 5DEHA 3D4DA 3VYTA 5IT9L 4FF4A 2I0QA 2SEBD 1V43A 1J8IA 2QEJC 2QCPX 3ZJYC 3UE0A 2YU9B 2UUBL 4P75A 3JAME 2K01A 1KD1C 5C4XG 2XGTA 2R92H 4DR7Q 1OXTA 3BVGA 1EL0A 2DUBA 5A2QL 2CWPA 4A3JH 3GTMB 2X6GA 1NE3A 4U19A 1IYUA 4LAAA 4ILWA 2ZJRA 3S15H 1NNXA 4C3JG 4I7AA 1B50A 1BO0A 3ZYYX 1WTPA 4NNQA 4A3KB 1T5EA 1YVCA 2ZT9C 5ELCA 4DR4Q 1HR0L 4DFAA 1EIHA 1RJMA 4ABNA 1QNUA 1IW7D 4I65A 4XXEA 3S1NB 1OO9B 2LSSA 3NTIA 1PFMA 2F0NA 3QB3A 3KJOA 1Z7TA 3L7ZC 4LFCL 1CUKA 2K50A 4H02A 1EFID 4X62L 2K6AA 3DM1A 3BU2A 1BCPD 2GN5A 2B3GA 3JAMi 1RKNA 2UXCQ 5FJ8G 4BBRB 2E2IB 1CKNA 3DLLA 3DEOA 5T1GA 1L1OC 4IFDG 3AEVA 5M5WB 4GKKQ 2N78A 1A3VA 2EYOA 3S2DH 2EYMA 2RQXA 1XNQL 2A73B 1W2BA 3J7YW 2WFWA 1IBKQ 1Q86C 4HTHA 4JW0A 5JBWA 4HEDA 4LF4Q 2ZXPA 1RIPA 3U4ZA 1TWFH 5D3IB 1KLGD 2EOTA 4DR7L 1I6VC 1QB5D 4YWMA 1CSPA 2HCIA 5IYCH 2VY3A 5FK9C 1EEID 4A3BG 1K3BC 4RGOS 3VDYA 2MGSA 1EQRA 2PPBC 2AQ3B 3DWPA 3D3RA 2ZQRA 4X66Q 4QGUA 1EYAA 3CCMA 4EQPA 1VQIA 1SFOH 1TS2A 5M3MH 3MZ5A 1CHPD 3TS0A 4DR4L 4AQYQ 1K83H 4X3TA 1YNND 1PV4A 2EXDA 1DCZA 1VMPA 4PV1C 1SYDA 3CC4A 2OCEA 2RF4A 1LO5D 4LF6Q 2Q2TA 4R4QA 5M3FG 3K80C 3S16B 4A3BB 4YHHQ 4B9XA 3D31A 1D1IA 1Q1EA 3KF8A 4EVOA 4F88A 4JI7Q 1ICWA 2A5HA 2XNAC 3I91A 5HGTA 3B6YA 1JB3A 3VR4A 3SEBA 1A15A 2FFKB 1DOLA 1O7LA 2NN6I 5JVG3 2HIXA 4GKKL 1TWHH 5EQ0A 1PFBA 1ET9A 1DONA 1GUGA 1KRTA 3T1YL 4DR1Q 3FKIH 1WOCA 2NVXH 3M4QA 3KK7A 1IBKL 1MSGA 3KDFA 2TMPA 2XN9C 5CBAE 5IY0A 4J6HA 4LF4L 1I4PA 5GAEC 1TS3A 4A3DG 1Y14B 4G4KA 3I4NH 1Y1WB 2PMZB 1TWCB 4DV1Q 4O42A 3S17B 3I7FA 3D0FA 3F2BA 4IFDJ 1ASYA 2HDMA 4FZWA 2VREA 1RJNA 2K14A 1SYFA 1S4ZA 2K4KA 2F52A 3OC7A 4EQOA 3M4OB 2A69D 1VQPA 1X3PA 3GTGB 1SJHD 2F0HA 3BZCA 5C5LA 1EF9A 4X66L 2JA9A 1HHVA 1SE3A 1I5FA 1EY7A 4KMUC 5TSSA 1WCMH 2G5DA 2HUGA 4AQYL 3MXNA 1HFGA 1PYSB 3H15A 3HG9A 3FHWA 1D6EC 3GDEA 1L2FA 1KHIA 4DK3C 5CMDA 1YITA 2WAQB 3R3OA 4BBSH 3GTPB 4A3GG 2LXKA 5CGKA 2KECA 3OMCA 5CV5A 1D8LA 3TP7A 2K5HA 4HIOA 4O1NA 4GLVB 4JI7L 2KEEA 1U4LA 2QKIC 2YU9H 3DWQA 1L0WA 1SNDA 3H3VI 4KTAA 4FF1A 4YCVA 5NUCA 2L0CA 2B2UC 4N9TA 4QJFA 4WJWA 3TBIB 3CQZB 1WZ8A 2X69A 5CORA 2IL8A 2Z1CA 5M9OA 1HFNA 1Q7YC 4G7ZC 2NVYB 2JA8H 3MHBA 4MZ9A 4DR1L 3PO3B 4A3GB 1ZYRD 2EJGC 1X3EA 4DAYB 2KCNA 4A3KH 2VQEQ 4KLKA 4N8X1 4DV1L 4ZQ3A 1SRUA 3HOVH 1LT4D 3I70A 4JV5L 1X55A 4KKUA 5T1IA 3OSOA 4OWXB 4HCEA 3OMGA 1EOVA 2IHEA 1B9NA 2K5VA 2UXDQ 4QUFA 1MGSA 3M3YB 2E2JB 3GTOH 1UWVA 5CV6A 1I6HB 1DGSA 2PNRC 4GS3A 2FMMA 4LUZA 1JC7A 1K73C 2F0FA 3ERSX 4BBRH 2WINB 2E2IH 1Y1VG 1EU3A 2L5TA 2K1BA 1MBYA 1S40A 5M5WH 2Z4IA 4C56C 1STHA 1UEAB 2IT1A 2PZUA 1CA5A 3G7LA 4JBJA 2QEXA 4DR3Q 5DM73 2HDLA 2F03A 4P74A 1GUTA 1PH7A 3NWSA 3RLFA 3OTOQ 3CCJA 2NZOA 5C0XG 4IUUA 1AE3A 2PCFB 4DUYL 4KK7A 1N36Q 4BY1G 3W8IB 2PMZE 1VQOA 2P63A 3H94A 1NZYB 3GV6A 4DNRB 3K81C 4IUTA 2LXJA 5CV7A 1Y1VB 1C9OA 4IZCA 2RKSA 2E2HB 2B2VA 3K8AA 2MP1A 1ESRA 4UDUC 2SOBA 5C4HA 3KFUA 4QY7A 3RQFA 4K6LA 1FGBD 1LV9A 3W1BA 3HOUB 1CI3M 5JPMC 4HAEA 3BYYB 1DCIA 3WOEA 3G64A 4BY7G 2VQEL 1QG7A 1K8OA 4UP7A 1SSOA 2HQEA 5FO9B 1LUZA 2PW7A 2Q2HA 4CJ2C 1QUQA 1WTQA 2WAQE 4K8IA 1Y8OB 1EWHA 5ELBA 2R3ZA 5C9GA 4GOPB 2UXDL 4FF3A 1LLRD 5EGTA 5BR8Q 4KY6A 5I4DA 5C3EB 4RGNA 1TKWB 1QZGA 2HT1A 3RZOB 1UUPA 4PQXA 1PZJD 5G3LF 3A4MA 3DHQA 2NVTB 4BXXH 2I5MX 1E1TA 4TQUS 2EJFC 1UX5A 4B3TQ 2R92G 4A3JG 2F3WA 5IYDH 1PA6A 4RWSC 4HJAA 1HCZA 4FF2A 4DR3L 2Z4HA 2RCNA 1K3RA 2R6GA 1Z9FA 4OL7A 2G9HD 1PTOB 1R4PB 3OTOL 1U4RA 3NTKA 1HQRD 3CF5A 1NMFA 1NUCA 1Y1WH 3QK8A 4AYBG 1Y69U 4EQ5A 1G2TA 1NY4A 2UUAQ 3Q0JA 1I4XA 3AYHB 1ICFB 3DXJC 4QIIA 1VQDA 2D0PA 4X6AH 2KEDA 4NEKA 4KHVA 4GOPC 3M4OH 4A3JB 1JJGA 5JEAH 5LL6S 1VS0A 3GTGH 2JN4A 1TS5A 1JQYD 3JAML 1JICA 3K0XA 4KI0A 5C0XJ 2IEXA 2WKDA 3F2UA 4MHEA 1J5EQ 3A5ZB 1ZEQX 1IZ6A 4AYBB 4A3MB 3SWXA 5CV8A 1WD0A 2WIIB 3T4AC 2H4OA 4Z9CB 1D1KA 4DA2A 3GTPH 4DV3Q 2F0MA 2ATWA 1SR3A 2XTIA 2NZHA 3LWUA 3WWVA 2VUMH 2IX0A 5BR8L 1MHWC 4ID6A 1GXDC 4YWKA 1ENAA 1S5BD 1IW7C 1TWAB 2IX1A 1I4GA 3ULPA 4CDEC 3S1MB 1YZ6A 1CKOA 3U9OA 4LFAL 3CAMA 3FPUB 3ND8A 4XYOA 2NTSA 3NENA 4JI2Q 4L5QA 5EBDA 4B3TL 1DUBA 1L0XB 3A56A 3HEJA 1HNXQ 1TT2A 1GUOA 3CW2C 4JI8L 1BCPC 1C48A 1V9PA 4GNXA 1ESFA 3PIPA 1DOMA 4MI2A 2EPBA 1NR2A 2TSSA 4NP5A 3HGBA 5EAYA 4LWCA 1JCKB 4R4TA 3S2DB 3BDOA 1JR0D 2DY8A 4QL5A 4JBKA 1JOQA 1KNEA 1NJIC 2QA4A 5M3MG 3ADDA 2F4VL 3BZDB 5FOBB 4XQQA 1S3OA 3QOJA 5IGEA 3OWEB 2A74C 2KHIA 5AFWA 3ONAB 4Y7NB 3NBHB 2D2CC 4UP9A 3E3XA 1G2SA 1HZ9A 4GN5A 5DAUA 1K8GA 3TRZA 2JA6H 1PH3A 3M3YH 1WJJA 3K5LA 1I6HH 4L63B 3T16A 1A2TA 4JI0Q 4F7XA 5D65A 2ALYB 1AW7A 5EPKA 1SFOB 3Q8DA 1V1PA 1IL8A 2BA0A 4X64Q 4MTKA 2P5ZX 1F9RA 1K83B 5L37A 4LF8L 4DV3L 2SNMA 3I4MB 3D4WA 2KHSA 1XXGA 2HD3A 4FXGC 1VQMA 1AE2A 5IYBH 3FKIG 4K2NA 4J8QA 1FVIA 3PCOB 4GLAC 4B3SQ 1A8VA 1EWIA 1XWEA 3I4NG 3PQIA 3U4VA 1O78A 1TU2B 4PZ7A 1XYIA 1PH8A 3HINA 2RCFA 3R2IA 1HNXL 4KV6A 2F0UA 5LMUQ 1NAPA 3GV3A 4JYLA 4C3HB 1XNRQ 2F4IA 1PRTB 3HOUH 4CBVA 3W1GA 3KF6B 3EVQA 3I47A 4NB3A 3H0GH 1G6PA 4DXGA 3FKIB 2XWBB 3UDFA 3J80E 3QG1A 1WCMG 1YJ9A 1STNA 4DK0A 3PZKA 1VQ4A 1ENFA 1TR5A 3I4NB 4AYBE 3STBD 5E4XA 1EIYB 2Z6KA 4K6DA 3HOXG 5ISRA 4DV4Q 3RQEA 3GP7A 4BBSG 1K9MC 4LMQD 1LTTD 2UZFA 1AP0A 4KJOA 3T13A 4RGTA 5C3EH 4L5TA 2VNUD 1C7YA 3RZOH 4JI0L 2DGYA 2Q2UA 4JG2A 2V4DA 2A6ED 5IGDA 3PIOA 1WTRA 1DYQA 3W2DA 1Z47A 1EIFA 2A69C 1WCMB 4LK1C 3C3LA 4V190 4X64L 3NXWA 4HCSA 1N32L 3EROA 1WTWA 1E1OA 2JA8G 2CWAA 3X3MA 1SNQA 3EA6A 4KD3A 2F0KA 1PTOH 5CV4A 1XNQQ 2VW9A 3J80i 1Q8KA 1TXYA 4LF9L 4KKTA 2LY7A 4A3KG 2KBNA 3HRXA 1EY5A 2LMCB 3CCSA 2BH2A 2KUMA 2D9UA 2ICIA 3HOVG 3MXPA 4OO1H 4LJZC 2FXQA 4GLXA 5LMUL 2MHVA 1GD7A 2M2LA 1JWSD 3C1EA 1XNRL 5HURA 3NELA 1L1OB 3VYRA 4J1MA 2JA8B 1JE5A 1U0LA 5DM63 3TREA 4F47A 1QJOA 3OWFA 4A3MH 1KIXA 4BBRG 2EY2A 1EQTA 3H02A 1FL0A 4ZRZA 4RG1A 4YCUA 3HOVB 3IKJA 2KCTA 3H09A 4DV4L 4HJ5A 3RLOA 3T51B 1P8LA 1OXXK 4P72A 1LM0A 4TKOB 3X3NA 1EQVA 3J7AV 1SBBB 4QIJA 3U9SA 4N8FA 1TWAH 5H1SE 1PFSA 3NTHA 1RHPA 4JPBW 3S1MH 4DK6C 3QR8A 3GTOB 3L0OA 1JJCB 5JOBA 3C1FA 3I2ZA 1SMYD 1GHJA 4OGQC 4FXDA 3ADBA 1ZKOA 4GZYC 3E9HA 3MEHA 1PYWD 1AEXA 2GA4B 3CHBD 4FO2A 5KIXA 4M1UB 3T1YQ 2EY6A 1RODA 3T1HQ 2E74C 4XIGS 4GEHB 2D5DA 1UE1A 1EY4A 4Y7NH 4MOUA 4MNOA 3TQYA 1XX8A 1D7QA 4JK1C 2CW0D 1SYEA 3I55A 1YIJA 2OTJA 4IUPA 3R9SA 3KLSX 1RL2A 3H3VC 2H5XA 1H9SA 2B2YC 3JC66 2B2VC 2E5LQ 3J7AF 5EJWA 1K0SA 5GAGC 1X3FA 2OTLA 1X56A 4YCWA 1DOKA 1X32A 5I9PA 2ICEC 5A35A 4N9PA 4BXXG 4POFA 5HGQA 1W6JA 3S2HH 1KAAA 2DY7A 3T88A 3QO2A 3I4MH 4R9WA 4HJ7A 5IYDG 4B3MQ 2X6LA 2UU9Q 3MVVA 2D0OA 2YTYA 2I5LX 5FLMH 3CP0A 1QE6A 2MPMA 1H9MA 1Y1WG 1FD7D 2NZ1D 5FLXc 4FVMA 1ILQA 4IZ8A 5AJ3L 1B3QA 2F1MA 1EEFD 2YTVA 2Q8RE 3IFDA 1LTBD 4C3HH 1PH5A 4FDBA 3CRKC 3SHLA 3CMAA 1UAPA 2PZTA 5IOCA 5K36H 4NMZA 3K5MA 5JEAG 2FINB 2H1EA 5CV9A 1JOKA 2N8NA 4EQNA 3KOJA 4O2DA 3T1HL 4NXNL 1X54A 1XTDA 2F0OA 2ASBA 4JBMA 2K5NA 3TZUA 1PH1A 4OLQA 5E1FA 4A3IH 3AMUA 2WAQG 1B53A 4JV5Q 1F77A 2SDFA 3S24A 2XWJB 1PRTF 1R9TH 5KYLA 5I2XA 2JE6I 3MOYA 2E5LL 1XPOA 4ZU2A 1BBUA 2VUMG 4H44C 1HNWQ 2ZXRA 5J22A 1LT5D 1ML0D 3HKZG 2AMCB 2NN6H 3WDNA 4QB4A 3TN2A 4JWVA 4K2LA 1FYCA 2A6HD 5IGFA 2L9HA 1BDOA 4P71A 1XJVA 1EY0A 4B3ML 2UU9L 1DJRD 3OIQA 1CZGA 3A8IE 1XMOL 3PO3G 1CQVA 1M8AA 4I4ZA 2CHBD 2XSCA 5DNFA 1WYDA 1QVGA 2VUMB 1MJEA 4ZCKA 3MFYA 1J9OA 1PDQA 3MXUA 2KCCA 4X3UA 4DUYQ 5K5PA 3HKZB 5IP9H 2LS01 5M5YB 1AN8A 1LYLA 2B29A 3CRLC 3SE0A 3VR6A 3BG3A 1BVSA 1YJNA 1MD2D 2RSOA 1GKHA 1HZCA 2QDLA 1D5MC 1B1ZA 2JA6G 5EPLA 1VF5C 5D3DA 3MA2B 3AJMA 4GNXC 3U58A 1WVLA 2CH4W 3NSWA 5ELOA 4WRDA 3EBEA 2DJGC 1SN8A 4XT1B 2KQ3A 4IALA 2F0TA 1MKHA 4IPGA 4IUVA 2B2WA 2BDOA 1SE8A 2NBFA 1Y64B 1JJ2A 1SNPA 3PV0A 4BA2I 2N49A 1TQOA 1GOZA 5CR3A 4YIJA 4ZK9B 3RUZA 1SYCA 4PNYA 4UAIA 4K5VA 1EZ6A 2JSOA 4JI6L 3N6RA 5IYBG 5JEAJ 3H3VH 1HNWL 1VQGA 3TP6A 3K7AH 2E76C 4LF5Q 2JA6B 2CQOA 3G48A 2MUYA 1FNVA 5FO8B 1GHKA 3A8KE 3H91A 4KNPA 4NPSA 4A3FH 5ELFA 2PW5A 3O4XE 2RVLA 5C4JB 4QQBX 5KGUA 1PZID 1A0IA 4A3EB 1OXUA 1CKMA 4B3RQ 3H6MA 4YY3L 4KY7A 1C8CA 4WCZA 5CYUA 1S72A 1I50H 3SXHA 3VR5A 3HOUG 1CTMA 1LTSD 3AFQA 1RTNA 4IFDI 5IGCA 3H0GG 4KN4C 3IFTA 4A4IA 4RHRA 3J7ZC 3BYTB 2ES2A 2F0QA 4CKCA 1L1OA 4X65Q 4IOAA 2PQEA 1Q81C 4P2CB 3Q23A 3PO2B 3J81c 2C9OA 3K7UC 4AIMA 5J3BA 1EUJA 1XTCD 2EJMA 1QVCA 1DM0B 1FR3A 4PZ8A 1HRJA 2YTXA 1VQCA 2CCZA 1HZAA 5C3EG 1EU4A 2F3VA 1SE4A 4OONA 3GTQH 1L0YB 4HMJA 3H0GB 4C3IB 1SE2A 5LMNL 4DAPA 1NMGA 2PI2E 2F0GA 2BE5D 1KQSA 2AWOA 2HCCA 3Q1TA 1K28A 1AFPA 5LMNW 1GVPA 3A74A 2FJ2A 2KENA 4XDXA 2O5IC 1A3TA 1UE6A 3J80L 3GD7A 3P5MA 3UDGA 3I4OA 4CDDC 4FP5D 3I72A 1M1KC 3K57A 4LF5L 2R7FA 1WTXA 2GVAA 4LW1A 3EQLC 1EY9A 3OOCA 2K7VA 2AUKA 2F0JA 3SDZA 1YHBA 4IZBA 3RNUA 2OQ0A 4XYQA 5KNBA 3NP8A 4BS9A 3HKZE 4LFAQ 4UY8C 4OO1G 2K5WA 2OWOA 2IWHA 4I7ZC 1KNAA 3SK6A 3ER0A 5E3FA 4NXML 1E0BA 4A93H 4B3RL 2DUDA 5JJLA 2A6EC 3KBXA 4L5SA 4JI8Q 2PNHA 4LFBQ 3HOZH 1EOTA 4O0AA 3NQIA 4IURA 1PH6A 3P7JA 4A3MG 2JJQA 3BZKA 4X65L 2GTRA 1VF7A 3LGJA 2F4VQ 3FRPB 3NEMA 3SVMA 5IT9c 3RSIA 1B3AA 5I6WA 1UE7A 1E3PA 1IL2A 4KHZA 4JC0A 4TVAB 5M5XB 3Q0GA 2BOSA 5C44B 1HPCA 4BWGB 1G8ZD 3IRBA 4DNIA 3M9BA 2IX3A 1VQ6A 5G3LD 1JB7A 5I6YA 1VQ9A 2BH8A 1BCPB 1BUVT 3K5NA 1CKNB 3ND9A 1RCVD 4LUVA 1EY6A 1Q46A 1SMXA 1EY8A 5EKIA 3HOWB 1JORA 2F0IA 1S5FD 1GM5A 1O80A 2BDNA 1MJCA 4LF8Q 5GADC 3AM1A 2CVRA 2O5JC 2RBMA 3O13A 4E6IA 1BF4A 2IW3A 2A1AA 2OQKA 4A76A 2WB1B 4HIDA 4DPGA 1HA5A 1S5CD 1BQQT 1B70B 1JOOA 2WKCA 3LNNA 4QUCA 5M5YH 3C46A 1IYVA 3SLLA 5EKLA 2NWGA 3FVQA 1ILPA 5JJZA 2NUCA 1YHQA 3F2CA 5JVH3 3PUXA 2KVMA 3HRZC 1QVFA 4LFBL 3FEWX 5IYCG 4DNTB 5IODA 1A63A 1JXZA 1WD1A 2DNCA 1SMYC 1F9SA 3V2TA 5JJKA 4OELB 3E0EA 1EYGA 2PQAB 4OG1A 1I4QA 1Q8IA 2B2UA 1AZPA 4RAUC 2ZQQA 1M4VA 1S5ED 4RKBA 4IO9A 3M4PA 4J15A 3PIP3 2ZTDA 2JA5B 2QQ3A 1YNJD 3HP3A 2J0TD 4P73A 1Y8PB 4ME3A 2RDHA 3I4MG 3S1RH 3KF8B 1J6QA 1VQNA 4IJHA 3RD4A 3GTKH 4F8MA 5GQOA 1V1QA 5FLMG 3S9WA 4JI1L 1QZHA 1Q52A 4RKLA 3T53B 1N9WA 1CZWA 1LTID 1D2BA 1PXUA 2GVBA 5C4JH 4QMGA 3PGZA 4CKEA 3VR2A 3QJYA 4A3CH 2SNSA 4A3EH 3KDFB 1WTVA 5IGGA 4C3HG 3S2HB 3K59A 1N32Q 3VA5A 5K36G 2EVBA 2Q8TA 3V05A 2MNAA 5IE8A 3VA7A 2KA7A 4JCSA 2I07B 3URYA 1YNNC 1D5ZC 4U18A 4G7HC 2R93H 1HTLD 4LF9Q 1F2YA 3GTLB 2HHHQ 4KHPQ 3QXIA 3PO2H 4H7BA 2M9VA 2XRQD 3UDIA 4GN4B 4A3IG 1EIGA 4DV6L 2JA7B 5C0XI 2R7ZB 1T9HA 2O2LD 4FXKC 3U50C 4DAYA 1UIYA 3E9IA 1B8AA 5LL6X 4DV2L 3CC2A 1VQJA 3MXNB 1X65A 5C3XA 1A6XA 3NUCA 5EPJA 3L8IA 3GO5A 1H9KA 3R2TA 2OT2A 4C3IH 3NPPA 1U4PA 2Z8LA 4CKBA 2NN6G 3LWEA 1YHAA 2AKWB 4IUNA 1AZQA 5GROA 4OIKA 3DM3A 1PVOA 5COYA 1PYBA 1HH2P 2B2TA 1SNCA 2CKZB 4LUOA 2PYKA 4C2MH 4A3IB 1G51A 4H0LC 2E8GA 4WJ4A 2A19A 5FO7B 3G6JB 1PH4A 3W8HB 3V96A 3J81j 2K52A 4GN3B 1DZ1A 4FZWC 1R9TB 2EZVA 1HZBA 1STGA 4EX5A 3RN2A 1ZXTA 2OF1A 2CFMA 4A75A 2WB1E 3ULLA 2MO0A 1PH9A 1B2TA 5FLXE 4ME5A 1WFQA 5IP9G 1VQFA 3A4NA 3CD6A 1U9RA 2FBMA 1AH9A 1KXLA 1VQBA 2CH4A 4OO1I 3CCUA 1NR4A 5HY6A 4U1AA 4RMFA 2VX2A 4OX9Q 5IP7H 1NZYA 5KNCA 1W3SA 1YEZA 1Q1BA 2HHHL 1B4OA 4KHPL 4KKSA 3CMEA 1IXRA 2C5CA 4CHTB 2PZWA 1XPRA 1ASZA 3BDCA 2JK8A 4HJ9A 1KDCA 3P75A 5M5XH 3OIPA 5C44H 4CDFC 4OHJA 1F2MA 2VL6A 3CCEA 3PUWA 1UX4A 1SYGA 4L5RC 2A8VA 3KYHC 3QOLA 1BBWA 3PUVA 5C5MA 1PTOF 1WTOA 2FW2A 1CM9A 2AQ2B 4ZUIA 2K05A 3KLSA 3I3CA 2ZJPA 2VQFQ 2NB0A 4A3FG 4FJWD 3PUZA 3HOWH 1QILA 3CCLA 4GOPA 1KC8C 1PLFA 1ZYRC 1STEA 2ID0A 3K0YA 1KAWA 2B2WC 2R7DA 4U68A 3HOYH 3RZDB 1C4QA 3OW7A 2EXZA 4DR5Q 1K0RA 1BCPF 1E2WA 3A54A 2ZTCA 4PMBA 4R8IA 3A7AB 3RLNA 2R61A 2B39A 1O7ZA 3TS2A 4DXFA 4NKLA 3K7AB 4LNQA 4GKJQ 3AB9A 2MO1A 4BA1I 3R9TA 1ENCA 4HJ8A 4K3WA 1PTOD 1I3QH 4A3FB 5AJ3Q 2RSNA 4TSSA 3E0JA 3OYYA 3MFGA 4IJLA 1HR0W 4AH6A 2K04A 5C4XB 5EBCA 3AQQA 5KJPA 1LT6D 1F9PA 1HTPA 2XRSD 4OX9L 1GUNA 1EYCA 1I50B 1QUQB 3E6ZX 5BN3A 1EWCA 2RDFA 4C3JB 3AU7A 4NXNQ 2N3SA 2JA5H 2IY5B 1STBA 2JP1A 2I46A 3ICEA 3SR1A 1K8MA 2HIVA 3D8GA 3L8JA 3SK8A 2C35B 2N88A 3P1HA 3PF5A 4QCLA 1F9QA 3N52A 4JI3Q 3EN2A 3NE5B 5I9OA 3FMCA 5J1ZA 2EIFA 5D14A 4ELXA 3UDXA 5LHY1 5ELDA 2VQFL 1SLJA 4L8JA 3OPOA 3PUYA 3CCQA 3GTQB 1KLUD 1O7IA 3KBGA 1KTKA 3TEHB 1M90C 3TMEA 2XIWA 3MXGA 3CU7A 2JEAI 4EGVA 4A93G 2K03A 4DR5L 1Q3LA 1WTHA 3Q22A 2BE5C 3HOZG 2ZTEA 1V8QA 1XMOQ 1IBMQ 3J80c 3KLWA 4KN7C 3S14B 4ELWA 3GTLH 1Q51A 2F0WA 3UI2A 1HXYD 4FYDA 4A3LH 4GKJL 4X3KA 1TVXA 3ULJA 1TWGB 5KNDA 4FNFA 3VR3A 3KJPA 5J39A 3R8BA 2B63H 2ZXOA 2JA7H 4X3SA 5C4ZA 1YBYA 5CC4A 2ZJQA 2JYOA 2D62A 2IJ0A 3J81E 3I4LA 3GTJH 2R7ZH 5DLQE 2PQAA 1BKBA 2F0DA 3EFXD 4HIMA 3D6WA 1UEBA 3F8TA 4JCVE 4OEMB 1CFMA 1E2ZA 4A93B 1MJ3A 3HOZB 3NBHA 4ZLTF 3H81A 3TP5A 3I56A 1BOSA 2FHTA 2UXCL 3L3OC 1GUWA 1HUNA 3BVMA 3CPFA 4QIWB 3S1QH 3PMFA 1T5XD 3HKSA 1NBWA 4MN3A 2EYFA 3CXCA 1TIID 1B9MA 2QILA 3F1ZA 4JI3L 4POGA 2VXWA 4JI6Q 2VB2X 1VQHA 3PSIA 2K32A 3A0JA 5M3FB 1BNZA 1JT8A 3SGIA 4ODGA 4GNXB 3JAMc 3CPWA 2EQSA 2NVQB 3J81i 4DV0Q 2AHOB 2A68D 3CKIB 3OW2A 1C0AA 1EY3A 3NK9A 1N34Q 1VQ7A 3R93A 3QIAA 2N55A 1IBML 4YY3Q 5EKKA 4DR2Q 1VCIA 1A62A 1E22A 5JPNC 1A3UA 1PRTD 3FDTA 2JEBI 4DF7A 4APVA 1JWMD 4A3DB 4ZUJA 1CHQD 4K5WA 4NDXA 1SJED 4JOIA 2B8FA 3KF6A 4PMWA 4HIKA 4L6TB 1E7ZA 1EF8A 4R4CA 5IT9E 1HA6A 2UUCQ 3UE1A 5CBEE 1STYA 3HOXH 3L9AX 2J4XA 1SROA 1S5DD 3KLRA 3P20A 1LT3D 1H9JA 4G57A 5KRUA 4LF6L 1V1PB 2RHSB 4R4IA 1XPUA 1E2VA 3RQGA 4YHHL 4HSPA 5A2QE 4HN7A 1QNKA 5IWAQ 4IQZA 1FGUA 3HZXA 4JVZA 3A4LA 1O7YA 5LMNQ 4A3CG 4HMIA 4DK1A 1X3QA 4A3EG 3DWAA 3GTMH 2XVSA 3RZDH 3A55A 1II3A 3LX0A 4C1NI
chains in the Genus database with same CATH topology
1YJ9A 4DR7L 1VQ4A 4JYAQ 4YWMA 4AYBE 4LUVA 3STBD 1Q46A 1CSPA 1SMXA 5IYCH 1EIYB 2VY3A 2Z6KA 4A3BG 4DV7Q 3HOXG 1JMCA 3VDYA 2R93G 1EQRA 2BA1A 4DV4Q 3G4SA 3RQEA 4BBSG 3PO2G 1K9MC 4IPDA 1GM5A 4X66Q 4QGUA 1MJCA 4MTNA 3CCMA 4DV0L 1VQIA 1SFOH 4LF8Q 3BJUA 5C4XH 5M3MH 3AM1A 5GADC 5C3EH 3S1NH 3TS0A 4DR4L 4K0KQ 4L5TA 2VNUD 4AQYQ 1C7YA 3RZOH 4JI0L 1K83H 2DGYA 1N34L 2Q2UA 4JG2A 4NXMQ 4UP8A 3CCVA 3G71A 2UXBQ 2A1AA 3PIOA 2OQKA 4A76A 1PV4A 2EXDA 1Z47A 1KL9A 3EIVA 1EIFA 4HIDA 4DPGA 4DR2L 4X64L 1B70B 5M5YH 2YV5A 2L15A 3CC4A 1N32L 4C3JH 4IOCA 2OCEA 2RF4A 4LF6Q 1MIUA 2Q2TA 4R4QA 5M3FG 1E1OA 3K80C 3HFZB 2CWAA 2JA8G 4YHHQ 5E7NA 1YHQA 3F2CA 3D31A 1Q1EA 3PUXA 4JI7Q 1CSQA 4QIWE 2VW9A 2UUCL 1QVFA 1XNQQ 4LFBL 3J80i 2Q2IA 5IYCG 1IYJB 1Q8KA 1TXYA 3B6YA 4LF9L 4A3KG 1A63A 2KBNA 5JJKA 2NN6I 3CCSA 2HIXA 3E0EA 4GKKL 1EYGA 2BH2A 2PQAB 1TWHH 3HOVG 4R4OA 2FXQA 1LTLA 4IO9A 3M4PA 3MEFA 4J15A 5LMUL 1GD7A 1KRTA 2Y0SG 5IWAL 4GLXA 3T1YL 2ZTDA 4DR1Q 3FKIH 1WOCA 2NVXH 3M4QA 1N33Q 1IBKL 1XNRL 4P73A 3KDFA 3NELA 1L1OB 4ME3A 5IY0A 3I4MG 4LF4L 5GAEC 3KF8B 3S1RH 5FJ8H 4A3DG 1Y14B 1J6QA 3I4NH 1VQNA 1OXSC 4IJHA 4DV1Q 3GTKH 1JE5A 1U0LA 5GQOA 1V1QA 3TREA 2I5HA 5FLMG 3I7FA 4JI1L 1QZHA 1N9WA 2VS1A 3D0FA 3F2BA 4A3MH 4JYAL 4IFDJ 1ASYA 1KIXA 4BBRG 2Z6KC 3S14H 2K14A 1GO3E 5IP7G 3STBC 2GVBA 1FL0A 5C4JH 4RG1A 2K4KA 3PGZA 4YCUA 4DV7L 2F52A 4A3CH 1TWGH 2KCTA 4DV4L 4A3EH 1VQPA 4HJ5A 3KDFB 3RLOA 1P8LA 1OXXK 4P72A 1LM0A 3BZCA 4X66L 1K8AC 4DR6Q 2JA9A 1N32Q 1I5FA 5C44G 2Z0SA 5K36G 1VQ5A 1WCMH 2MNAA 1TWAH 4K0KL 5IE8A 5H1SE 1PFSA 4AQYL 3S1MH 1PYSB 3H15A 4DK6C 3AFPA 3FHWA 2KHJA 4JI4Q 2IHFA 2UXBL 3RR5A 3GDEA 1L2FA 1KHIA 4DK3C 3L0OA 3S16H 4A3BH 1JJCB 1YITA 1B7YB 2R93H 4LF9Q 2HHHQ 3I2ZA 4OWWB 4BBSH 3PO2H 4A3GG 4KHPQ 3UDIA 4GN4B 2LXKA 4A3IG 3ADBA 4DV6L 5C0XI 3HOWG 3E9HA 1D8LA 2K5HA 4HIOA 4GLVB 1T9HA 4JI7L 3U50C 3E9IA 3T1YQ 2YU9H 1B8AA 1L0WA 4DV2L 3CC2A 1VQJA 3H3VI 4YCVA 3MXNB 1X65A 4JBWA 3T1HQ 3HOYG 2AWNA 4XIGS 5ELNA 4QJFA 3L8IA 3GO5A 2KCMA 4GEHB 4C3IH 1E24A 1Q7YC 2NN6G 1UE1A 2WB1G 4XTCS 1YHAA 4Y7NH 5M3FH 4MNOA 2AKWB 4JI1Q 3TQYA 5GROA 2V1CC 1X9NA 1WI5A 2JA8H 1D7QA 1X6OA 3I55A 3DM3A 4MZ9A 4DR1L 1YIJA 1TWCH 1PHJA 2OTJA 1N33L 1PVOA 1PYBA 1N36L 1HH2P 2CKZB 4LUOA 3S17H 5JJIA 1IBLQ 1RL2A 3W5OA 4C2MH 2NVQH 1G51A 1X3EA 2H5XA 4DUZQ 3JC66 4DAYB 2E8GA 2E5LQ 2A19A 4WJ4A 4A3KH 1PH4A 3W8HB 2VQEQ 5GAGC 3J81j 1X3FA 4KLKA 4OXPA 2K52A 4DV1L 1VQ8A 4GN3B 3M7NA 2OTLA 1H95A 1X56A 4YCWA 1SRUA 3HOVH 4OO1G 1HZBA 4DAMA 4EX5A 4HIKA 3RN2A 1X55A 3CC7A 4JV5L 2QGQA 1KRSA 2CFMA 4A75A 2WB1E 3ULLA 2MO0A 4BXXG 4OWXB 4POFA 1PH9A 5HGQA 3S2HH 1WFQA 5IP9G 1EOVA 1XMQQ 1VQFA 3I4MH 2IHEA 4HJ7A 1YJWA 2K5VA 3A4NA 5IYDG 4A3DH 4B3MQ 2UXDQ 2UU9Q 2JA5G 3GTOH 1UWVA 2D0OA 4DR6L 3CD6A 1DGSA 2YTYA 2I5LX 5FLMH 4GS3A 1AH9A 1KXLA 1VQBA 3CP0A 4LUZA 4OO1I 3CCUA 1K73C 3ERSX 4DV6Q 5HY6A 3T1HL 4RMFA 4BBRH 1Y1WG 2E2IH 1Y1VG 4JI4L 5FLXc 4JI5Q 4OX9Q 5IP7H 1S40A 1W3SA 5M5WH 1YEZA 5AJ3L 3CCRA 4DV2Q 1Q1BA 4DV5Q 2HHHL 4KHPL 2IT1A 3CMEA 4JBJA 1IXRA 2YTVA 2QEXA 1NTGA 1XPRA 4C3HH 1ASZA 2JK8A 4FDBA 4HJ9A 4DR3Q 5M5XH 1PH5A 4LF7Q 1HJPA 4P74A 5C44H 3CMAA 2VL6A 3CCEA 3G6EA 3CQZH 1PH7A 3RLFA 3OTOQ 4Y52H 3PUWA 2NZOA 2VZAA 5JEAG 5C0XG 1UX4A 1AE3A 3CCJA 4L5RC 4DUYL 2A8VA 3KYHC 1YI2A 1HNZQ 1N36Q 2N8NA 4BY1G 3KOJA 3W8IB 1BBWA 2PMZE 3PUVA 4IPHA 1X3GA 4O2DA 1VQEA 2P63A 1X54A 4NXNL 1VQOA 2NVYH 1XTDA 2ASBA 3PO3H 4JBMA 2PI2A 3K81C 2LXJA 4A3GH 2K5NA 1C9OA 1VQKA 1PH1A 1G291 2ZJPA 4A3IH 3K8AA 2VQFQ 3FP9A 4A3FG 3PUZA 3KFUA 4QY7A 3RQFA 2WAQG 3HOWH 4JV5Q 4A3LG 3CCLA 4GOPA 2WP8J 3S24A 1KC8C 3W1BA 1R9TH 1IBLL 2UUAL 2ID0A 1OTCA 2Y0SE 1KAWA 2HQLA 2JE6I 4DUZL 2E5LL 2B63G 2JA7G 1XPOA 1BBUA 2R7DA 2VUMG 3HOYH 4BY7G 2VQEL 4UP7A 1HNWQ 4DR5Q 2R7ZG 1K0RA 1YNXA 2ZM6Q 5GAHC 2ZTCA 3HKZG 2AMCB 1LUZA 3RLNA 2Q2HA 1QUQA 1Q12A 3TS2A 4LNQA 2E2JH 2WAQE 4GKJQ 2MO1A 1XMQL 4BA1I 4WJ3M 4P71A 4HJ8A 1J5EL 1XJVA 1EQQA 1I3QH 4GOPB 2UXDL 4B3ML 5AJ3Q 2UU9L 5BR8Q 1XMOL 3PO3G 3OYYA 4IJLA 1HR0W 4AH6A 3AQQA 2MQHA 1QZGA 2HT1A 2RHQB 1WYDA 1QVGA 1I94Q 1MJEA 4ALPA 3A4MA 4JI5L 4OX9L 4BXXH 2F3IA 2I5MX 1E1TA 4TQUS 4DUYQ 1QUQB 1UX5A 2YYZA 5IP9H 4DV5L 4B3TQ 2R92G 4A3JG 1LYLA 2B29A 5IYDH 1PA6A 4NXNQ 1FJGQ 4R1JA 2N3SA 4HJAA 1BVSA 2JA5H 1YJNA 2IY5B 4DR3L 3M85A 4LF7L 2RCNA 1K3RA 3F2DA 3ICEA 2R6GA 1Z9FA 1GKHA 1HZCA 1Q82C 2HIVA 3OTOL 2JA6G 3CF5A 3L8JA 1NMFA 1Y1WH 2C35B 2UUBQ 4JI2L 1Y1VH 4IPCA 4AYBG 3AJMA 4UPAA 1U5KA 4GNXC 4EQ5A 3U58A 3PF5A 1HNZL 3L2PA 2E2HH 4JI3Q 5ELOA 1NY4A 3EN2A 2UUAQ 3EBEA 2EIFA 3A5UA 3AYHB 4DKAC 2MFIA 1SN8A 3UDXA 1VQDA 2D0PA 4X6AH 1MKHA 4IPGA 2K75A 1SLJA 2VQFL 1EFWA 1SE8A 4GOPC 3PUYA 3CCQA 1Y64B 1JJ2A 3M4OH 3PV0A 4BA2I 2N49A 1O7IA 1JJGA 3TEHB 3RN5A 3GTGH 1VS0A 1M90C 3ADCA 4BY1H 3K0XA 4JI6L 4KI0A 2JEAI 4YWLA 5IYBG 5JEAJ 5C0XJ 3H3VH 4A93G 1J5EQ 1HNWL 1VQGA 3A5ZB 4DR5L 3J7A5 3K7AH 1HR0Q 4LF5Q 1PH2A 3HOZG 2ZM6L 2CQOA 2ZTEA 1IZ6A 1XMOQ 3G48A 1VQAA 1IBMQ 1OXVA 3J80c 3KLWA 4NPSA 4A3FH 3O4XE 3GTLH 4PZ6A 4PG3A 4A3LH 3GTPH 4GKJL 4OWTB 4LFCQ 4DV3Q 4QQBX 3ULJA 2ATWA 1A0IA 1SR3A 3KJPA 4X62Q 2XTIA 2NZHA 3WWVA 1OXUA 2B63H 2JA7H 2VUMH 2IX0A 1YBYA 5BR8L 2ZJQA 1CKMA 4BY7H 2D62A 4B3RQ 4YY3L 3GTJH 1VQLA 2R7ZH 2NVTH 4YWKA 5DLQE 1S72A 1I50H 1N8RC 3HOUG 2PQAA 1BKBA 2IX1A 3ULPA 3AFQA 4HIMA 4IFDI 1YZ6A 1CKOA 3H0GG 1I94L 4LFAL 1UEBA 1P16A 3F8TA 4JCVE 4A4IA 3CAMA 3J7ZC 4JOIC 2ES2A 3NENA 4JI2Q 4L5QA 4B3TL 1L1OA 4X65Q 4IOAA 1HNXQ 1Q81C 2JQOA 3CW2C 3J81c 4JI8L 3K7UC 4B3SL 1FJGL 1UE5A 1V9PA 4AIMA 4GNXA 3I56A 5J3BA 1EUJA 2UXCL 3PIPA 1QVCA 5EAYA 3CPFA 2I0QA 4LWCA 1V43A 4R4TA 3S1QH 4PZ8A 3ZJYC 4QL5A 3UE0A 4JBKA 3HKSA 1NBWA 2UUBL 2YTXA 3CXCA 4P75A 1VQCA 2CCZA 1HZAA 3F1ZA 4JI3L 2QA4A 5M3MG 1NJIC 3ADDA 5C3EG 1KD1C 5C4XG 2F4VL 4OONA 3GTQH 2XGTA 2R92H 4DR7Q 1OXTA 1S3OA 5JJLA 4POGA 2CWPA 2KHIA 4A3JH 4JI6Q 5LMNL 3PF4A 1NMGA 2PI2E 1VQHA 3PSIA 1NE3A 3A0JA 3NBHB 1KQSA 2AWOA 1JT8A 3SGIA 5LMNW 4UP9A 1GVPA 3A74A 1HZ9A 4GN5A 4GNXB 1K8GA 2KENA 2ZJRA 3S15H 3JAMc 3CPWA 3TRZA 1UE6A 1PH3A 2JA6H 3M3YH 1WJJA 2EQSA 3J81i 3GD7A 1I6HH 4DV0Q 3UDGA 4NNQA 2AHOB 3I4OA 1YVCA 3OW2A 4DR4Q 1C0AA 1M1KC 1HR0L 4LF5L 4JI0Q 2R7FA 1N34Q 1VQ7A 2GVAA 2ALYB 4LW1A 1RJMA 1IBML 4YY3Q 3Q8DA 1YHBA 3RNUA 2BA0A 2OQ0A 4X64Q 2LSSA 1VCIA 4DR2Q 1A62A 1E22A 3KJOA 3HKZE 3L7ZC 4LFAQ 4LFCL 4DV3L 4LF8L 1CUKA 2K50A 4H02A 2OWOA 4UY8C 2JEBI 4X62L 4APVA 3ER0A 1VQMA 4NXML 1AE2A 5IYBH 3FKIG 4JOIA 4A93H 4B3RL 1FVIA 2DUDA 3KF6A 4PMWA 3BU2A 3PCOB 1E7ZA 2GN5A 2B3GA 4R4CA 4GLAC 4JI8Q 2UUCQ 2PNHA 3UE1A 4B3SQ 4L5SA 3HOZH 1A8VA 3JAMi 4LFBQ 3HOXH 1EWIA 2UXCQ 5FJ8G 1SROA 3I4NG 3U4VA 1CKNA 3DLLA 4PZ7A 4LF6L 1L1OC 4O0AA 1PH8A 3AEVA 4IFDG 4GKKQ 4R4IA 2RHSB 1XPUA 2N78A 3RQGA 4YHHL 4A3MG 1PH6A 2JJQA 3BZKA 4X65L 1HNXL 3S2DH 3LGJA 5LMUQ 2F4VQ 5IWAQ 1XNQL 3NEMA 5IT9c 1UE7A 1W2BA 1E3PA 1IL2A 1FGUA 2WFWA 4JC0A 4KHZA 3A4LA 4TVAB 1Q86C 5LMNQ 1IBKQ 1XNRQ 4A3CG 3HOUH 3W1GA 4LF4Q 3KF6B 4DNIA 3IRBA 4NB3A 3M9BA 4A3EG 1RIPA 3U4ZA 3H0GH 1G6PA 1VQ6A 1JB7A 3GTMH 1TWFH 3RZDH 3UDFA 1VQ9A 2BH8A 1WCMG 1CKNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 A;  4DR7 L;  1VQ4 A;  4JYA Q;  4YWM A;  4AYB E;  4LUV A;  3STB D;  1Q46 A;  1CSP A;  1SMX A;  5IYC H;  1EIY B;  2VY3 A;  2Z6K A;  4A3B G;  4DV7 Q;  3HOX G;  1JMC A;  3VDY A;  2R93 G;  1EQR A;  2BA1 A;  4DV4 Q;  3G4S A;  4BBS G;  3PO2 G;  1K9M C;  4IPD A;  1GM5 A;  4X66 Q;  4QGU A;  1MJC A;  4MTN A;  3CCM A;  4DV0 L;  1VQI A;  1SFO H;  4LF8 Q;  3BJU A;  5C4X H;  5M3M H;  5GAD C;  5C3E H;  3S1N H;  3TS0 A;  4DR4 L;  4K0K Q;  4L5T A;  2VNU D;  4AQY Q;  1C7Y A;  3RZO H;  4JI0 L;  1K83 H;  2DGY A;  1N34 L;  2Q2U A;  4JG2 A;  4NXM Q;  4UP8 A;  3CCV A;  3G71 A;  2UXB Q;  2A1A A;  3PIO A;  2OQK A;  4A76 A;  1PV4 A;  2EXD A;  1Z47 A;  1KL9 A;  3EIV A;  1EIF A;  4HID A;  4DPG A;  4DR2 L;  4X64 L;  1B70 B;  5M5Y H;  2YV5 A;  2L15 A;  3CC4 A;  1N32 L;  4C3J H;  4IOC A;  2OCE A;  2RF4 A;  4LF6 Q;  1MIU A;  2Q2T A;  4R4Q A;  5M3F G;  1E1O A;  3K80 C;  3HFZ B;  2CWA A;  2JA8 G;  4YHH Q;  5E7N A;  1YHQ A;  3F2C A;  3D31 A;  1Q1E A;  3PUX A;  4JI7 Q;  1CSQ A;  4QIW E;  2VW9 A;  2UUC L;  1QVF A;  1XNQ Q;  4LFB L;  3J80 i;  2Q2I A;  5IYC G;  1IYJ B;  1Q8K A;  1TXY A;  3B6Y A;  4LF9 L;  4A3K G;  1A63 A;  2KBN A;  5JJK A;  2NN6 I;  3CCS A;  2HIX A;  3E0E A;  4GKK L;  1EYG A;  2BH2 A;  2PQA B;  1TWH H;  3HOV G;  4R4O A;  2FXQ A;  1LTL A;  4IO9 A;  3M4P A;  3MEF A;  4J15 A;  5LMU L;  1GD7 A;  1KRT A;  2Y0S G;  5IWA L;  4GLX A;  3T1Y L;  2ZTD A;  4DR1 Q;  3FKI H;  1WOC A;  2NVX H;  3M4Q A;  1N33 Q;  1IBK L;  1XNR L;  4P73 A;  3KDF A;  3NEL A;  1L1O B;  4ME3 A;  5IY0 A;  3I4M G;  4LF4 L;  5GAE C;  3KF8 B;  3S1R H;  5FJ8 H;  4A3D G;  1Y14 B;  1J6Q A;  3I4N H;  1VQN A;  1OXS C;  4IJH A;  4DV1 Q;  3GTK H;  1JE5 A;  1U0L A;  5GQO A;  1V1Q A;  3TRE A;  2I5H A;  5FLM G;  3I7F A;  4JI1 L;  1QZH A;  1N9W A;  2VS1 A;  3D0F A;  3F2B A;  4A3M H;  4JYA L;  4IFD J;  1ASY A;  1KIX A;  4BBR G;  2Z6K C;  3S14 H;  2K14 A;  1GO3 E;  5IP7 G;  3STB C;  2GVB A;  1FL0 A;  5C4J H;  4RG1 A;  2K4K A;  3PGZ A;  4YCU A;  4DV7 L;  2F52 A;  4A3C H;  1TWG H;  2KCT A;  4DV4 L;  4A3E H;  1VQP A;  4HJ5 A;  3KDF B;  3RLO A;  1P8L A;  1OXX K;  4P72 A;  1LM0 A;  3BZC A;  4X66 L;  1K8A C;  4DR6 Q;  2JA9 A;  1N32 Q;  1I5F A;  5C44 G;  2Z0S A;  5K36 G;  1VQ5 A;  1WCM H;  2MNA A;  1TWA H;  4K0K L;  5IE8 A;  5H1S E;  1PFS A;  4AQY L;  3S1M H;  1PYS B;  3H15 A;  4DK6 C;  3AFP A;  3FHW A;  2KHJ A;  4JI4 Q;  2IHF A;  2UXB L;  3RR5 A;  3GDE A;  1L2F A;  1KHI A;  4DK3 C;  3L0O A;  3S16 H;  4A3B H;  1JJC B;  1YIT A;  1B7Y B;  2R93 H;  4LF9 Q;  2HHH Q;  3I2Z A;  4OWW B;  4BBS H;  3PO2 H;  4A3G G;  4KHP Q;  3UDI A;  4GN4 B;  2LXK A;  4A3I G;  4DV6 L;  5C0X I;  3HOW G;  3E9H A;  1D8L A;  2K5H A;  4HIO A;  4GLV B;  1T9H A;  4JI7 L;  3U50 C;  3E9I A;  3T1Y Q;  2YU9 H;  1B8A A;  1L0W A;  4DV2 L;  3CC2 A;  1VQJ A;  3H3V I;  4YCV A;  3MXN B;  1X65 A;  4JBW A;  3T1H Q;  3HOY G;  2AWN A;  4XIG S;  5ELN A;  4QJF A;  3GO5 A;  2KCM A;  4C3I H;  1E24 A;  1Q7Y C;  2NN6 G;  1UE1 A;  2WB1 G;  4XTC S;  1YHA A;  4Y7N H;  5M3F H;  4MNO A;  2AKW B;  4JI1 Q;  3TQY A;  5GRO A;  2V1C C;  1X9N A;  1WI5 A;  2JA8 H;  1D7Q A;  1X6O A;  3I55 A;  3DM3 A;  4MZ9 A;  4DR1 L;  1YIJ A;  1TWC H;  1PHJ A;  2OTJ A;  1N33 L;  1PVO A;  1PYB A;  1N36 L;  1HH2 P;  2CKZ B;  4LUO A;  3S17 H;  5JJI A;  1IBL Q;  1RL2 A;  3W5O A;  4C2M H;  2NVQ H;  1G51 A;  1X3E A;  2H5X A;  4DUZ Q;  3JC6 6;  4DAY B;  2E8G A;  2E5L Q;  2A19 A;  4WJ4 A;  4A3K H;  1PH4 A;  1VQ8 A;  2VQE Q;  5GAG C;  3J81 j;  1X3F A;  4KLK A;  4OXP A;  2K52 A;  4DV1 L;  3M7N A;  4GN3 B;  1H95 A;  2OTL A;  1X56 A;  4YCW A;  1SRU A;  3HOV H;  4OO1 G;  1HZB A;  4DAM A;  4EX5 A;  4HIK A;  3RN2 A;  1X55 A;  3CC7 A;  4JV5 L;  2QGQ A;  1KRS A;  2CFM A;  4A75 A;  2WB1 E;  3ULL A;  2MO0 A;  4BXX G;  4OWX B;  4POF A;  1PH9 A;  5HGQ A;  3S2H H;  1WFQ A;  5IP9 G;  1EOV A;  1XMQ Q;  1VQF A;  3I4M H;  2IHE A;  4HJ7 A;  1YJW A;  2K5V A;  5IYD G;  4A3D H;  4B3M Q;  2UXD Q;  2UU9 Q;  2JA5 G;  3GTO H;  1UWV A;  2D0O A;  4DR6 L;  3CD6 A;  1DGS A;  2YTY A;  2I5L X;  5FLM H;  4GS3 A;  1AH9 A;  1KXL A;  1VQB A;  3CP0 A;  4LUZ A;  4OO1 I;  3CCU A;  1K73 C;  3ERS X;  4DV6 Q;  5HY6 A;  4RMF A;  4BBR H;  1Y1W G;  2E2I H;  1Y1V G;  4JI4 L;  5FLX c;  4JI5 Q;  4OX9 Q;  5IP7 H;  1S40 A;  1W3S A;  5M5W H;  1YEZ A;  5AJ3 L;  3CCR A;  4DV2 Q;  1Q1B A;  4DV5 Q;  2HHH L;  4KHP L;  2IT1 A;  3CME A;  4JBJ A;  1IXR A;  2YTV A;  2QEX A;  1NTG A;  1XPR A;  4C3H H;  1ASZ A;  2JK8 A;  4FDB A;  4HJ9 A;  4DR3 Q;  5M5X H;  1PH5 A;  4LF7 Q;  1HJP A;  4P74 A;  5C44 H;  3CMA A;  2VL6 A;  3CCE A;  3G6E A;  3CQZ H;  1PH7 A;  3RLF A;  3OTO Q;  4Y52 H;  3PUW A;  2NZO A;  2VZA A;  5JEA G;  5C0X G;  3CCJ A;  1AE3 A;  4L5R C;  4DUY L;  2A8V A;  3KYH C;  1YI2 A;  1HNZ Q;  1N36 Q;  2N8N A;  4BY1 G;  3KOJ A;  1BBW A;  2PMZ E;  4O2D A;  3PUV A;  4IPH A;  1X3G A;  3T1H L;  1VQE A;  1X54 A;  4NXN L;  1VQO A;  2NVY H;  1XTD A;  2ASB A;  3PO3 H;  4JBM A;  2PI2 A;  3K81 C;  2LXJ A;  4A3G H;  2K5N A;  1C9O A;  1VQK A;  1PH1 A;  1G29 1;  2ZJP A;  4A3I H;  3K8A A;  2VQF Q;  3FP9 A;  4A3F G;  3PUZ A;  3KFU A;  4QY7 A;  2WAQ G;  3HOW H;  4JV5 Q;  4A3L G;  3CCL A;  4GOP A;  2WP8 J;  3S24 A;  1KC8 C;  3W1B A;  1R9T H;  1IBL L;  2UUA L;  2ID0 A;  1OTC A;  2Y0S E;  1KAW A;  2HQL A;  2JE6 I;  4DUZ L;  2E5L L;  2B63 G;  2JA7 G;  1XPO A;  1BBU A;  2R7D A;  2VUM G;  3HOY H;  4BY7 G;  2VQE L;  4UP7 A;  1HNW Q;  4DR5 Q;  2R7Z G;  1K0R A;  1YNX A;  2ZM6 Q;  5GAH C;  2ZTC A;  3HKZ G;  2AMC B;  1LUZ A;  3RLN A;  2Q2H A;  1QUQ A;  1Q12 A;  3TS2 A;  4LNQ A;  2E2J H;  2WAQ E;  4GKJ Q;  2MO1 A;  1XMQ L;  4BA1 I;  4WJ3 M;  4P71 A;  4HJ8 A;  1J5E L;  1XJV A;  1EQQ A;  1I3Q H;  4GOP B;  2UXD L;  4B3M L;  5AJ3 Q;  2UU9 L;  5BR8 Q;  1XMO L;  3PO3 G;  3OYY A;  4IJL A;  1HR0 W;  4AH6 A;  3AQQ A;  2MQH A;  1QZG A;  2HT1 A;  2RHQ B;  1WYD A;  1QVG A;  1I94 Q;  1MJE A;  4ALP A;  4JI5 L;  4OX9 L;  4BXX H;  2F3I A;  2I5M X;  1E1T A;  4TQU S;  4DUY Q;  1QUQ B;  4B3T Q;  2YYZ A;  5IP9 H;  4DV5 L;  2R92 G;  4A3J G;  1LYL A;  2B29 A;  5IYD H;  1PA6 A;  4NXN Q;  1FJG Q;  4R1J A;  2N3S A;  4HJA A;  1BVS A;  2JA5 H;  1YJN A;  2IY5 B;  4DR3 L;  3M85 A;  4LF7 L;  2RCN A;  1K3R A;  3F2D A;  3ICE A;  2R6G A;  1Z9F A;  1GKH A;  1HZC A;  1Q82 C;  2HIV A;  3OTO L;  2JA6 G;  3CF5 A;  1NMF A;  1Y1W H;  4JI2 L;  2C35 B;  2UUB Q;  1Y1V H;  4IPC A;  4AYB G;  3PF5 A;  4UPA A;  1U5K A;  4GNX C;  4EQ5 A;  3U58 A;  1HNZ L;  2E2H H;  3L2P A;  4JI3 Q;  5ELO A;  1NY4 A;  3EN2 A;  2UUA Q;  3EBE A;  2EIF A;  3A5U A;  3AYH B;  4DKA C;  2MFI A;  1SN8 A;  3UDX A;  1VQD A;  2D0P A;  4X6A H;  1MKH A;  4IPG A;  2K75 A;  1SLJ A;  2VQF L;  1EFW A;  1SE8 A;  4GOP C;  3PUY A;  3CCQ A;  1JJ2 A;  3M4O H;  3PV0 A;  4BA2 I;  2N49 A;  1O7I A;  1JJG A;  3TEH B;  3RN5 A;  3GTG H;  1VS0 A;  1M90 C;  4BY1 H;  3K0X A;  4JI6 L;  4KI0 A;  2JEA I;  4YWL A;  5IYB G;  5JEA J;  5C0X J;  3H3V H;  4A93 G;  1J5E Q;  1HNW L;  1VQG A;  3A5Z B;  4DR5 L;  3J7A 5;  3K7A H;  1HR0 Q;  4LF5 Q;  1PH2 A;  3HOZ G;  2ZM6 L;  2CQO A;  2ZTE A;  1IZ6 A;  1XMO Q;  3G48 A;  1VQA A;  1IBM Q;  1OXV A;  3J80 c;  3KLW A;  4NPS A;  4A3F H;  3GTL H;  4PZ6 A;  4PG3 A;  4A3L H;  3GTP H;  4GKJ L;  4OWT B;  4LFC Q;  4DV3 Q;  4QQB X;  3ULJ A;  2ATW A;  1A0I A;  1SR3 A;  3KJP A;  4X62 Q;  2XTI A;  2NZH A;  3WWV A;  1OXU A;  2B63 H;  2JA7 H;  2VUM H;  2IX0 A;  1YBY A;  5BR8 L;  2ZJQ A;  1CKM A;  4BY7 H;  2D62 A;  4B3R Q;  4YY3 L;  3GTJ H;  1VQL A;  2R7Z H;  2NVT H;  4YWK A;  5DLQ E;  1S72 A;  1I50 H;  1N8R C;  3HOU G;  2PQA A;  1BKB A;  2IX1 A;  3ULP A;  3AFQ A;  4HIM A;  4IFD I;  1YZ6 A;  1CKO A;  3H0G G;  1I94 L;  4LFA L;  1UEB A;  1P16 A;  3F8T A;  4JCV E;  4A4I A;  3CAM A;  3J7Z C;  4JOI C;  2ES2 A;  3NEN A;  4JI2 Q;  4L5Q A;  4B3T L;  1L1O A;  4X65 Q;  4IOA A;  1HNX Q;  1Q81 C;  2JQO A;  3CW2 C;  3J81 c;  4JI8 L;  3K7U C;  4B3S L;  1FJG L;  1UE5 A;  1V9P A;  4AIM A;  4GNX A;  3I56 A;  5J3B A;  1EUJ A;  2UXC L;  3PIP A;  1QVC A;  5EAY A;  3CPF A;  2I0Q A;  4LWC A;  1V43 A;  4R4T A;  3S1Q H;  4PZ8 A;  3ZJY C;  4QL5 A;  3UE0 A;  4JBK A;  3HKS A;  1NBW A;  2UUB L;  2YTX A;  3CXC A;  4P75 A;  1VQC A;  2CCZ A;  1HZA A;  3F1Z A;  4JI3 L;  2QA4 A;  5M3M G;  1NJI C;  1KD1 C;  5C3E G;  5C4X G;  2F4V L;  4OON A;  3GTQ H;  2XGT A;  2R92 H;  4DR7 Q;  1OXT A;  1S3O A;  5JJL A;  4POG A;  2CWP A;  2KHI A;  4A3J H;  4JI6 Q;  5LMN L;  3PF4 A;  1NMG A;  2PI2 E;  1VQH A;  3PSI A;  1NE3 A;  3A0J A;  3NBH B;  1KQS A;  2AWO A;  1JT8 A;  3SGI A;  5LMN W;  4UP9 A;  1GVP A;  3A74 A;  1HZ9 A;  4GN5 A;  4GNX B;  1K8G A;  2KEN A;  2ZJR A;  3S15 H;  3JAM c;  3CPW A;  3TRZ A;  1UE6 A;  1PH3 A;  2JA6 H;  3M3Y H;  1WJJ A;  2EQS A;  3J81 i;  3GD7 A;  1I6H H;  4DV0 Q;  3UDG A;  2AHO B;  3I4O A;  1YVC A;  3OW2 A;  4DR4 Q;  1C0A A;  1M1K C;  1HR0 L;  4LF5 L;  4JI0 Q;  2R7F A;  1N34 Q;  1VQ7 A;  2GVA A;  2ALY B;  4LW1 A;  1IBM L;  4YY3 Q;  3Q8D A;  1YHB A;  3RNU A;  2BA0 A;  2OQ0 A;  4X64 Q;  2LSS A;  1VCI A;  4DR2 Q;  1A62 A;  1E22 A;  3KJO A;  3HKZ E;  3L7Z C;  4LFA Q;  4LFC L;  4DV3 L;  4LF8 L;  1CUK A;  2K50 A;  4H02 A;  2OWO A;  4UY8 C;  2JEB I;  4X62 L;  4APV A;  3ER0 A;  1VQM A;  4NXM L;  1AE2 A;  5IYB H;  3FKI G;  4JOI A;  4A93 H;  4B3R L;  1FVI A;  2DUD A;  3KF6 A;  4PMW A;  3BU2 A;  3PCO B;  1E7Z A;  2GN5 A;  2B3G A;  4R4C A;  4GLA C;  4JI8 Q;  2UUC Q;  2PNH A;  3UE1 A;  4B3S Q;  4L5S A;  3HOZ H;  1A8V A;  3JAM i;  4LFB Q;  3HOX H;  1EWI A;  2UXC Q;  5FJ8 G;  1SRO A;  3I4N G;  3U4V A;  1CKN A;  3DLL A;  4PZ7 A;  4LF6 L;  1L1O C;  4O0A A;  1PH8 A;  3AEV A;  4IFD G;  4GKK Q;  4R4I A;  2RHS B;  1XPU A;  2N78 A;  4YHH L;  4A3M G;  1PH6 A;  2JJQ A;  3BZK A;  4X65 L;  1HNX L;  3S2D H;  3LGJ A;  5LMU Q;  2F4V Q;  5IWA Q;  1XNQ L;  3NEM A;  5IT9 c;  1UE7 A;  1W2B A;  1E3P A;  1IL2 A;  1FGU A;  2WFW A;  4JC0 A;  4KHZ A;  4TVA B;  1IBK Q;  1Q86 C;  5LMN Q;  1XNR Q;  4A3C G;  3HOU H;  3W1G A;  4LF4 Q;  3KF6 B;  4DNI A;  3IRB A;  4NB3 A;  3M9B A;  4A3E G;  1RIP A;  3U4Z A;  3H0G H;  1G6P A;  1VQ6 A;  1JB7 A;  3GTM H;  1TWF H;  3RZD H;  3UDF A;  1VQ9 A;  2BH8 A;  1WCM G;  1CKN B; 
#chains in the Genus database with same CATH topology
 3S1R B;  4JYA Q;  1GUS A;  2CQA A;  1YNJ C;  5KEE A;  2QW7 A;  3GTK B;  3MAQ A;  2HW5 A;  2K33 A;  2EY1 A;  4DV7 Q;  4RCO A;  1JMC A;  2R93 G;  2BA1 A;  3G4S A;  3PO2 G;  4IPD A;  5JBX A;  4RH6 A;  3D4R A;  3TLF A;  4MTN A;  4DV0 L;  3PF4 A;  1CT1 D;  3BJU A;  3I90 A;  3Q6S A;  2Q8I B;  3TDQ A;  5C4X H;  3Q0A A;  3S1N H;  4K0K Q;  1SNM A;  2EDG A;  1N34 L;  4NXM Q;  2OEO A;  4UP8 A;  3CCV A;  3G71 A;  2UXB Q;  1RF2 D;  1CQF A;  4G7O C;  1KL9 A;  3EIV A;  3K5O A;  4DR2 L;  1NCV A;  2L11 A;  2M00 A;  4C3I G;  2YV5 A;  2L15 A;  4C3J H;  2QDB A;  4IOC A;  2EE1 A;  1MIU A;  1SAP A;  3D6C A;  1VMC A;  1F2Z A;  3HFZ B;  3NQT A;  1FNW A;  2R93 B;  5E7N A;  3SK5 A;  4RGM A;  4DAV A;  2EYH A;  2JXM B;  1CSQ A;  3NBI A;  4QIW E;  2UUC L;  2Q2I A;  3A7L A;  1IYJ B;  4DGZ A;  2Z9H A;  4K8J A;  3K58 A;  1Y8N B;  2BCO A;  1B44 D;  1QWY A;  1TY0 A;  4R4O A;  1GJX A;  1LAC A;  4I42 A;  1ET6 A;  1LTL A;  3MEF A;  5IWA L;  2Y0S G;  3BS1 A;  1G6Z A;  1N33 Q;  4TRD A;  4CGY B;  1LTR D;  4V0B A;  3GQB A;  5FJ8 H;  3VYS A;  3IAY A;  1OXS C;  3M4Y A;  4HSV A;  4IFD H;  2B2Y A;  4PMC A;  2I5H A;  2B2T C;  4C2M B;  2VS1 A;  4JYA L;  1PZK D;  2Z6K C;  1HUM A;  3S14 H;  5E4W C;  1GO3 E;  5IP7 G;  2MJ8 A;  3STB C;  2F0S A;  5F2D A;  1STA A;  2E2D C;  4DV7 L;  1TY2 A;  4RA8 A;  1TWG H;  3TP8 A;  2Y0S B;  1K8A C;  4DR6 Q;  4BY1 B;  5C44 G;  2Z0S A;  4HR7 B;  1CA6 A;  1VQ5 A;  2AUJ D;  4K0K L;  1F2L A;  3AFP A;  1Q90 A;  2KHJ A;  1W6K A;  4RFB A;  2IHF A;  4JI4 Q;  2UXB L;  3RR5 A;  3NWT A;  2K5D A;  4CJ0 B;  3S16 H;  5FLX L;  4A3B H;  1B7Y B;  4B9W A;  1MI2 A;  4OWW B;  4Q0F A;  2E75 C;  3NHH A;  3BVZ A;  2L4N A;  2EY5 A;  4KD4 A;  1VDZ A;  1PFN A;  4NW2 A;  4BY7 B;  3HOW G;  4KY5 A;  3I73 A;  4K14 A;  4JBW A;  3DMU A;  3MC0 B;  3HOY G;  2AWN A;  5ELN A;  2KCM A;  2EYL A;  3M7G A;  1U4M A;  1RDP D;  1E24 A;  1NSN S;  2WB1 G;  2LFN A;  4XTC S;  5M3F H;  2IPK D;  4JI1 Q;  2F6Q A;  2V1C C;  1X9N A;  1WI5 A;  1X6O A;  1PHJ A;  2DJF C;  1TWC H;  1N33 L;  1N36 L;  3S17 H;  5JJI A;  1IBL Q;  3W5O A;  2PO4 A;  2NVQ H;  1SEB D;  4DUZ Q;  2FMC A;  1VQ8 A;  4DU9 A;  4B08 A;  3M7N A;  1H95 A;  4OXP A;  1EZ8 A;  1SDF A;  1ONL A;  2R92 B;  4DAM A;  3CC7 A;  3HOY B;  1CK1 A;  1KRS A;  2QGQ A;  2G9D A;  4JFC A;  1I4R A;  1DXM A;  1XMQ Q;  1IKM A;  1MSH A;  3DUZ A;  1YJW A;  3S15 B;  4A3D H;  3DEP A;  1SNO A;  3R0O A;  1Z6H A;  2JA5 G;  4DR6 L;  1H9S B;  2EYP A;  3E5S A;  1I3Q B;  4DV6 Q;  4JI4 L;  2NYZ D;  4JI5 Q;  2L55 A;  4OIJ A;  2KOL A;  3KQF A;  1PTO C;  3CCR A;  4DV2 Q;  4DV5 Q;  4DN4 M;  3MWY W;  1JWU D;  1R4Q B;  3TZD A;  1NTG A;  5KYI A;  4XQN A;  4LF7 Q;  1HJP A;  4MIU A;  1LTA D;  1RJT A;  1BR9 A;  2O4X A;  3G6E A;  3CQZ H;  4Y52 H;  2VZA A;  2K28 A;  1YI2 A;  1HNZ Q;  4IPH A;  1X3G A;  1VQE A;  2NVY H;  1RTO A;  1EYD A;  4ULL A;  3PO3 H;  2PI2 A;  4A3G H;  1VQK A;  1HZD A;  4I52 A;  1G29 1;  1TS4 A;  3FP9 A;  3RMH A;  2CW0 C;  4A3L G;  1BXT A;  2WP8 J;  2QF7 A;  2F0P A;  2AQ1 B;  1IBL L;  5BN4 A;  3BDL A;  2UUA L;  4F87 A;  2Y0S E;  2DNE A;  1OTC A;  2HQL A;  3K6O A;  4DUZ L;  2B63 G;  2JA7 G;  3FDU A;  1TWF B;  4K2K A;  1LTG D;  2J7Z A;  2EYJ A;  2R7Z G;  1YNX A;  2WV6 D;  5FKA C;  1FNU A;  2K5Q A;  2ZM6 Q;  5GAH C;  4EML A;  4CDC C;  3WOF A;  1Q12 A;  3OHX C;  2E2J H;  1HQM C;  3QXZ A;  4C1N K;  4U67 3;  1XMQ L;  4CJ1 B;  4WJ3 M;  4JOT A;  4ZAI A;  2F0L A;  1J5E L;  2B8G A;  1EQQ A;  4WOR A;  5M3M B;  3EJI A;  2MQH A;  1LAB A;  1D5X C;  2RHQ B;  5C3W A;  2B63 B;  5I2Y A;  1I94 Q;  3IL8 A;  4JI5 L;  4ALP A;  3GTJ B;  2F3I A;  1SYB A;  2OXP A;  2YYZ A;  4DV5 L;  2LKV A;  4XT3 B;  4IZD A;  1FJG Q;  4R1J A;  1DD2 A;  1KDA A;  1RD9 D;  2DN8 A;  4H13 C;  3J81 L;  3M85 A;  4LF7 L;  5C6A A;  3F2D A;  2VB3 X;  4UHV A;  1Q82 C;  4S3S A;  4JI2 L;  2UUB Q;  1Y1V H;  5JAV A;  4IPC A;  4RCN A;  4UPA A;  1U5K A;  1HNZ L;  2E2H H;  2PPY A;  3L2P A;  1I4H A;  3SK4 A;  2KJX A;  3S1Q B;  3T8A A;  3KUP A;  3A5U A;  4RHS A;  4DKA C;  2MFI A;  1BBX C;  1TWH B;  1V1O A;  3W3A A;  4IN3 A;  2Z6B A;  1EFW A;  2K75 A;  4IUQ A;  2WAC A;  2PBP A;  3T56 B;  2L12 A;  4M8A A;  2NVX B;  3MTS A;  3RN5 A;  1IKL A;  1KAB A;  5IIF A;  5C0X H;  3ADC A;  3Q24 A;  3VYU A;  5IGB A;  4BY1 H;  2F0E A;  4YWL A;  3TSS A;  4XQJ A;  2RDG A;  3C2P A;  3J7A 5;  5ELE A;  1HR0 Q;  1PH2 A;  1A2U A;  3T89 A;  2ZM6 L;  3A8J E;  1VQA A;  3ITP A;  4KJN A;  1OXV A;  1JE4 A;  2RA4 A;  4ZKB B;  3MYB A;  3PIO 3;  2ENB A;  4PZ6 A;  4PG3 A;  4ZYS A;  4ELS A;  3QWN A;  1G91 A;  4OWT B;  4LFC Q;  4WFN 3;  2A6H C;  2A68 C;  2NTT A;  4X62 Q;  1PMR A;  1QCB D;  1QOH A;  4BY7 H;  4ZKC B;  4QF4 A;  1VQL A;  4Q5V A;  2NVT H;  3FPP A;  2F0V A;  1N8R C;  4K5X A;  1UNS A;  1I94 L;  3I8Z A;  1P16 A;  3TRR A;  1H9R A;  2L1B A;  1PRT C;  4JOI C;  1SXT A;  3ERQ A;  3HOX B;  2EJ5 A;  1KDB A;  4BBS B;  2JQO A;  5BN5 A;  3HS0 C;  4R8N A;  1IHZ A;  1FJG L;  4B3S L;  1UE5 A;  5DEH A;  3D4D A;  3VYT A;  5IT9 L;  4FF4 A;  2I0Q A;  2SEB D;  1V43 A;  1J8I A;  2QEJ C;  2QCP X;  3ZJY C;  3UE0 A;  2YU9 B;  2UUB L;  4P75 A;  3JAM E;  2K01 A;  1KD1 C;  5C4X G;  2XGT A;  2R92 H;  4DR7 Q;  1OXT A;  3BVG A;  1EL0 A;  2DUB A;  5A2Q L;  2CWP A;  4A3J H;  3GTM B;  2X6G A;  1NE3 A;  4U19 A;  1IYU A;  4LAA A;  4ILW A;  2ZJR A;  3S15 H;  1NNX A;  4C3J G;  4I7A A;  1B50 A;  1BO0 A;  3ZYY X;  1WTP A;  4NNQ A;  4A3K B;  1T5E A;  1YVC A;  2ZT9 C;  5ELC A;  4DR4 Q;  1HR0 L;  4DFA A;  1EIH A;  1RJM A;  4ABN A;  1QNU A;  1IW7 D;  4I65 A;  4XXE A;  3S1N B;  1OO9 B;  2LSS A;  3NTI A;  1PFM A;  2F0N A;  3QB3 A;  3KJO A;  1Z7T A;  3L7Z C;  4LFC L;  1CUK A;  2K50 A;  4H02 A;  1EFI D;  4X62 L;  2K6A A;  3DM1 A;  3BU2 A;  1BCP D;  2GN5 A;  2B3G A;  3JAM i;  1RKN A;  2UXC Q;  5FJ8 G;  4BBR B;  2E2I B;  1CKN A;  3DLL A;  3DEO A;  5T1G A;  1L1O C;  4IFD G;  3AEV A;  5M5W B;  4GKK Q;  2N78 A;  1A3V A;  2EYO A;  3S2D H;  2EYM A;  2RQX A;  1XNQ L;  2A73 B;  1W2B A;  3J7Y W;  2WFW A;  1IBK Q;  1Q86 C;  4HTH A;  4JW0 A;  5JBW A;  4HED A;  4LF4 Q;  2ZXP A;  1RIP A;  3U4Z A;  1TWF H;  5D3I B;  1KLG D;  2EOT A;  4DR7 L;  1I6V C;  1QB5 D;  4YWM A;  1CSP A;  2HCI A;  5IYC H;  2VY3 A;  5FK9 C;  1EEI D;  4A3B G;  1K3B C;  4RGO S;  3VDY A;  2MGS A;  1EQR A;  2PPB C;  2AQ3 B;  3DWP A;  3D3R A;  2ZQR A;  4X66 Q;  4QGU A;  1EYA A;  3CCM A;  4EQP A;  1VQI A;  1SFO H;  1TS2 A;  5M3M H;  3MZ5 A;  1CHP D;  3TS0 A;  4DR4 L;  4AQY Q;  1K83 H;  4X3T A;  1YNN D;  1PV4 A;  2EXD A;  1DCZ A;  1VMP A;  4PV1 C;  1SYD A;  3CC4 A;  2OCE A;  2RF4 A;  1LO5 D;  4LF6 Q;  2Q2T A;  4R4Q A;  5M3F G;  3K80 C;  3S16 B;  4A3B B;  4YHH Q;  4B9X A;  3D31 A;  1D1I A;  1Q1E A;  3KF8 A;  4EVO A;  4F88 A;  4JI7 Q;  1ICW A;  2A5H A;  2XNA C;  3I91 A;  5HGT A;  3B6Y A;  1JB3 A;  3VR4 A;  3SEB A;  1A15 A;  2FFK B;  1DOL A;  1O7L A;  2NN6 I;  5JVG 3;  2HIX A;  4GKK L;  1TWH H;  5EQ0 A;  1PFB A;  1ET9 A;  1DON A;  1GUG A;  1KRT A;  3T1Y L;  4DR1 Q;  3FKI H;  1WOC A;  2NVX H;  3M4Q A;  3KK7 A;  1IBK L;  1MSG A;  3KDF A;  2TMP A;  2XN9 C;  5CBA E;  5IY0 A;  4J6H A;  4LF4 L;  1I4P A;  5GAE C;  1TS3 A;  4A3D G;  1Y14 B;  4G4K A;  3I4N H;  1Y1W B;  2PMZ B;  1TWC B;  4DV1 Q;  4O42 A;  3S17 B;  3I7F A;  3D0F A;  3F2B A;  4IFD J;  1ASY A;  2HDM A;  4FZW A;  2VRE A;  1RJN A;  2K14 A;  1SYF A;  1S4Z A;  2K4K A;  2F52 A;  3OC7 A;  4EQO A;  3M4O B;  2A69 D;  1VQP A;  1X3P A;  3GTG B;  1SJH D;  2F0H A;  3BZC A;  5C5L A;  1EF9 A;  4X66 L;  2JA9 A;  1HHV A;  1SE3 A;  1I5F A;  1EY7 A;  4KMU C;  5TSS A;  1WCM H;  2G5D A;  2HUG A;  4AQY L;  3MXN A;  1HFG A;  1PYS B;  3H15 A;  3HG9 A;  3FHW A;  1D6E C;  3GDE A;  1L2F A;  1KHI A;  4DK3 C;  5CMD A;  1YIT A;  2WAQ B;  3R3O A;  4BBS H;  3GTP B;  4A3G G;  2LXK A;  5CGK A;  2KEC A;  3OMC A;  5CV5 A;  1D8L A;  3TP7 A;  2K5H A;  4HIO A;  4O1N A;  4GLV B;  4JI7 L;  2KEE A;  1U4L A;  2QKI C;  2YU9 H;  3DWQ A;  1L0W A;  1SND A;  3H3V I;  4KTA A;  4FF1 A;  4YCV A;  5NUC A;  2L0C A;  2B2U C;  4N9T A;  4QJF A;  4WJW A;  3TBI B;  3CQZ B;  1WZ8 A;  2X69 A;  5COR A;  2IL8 A;  2Z1C A;  5M9O A;  1HFN A;  1Q7Y C;  4G7Z C;  2NVY B;  2JA8 H;  3MHB A;  4MZ9 A;  4DR1 L;  3PO3 B;  4A3G B;  1ZYR D;  2EJG C;  1X3E A;  4DAY B;  2KCN A;  4A3K H;  2VQE Q;  4KLK A;  4N8X 1;  4DV1 L;  4ZQ3 A;  1SRU A;  3HOV H;  1LT4 D;  3I70 A;  4JV5 L;  1X55 A;  4KKU A;  5T1I A;  3OSO A;  4OWX B;  4HCE A;  3OMG A;  1EOV A;  2IHE A;  1B9N A;  2K5V A;  2UXD Q;  4QUF A;  1MGS A;  3M3Y B;  2E2J B;  3GTO H;  1UWV A;  5CV6 A;  1I6H B;  1DGS A;  2PNR C;  4GS3 A;  2FMM A;  4LUZ A;  1JC7 A;  1K73 C;  2F0F A;  3ERS X;  4BBR H;  2WIN B;  2E2I H;  1Y1V G;  1EU3 A;  2L5T A;  2K1B A;  1MBY A;  1S40 A;  5M5W H;  2Z4I A;  4C56 C;  1STH A;  1UEA B;  2IT1 A;  2PZU A;  1CA5 A;  3G7L A;  4JBJ A;  2QEX A;  4DR3 Q;  5DM7 3;  2HDL A;  2F03 A;  4P74 A;  1GUT A;  1PH7 A;  3NWS A;  3RLF A;  3OTO Q;  3CCJ A;  2NZO A;  5C0X G;  4IUU A;  1AE3 A;  2PCF B;  4DUY L;  4KK7 A;  1N36 Q;  4BY1 G;  3W8I B;  2PMZ E;  1VQO A;  2P63 A;  3H94 A;  1NZY B;  3GV6 A;  4DNR B;  3K81 C;  4IUT A;  2LXJ A;  5CV7 A;  1Y1V B;  1C9O A;  4IZC A;  2RKS A;  2E2H B;  2B2V A;  3K8A A;  2MP1 A;  1ESR A;  4UDU C;  2SOB A;  5C4H A;  3KFU A;  4QY7 A;  3RQF A;  4K6L A;  1FGB D;  1LV9 A;  3W1B A;  3HOU B;  1CI3 M;  5JPM C;  4HAE A;  3BYY B;  1DCI A;  3WOE A;  3G64 A;  4BY7 G;  2VQE L;  1QG7 A;  1K8O A;  4UP7 A;  1SSO A;  2HQE A;  5FO9 B;  1LUZ A;  2PW7 A;  2Q2H A;  4CJ2 C;  1QUQ A;  1WTQ A;  2WAQ E;  4K8I A;  1Y8O B;  1EWH A;  5ELB A;  2R3Z A;  5C9G A;  4GOP B;  2UXD L;  4FF3 A;  1LLR D;  5EGT A;  5BR8 Q;  4KY6 A;  5I4D A;  5C3E B;  4RGN A;  1TKW B;  1QZG A;  2HT1 A;  3RZO B;  1UUP A;  4PQX A;  1PZJ D;  5G3L F;  3A4M A;  3DHQ A;  2NVT B;  4BXX H;  2I5M X;  1E1T A;  4TQU S;  2EJF C;  1UX5 A;  4B3T Q;  2R92 G;  4A3J G;  2F3W A;  5IYD H;  1PA6 A;  4RWS C;  4HJA A;  1HCZ A;  4FF2 A;  4DR3 L;  2Z4H A;  2RCN A;  1K3R A;  2R6G A;  1Z9F A;  4OL7 A;  2G9H D;  1PTO B;  1R4P B;  3OTO L;  1U4R A;  3NTK A;  1HQR D;  3CF5 A;  1NMF A;  1NUC A;  1Y1W H;  3QK8 A;  4AYB G;  1Y69 U;  4EQ5 A;  1G2T A;  1NY4 A;  2UUA Q;  3Q0J A;  1I4X A;  3AYH B;  1ICF B;  3DXJ C;  4QII A;  1VQD A;  2D0P A;  4X6A H;  2KED A;  4NEK A;  4KHV A;  4GOP C;  3M4O H;  4A3J B;  1JJG A;  5JEA H;  5LL6 S;  1VS0 A;  3GTG H;  2JN4 A;  1TS5 A;  1JQY D;  3JAM L;  1JIC A;  3K0X A;  4KI0 A;  5C0X J;  2IEX A;  2WKD A;  3F2U A;  4MHE A;  1J5E Q;  3A5Z B;  1ZEQ X;  1IZ6 A;  4AYB B;  4A3M B;  3SWX A;  5CV8 A;  1WD0 A;  2WII B;  3T4A C;  2H4O A;  4Z9C B;  1D1K A;  4DA2 A;  3GTP H;  4DV3 Q;  2F0M A;  2ATW A;  1SR3 A;  2XTI A;  2NZH A;  3LWU A;  3WWV A;  2VUM H;  2IX0 A;  5BR8 L;  1MHW C;  4ID6 A;  1GXD C;  4YWK A;  1ENA A;  1S5B D;  1IW7 C;  1TWA B;  2IX1 A;  1I4G A;  3ULP A;  4CDE C;  3S1M B;  1YZ6 A;  1CKO A;  3U9O A;  4LFA L;  3CAM A;  3FPU B;  3ND8 A;  4XYO A;  2NTS A;  3NEN A;  4JI2 Q;  4L5Q A;  5EBD A;  4B3T L;  1DUB A;  1L0X B;  3A56 A;  3HEJ A;  1HNX Q;  1TT2 A;  1GUO A;  3CW2 C;  4JI8 L;  1BCP C;  1C48 A;  1V9P A;  4GNX A;  1ESF A;  3PIP A;  1DOM A;  4MI2 A;  2EPB A;  1NR2 A;  2TSS A;  4NP5 A;  3HGB A;  5EAY A;  4LWC A;  1JCK B;  4R4T A;  3S2D B;  3BDO A;  1JR0 D;  2DY8 A;  4QL5 A;  4JBK A;  1JOQ A;  1KNE A;  1NJI C;  2QA4 A;  5M3M G;  3ADD A;  2F4V L;  3BZD B;  5FOB B;  4XQQ A;  1S3O A;  3QOJ A;  5IGE A;  3OWE B;  2A74 C;  2KHI A;  5AFW A;  3ONA B;  4Y7N B;  3NBH B;  2D2C C;  4UP9 A;  3E3X A;  1G2S A;  1HZ9 A;  4GN5 A;  5DAU A;  1K8G A;  3TRZ A;  2JA6 H;  1PH3 A;  3M3Y H;  1WJJ A;  3K5L A;  1I6H H;  4L63 B;  3T16 A;  1A2T A;  4JI0 Q;  4F7X A;  5D65 A;  2ALY B;  1AW7 A;  5EPK A;  1SFO B;  3Q8D A;  1V1P A;  1IL8 A;  2BA0 A;  4X64 Q;  4MTK A;  2P5Z X;  1F9R A;  1K83 B;  5L37 A;  4LF8 L;  4DV3 L;  2SNM A;  3I4M B;  3D4W A;  2KHS A;  1XXG A;  2HD3 A;  4FXG C;  1VQM A;  1AE2 A;  5IYB H;  3FKI G;  4K2N A;  4J8Q A;  1FVI A;  3PCO B;  4GLA C;  4B3S Q;  1A8V A;  1EWI A;  1XWE A;  3I4N G;  3PQI A;  3U4V A;  1O78 A;  1TU2 B;  4PZ7 A;  1XYI A;  1PH8 A;  3HIN A;  2RCF A;  3R2I A;  1HNX L;  4KV6 A;  2F0U A;  5LMU Q;  1NAP A;  3GV3 A;  4JYL A;  4C3H B;  1XNR Q;  2F4I A;  1PRT B;  3HOU H;  4CBV A;  3W1G A;  3KF6 B;  3EVQ A;  3I47 A;  4NB3 A;  3H0G H;  1G6P A;  4DXG A;  3FKI B;  2XWB B;  3UDF A;  3J80 E;  3QG1 A;  1WCM G;  1YJ9 A;  1STN A;  4DK0 A;  3PZK A;  1VQ4 A;  1ENF A;  1TR5 A;  3I4N B;  4AYB E;  3STB D;  5E4X A;  1EIY B;  2Z6K A;  4K6D A;  3HOX G;  5ISR A;  4DV4 Q;  3RQE A;  3GP7 A;  4BBS G;  1K9M C;  4LMQ D;  1LTT D;  2UZF A;  1AP0 A;  4KJO A;  3T13 A;  4RGT A;  5C3E H;  4L5T A;  2VNU D;  1C7Y A;  3RZO H;  4JI0 L;  2DGY A;  2Q2U A;  4JG2 A;  2V4D A;  2A6E D;  5IGD A;  3PIO A;  1WTR A;  1DYQ A;  3W2D A;  1Z47 A;  1EIF A;  2A69 C;  1WCM B;  4LK1 C;  3C3L A;  4V19 0;  4X64 L;  3NXW A;  4HCS A;  1N32 L;  3ERO A;  1WTW A;  1E1O A;  2JA8 G;  2CWA A;  3X3M A;  1SNQ A;  3EA6 A;  4KD3 A;  2F0K A;  1PTO H;  5CV4 A;  1XNQ Q;  2VW9 A;  3J80 i;  1Q8K A;  1TXY A;  4LF9 L;  4KKT A;  2LY7 A;  4A3K G;  2KBN A;  3HRX A;  1EY5 A;  2LMC B;  3CCS A;  2BH2 A;  2KUM A;  2D9U A;  2ICI A;  3HOV G;  3MXP A;  4OO1 H;  4LJZ C;  2FXQ A;  4GLX A;  5LMU L;  2MHV A;  1GD7 A;  2M2L A;  1JWS D;  3C1E A;  1XNR L;  5HUR A;  3NEL A;  1L1O B;  3VYR A;  4J1M A;  2JA8 B;  1JE5 A;  1U0L A;  5DM6 3;  3TRE A;  4F47 A;  1QJO A;  3OWF A;  4A3M H;  1KIX A;  4BBR G;  2EY2 A;  1EQT A;  3H02 A;  1FL0 A;  4ZRZ A;  4RG1 A;  4YCU A;  3HOV B;  3IKJ A;  2KCT A;  3H09 A;  4DV4 L;  4HJ5 A;  3RLO A;  3T51 B;  1P8L A;  1OXX K;  4P72 A;  1LM0 A;  4TKO B;  3X3N A;  1EQV A;  3J7A V;  1SBB B;  4QIJ A;  3U9S A;  4N8F A;  1TWA H;  5H1S E;  1PFS A;  3NTH A;  1RHP A;  4JPB W;  3S1M H;  4DK6 C;  3QR8 A;  3GTO B;  3L0O A;  1JJC B;  5JOB A;  3C1F A;  3I2Z A;  1SMY D;  1GHJ A;  4OGQ C;  4FXD A;  3ADB A;  1ZKO A;  4GZY C;  3E9H A;  3MEH A;  1PYW D;  1AEX A;  2GA4 B;  3CHB D;  4FO2 A;  5KIX A;  4M1U B;  3T1Y Q;  2EY6 A;  1ROD A;  3T1H Q;  2E74 C;  4XIG S;  4GEH B;  2D5D A;  1UE1 A;  1EY4 A;  4Y7N H;  4MOU A;  4MNO A;  3TQY A;  1XX8 A;  1D7Q A;  4JK1 C;  2CW0 D;  1SYE A;  3I55 A;  1YIJ A;  2OTJ A;  4IUP A;  3R9S A;  3KLS X;  1RL2 A;  3H3V C;  2H5X A;  1H9S A;  2B2Y C;  3JC6 6;  2B2V C;  2E5L Q;  3J7A F;  5EJW A;  1K0S A;  5GAG C;  1X3F A;  2OTL A;  1X56 A;  4YCW A;  1DOK A;  1X32 A;  5I9P A;  2ICE C;  5A35 A;  4N9P A;  4BXX G;  4POF A;  5HGQ A;  1W6J A;  3S2H H;  1KAA A;  2DY7 A;  3T88 A;  3QO2 A;  3I4M H;  4R9W A;  4HJ7 A;  5IYD G;  4B3M Q;  2X6L A;  2UU9 Q;  3MVV A;  2D0O A;  2YTY A;  2I5L X;  5FLM H;  3CP0 A;  1QE6 A;  2MPM A;  1H9M A;  1Y1W G;  1FD7 D;  2NZ1 D;  5FLX c;  4FVM A;  1ILQ A;  4IZ8 A;  5AJ3 L;  1B3Q A;  2F1M A;  1EEF D;  2YTV A;  2Q8R E;  3IFD A;  1LTB D;  4C3H H;  1PH5 A;  4FDB A;  3CRK C;  3SHL A;  3CMA A;  1UAP A;  2PZT A;  5IOC A;  5K36 H;  4NMZ A;  3K5M A;  5JEA G;  2FIN B;  2H1E A;  5CV9 A;  1JOK A;  2N8N A;  4EQN A;  3KOJ A;  4O2D A;  3T1H L;  4NXN L;  1X54 A;  1XTD A;  2F0O A;  2ASB A;  4JBM A;  2K5N A;  3TZU A;  1PH1 A;  4OLQ A;  5E1F A;  4A3I H;  3AMU A;  2WAQ G;  1B53 A;  4JV5 Q;  1F77 A;  2SDF A;  3S24 A;  2XWJ B;  1PRT F;  1R9T H;  5KYL A;  5I2X A;  2JE6 I;  3MOY A;  2E5L L;  1XPO A;  4ZU2 A;  1BBU A;  2VUM G;  4H44 C;  1HNW Q;  2ZXR A;  5J22 A;  1LT5 D;  1ML0 D;  3HKZ G;  2AMC B;  2NN6 H;  3WDN A;  4QB4 A;  3TN2 A;  4JWV A;  4K2L A;  1FYC A;  2A6H D;  5IGF A;  2L9H A;  1BDO A;  4P71 A;  1XJV A;  1EY0 A;  4B3M L;  2UU9 L;  1DJR D;  3OIQ A;  1CZG A;  3A8I E;  1XMO L;  3PO3 G;  1CQV A;  1M8A A;  4I4Z A;  2CHB D;  2XSC A;  5DNF A;  1WYD A;  1QVG A;  2VUM B;  1MJE A;  4ZCK A;  3MFY A;  1J9O A;  1PDQ A;  3MXU A;  2KCC A;  4X3U A;  4DUY Q;  5K5P A;  3HKZ B;  5IP9 H;  2LS0 1;  5M5Y B;  1AN8 A;  1LYL A;  2B29 A;  3CRL C;  3SE0 A;  3VR6 A;  3BG3 A;  1BVS A;  1YJN A;  1MD2 D;  2RSO A;  1GKH A;  1HZC A;  2QDL A;  1D5M C;  1B1Z A;  2JA6 G;  5EPL A;  1VF5 C;  5D3D A;  3MA2 B;  3AJM A;  4GNX C;  3U58 A;  1WVL A;  2CH4 W;  3NSW A;  5ELO A;  4WRD A;  3EBE A;  2DJG C;  1SN8 A;  4XT1 B;  2KQ3 A;  4IAL A;  2F0T A;  1MKH A;  4IPG A;  4IUV A;  2B2W A;  2BDO A;  1SE8 A;  2NBF A;  1Y64 B;  1JJ2 A;  1SNP A;  3PV0 A;  4BA2 I;  2N49 A;  1TQO A;  1GOZ A;  5CR3 A;  4YIJ A;  4ZK9 B;  3RUZ A;  1SYC A;  4PNY A;  4UAI A;  4K5V A;  1EZ6 A;  2JSO A;  4JI6 L;  3N6R A;  5IYB G;  5JEA J;  3H3V H;  1HNW L;  1VQG A;  3TP6 A;  3K7A H;  2E76 C;  4LF5 Q;  2JA6 B;  2CQO A;  3G48 A;  2MUY A;  1FNV A;  5FO8 B;  1GHK A;  3A8K E;  3H91 A;  4KNP A;  4NPS A;  4A3F H;  5ELF A;  2PW5 A;  3O4X E;  2RVL A;  5C4J B;  4QQB X;  5KGU A;  1PZI D;  1A0I A;  4A3E B;  1OXU A;  1CKM A;  4B3R Q;  3H6M A;  4YY3 L;  4KY7 A;  1C8C A;  4WCZ A;  5CYU A;  1S72 A;  1I50 H;  3SXH A;  3VR5 A;  3HOU G;  1CTM A;  1LTS D;  3AFQ A;  1RTN A;  4IFD I;  5IGC A;  3H0G G;  4KN4 C;  3IFT A;  4A4I A;  4RHR A;  3J7Z C;  3BYT B;  2ES2 A;  2F0Q A;  4CKC A;  1L1O A;  4X65 Q;  4IOA A;  2PQE A;  1Q81 C;  4P2C B;  3Q23 A;  3PO2 B;  3J81 c;  2C9O A;  3K7U C;  4AIM A;  5J3B A;  1EUJ A;  1XTC D;  2EJM A;  1QVC A;  1DM0 B;  1FR3 A;  4PZ8 A;  1HRJ A;  2YTX A;  1VQC A;  2CCZ A;  1HZA A;  5C3E G;  1EU4 A;  2F3V A;  1SE4 A;  4OON A;  3GTQ H;  1L0Y B;  4HMJ A;  3H0G B;  4C3I B;  1SE2 A;  5LMN L;  4DAP A;  1NMG A;  2PI2 E;  2F0G A;  2BE5 D;  1KQS A;  2AWO A;  2HCC A;  3Q1T A;  1K28 A;  1AFP A;  5LMN W;  1GVP A;  3A74 A;  2FJ2 A;  2KEN A;  4XDX A;  2O5I C;  1A3T A;  1UE6 A;  3J80 L;  3GD7 A;  3P5M A;  3UDG A;  3I4O A;  4CDD C;  4FP5 D;  3I72 A;  1M1K C;  3K57 A;  4LF5 L;  2R7F A;  1WTX A;  2GVA A;  4LW1 A;  3EQL C;  1EY9 A;  3OOC A;  2K7V A;  2AUK A;  2F0J A;  3SDZ A;  1YHB A;  4IZB A;  3RNU A;  2OQ0 A;  4XYQ A;  5KNB A;  3NP8 A;  4BS9 A;  3HKZ E;  4LFA Q;  4UY8 C;  4OO1 G;  2K5W A;  2OWO A;  2IWH A;  4I7Z C;  1KNA A;  3SK6 A;  3ER0 A;  5E3F A;  4NXM L;  1E0B A;  4A93 H;  4B3R L;  2DUD A;  5JJL A;  2A6E C;  3KBX A;  4L5S A;  4JI8 Q;  2PNH A;  4LFB Q;  3HOZ H;  1EOT A;  4O0A A;  3NQI A;  4IUR A;  1PH6 A;  3P7J A;  4A3M G;  2JJQ A;  3BZK A;  4X65 L;  2GTR A;  1VF7 A;  3LGJ A;  2F4V Q;  3FRP B;  3NEM A;  3SVM A;  5IT9 c;  3RSI A;  1B3A A;  5I6W A;  1UE7 A;  1E3P A;  1IL2 A;  4KHZ A;  4JC0 A;  4TVA B;  5M5X B;  3Q0G A;  2BOS A;  5C44 B;  1HPC A;  4BWG B;  1G8Z D;  3IRB A;  4DNI A;  3M9B A;  2IX3 A;  1VQ6 A;  5G3L D;  1JB7 A;  5I6Y A;  1VQ9 A;  2BH8 A;  1BCP B;  1BUV T;  3K5N A;  1CKN B;  3ND9 A;  1RCV D;  4LUV A;  1EY6 A;  1Q46 A;  1SMX A;  1EY8 A;  5EKI A;  3HOW B;  1JOR A;  2F0I A;  1S5F D;  1GM5 A;  1O80 A;  2BDN A;  1MJC A;  4LF8 Q;  5GAD C;  3AM1 A;  2CVR A;  2O5J C;  2RBM A;  3O13 A;  4E6I A;  1BF4 A;  2IW3 A;  2A1A A;  2OQK A;  4A76 A;  2WB1 B;  4HID A;  4DPG A;  1HA5 A;  1S5C D;  1BQQ T;  1B70 B;  1JOO A;  2WKC A;  3LNN A;  4QUC A;  5M5Y H;  3C46 A;  1IYV A;  3SLL A;  5EKL A;  2NWG A;  3FVQ A;  1ILP A;  5JJZ A;  2NUC A;  1YHQ A;  3F2C A;  5JVH 3;  3PUX A;  2KVM A;  3HRZ C;  1QVF A;  4LFB L;  3FEW X;  5IYC G;  4DNT B;  5IOD A;  1A63 A;  1JXZ A;  1WD1 A;  2DNC A;  1SMY C;  1F9S A;  3V2T A;  5JJK A;  4OEL B;  3E0E A;  1EYG A;  2PQA B;  4OG1 A;  1I4Q A;  1Q8I A;  2B2U A;  1AZP A;  4RAU C;  2ZQQ A;  1M4V A;  1S5E D;  4RKB A;  4IO9 A;  3M4P A;  4J15 A;  3PIP 3;  2ZTD A;  2JA5 B;  2QQ3 A;  1YNJ D;  3HP3 A;  2J0T D;  4P73 A;  1Y8P B;  4ME3 A;  2RDH A;  3I4M G;  3S1R H;  3KF8 B;  1J6Q A;  1VQN A;  4IJH A;  3RD4 A;  3GTK H;  4F8M A;  5GQO A;  1V1Q A;  5FLM G;  3S9W A;  4JI1 L;  1QZH A;  1Q52 A;  4RKL A;  3T53 B;  1N9W A;  1CZW A;  1LTI D;  1D2B A;  1PXU A;  2GVB A;  5C4J H;  4QMG A;  3PGZ A;  4CKE A;  3VR2 A;  3QJY A;  4A3C H;  2SNS A;  4A3E H;  3KDF B;  1WTV A;  5IGG A;  4C3H G;  3S2H B;  3K59 A;  1N32 Q;  3VA5 A;  5K36 G;  2EVB A;  2Q8T A;  3V05 A;  2MNA A;  5IE8 A;  3VA7 A;  2KA7 A;  4JCS A;  2I07 B;  3URY A;  1YNN C;  1D5Z C;  4U18 A;  4G7H C;  2R93 H;  1HTL D;  4LF9 Q;  1F2Y A;  3GTL B;  2HHH Q;  4KHP Q;  3QXI A;  3PO2 H;  4H7B A;  2M9V A;  2XRQ D;  3UDI A;  4GN4 B;  4A3I G;  1EIG A;  4DV6 L;  2JA7 B;  5C0X I;  2R7Z B;  1T9H A;  2O2L D;  4FXK C;  3U50 C;  4DAY A;  1UIY A;  3E9I A;  1B8A A;  5LL6 X;  4DV2 L;  3CC2 A;  1VQJ A;  3MXN B;  1X65 A;  5C3X A;  1A6X A;  3NUC A;  5EPJ A;  3L8I A;  3GO5 A;  1H9K A;  3R2T A;  2OT2 A;  4C3I H;  3NPP A;  1U4P A;  2Z8L A;  4CKB A;  2NN6 G;  3LWE A;  1YHA A;  2AKW B;  4IUN A;  1AZQ A;  5GRO A;  4OIK A;  3DM3 A;  1PVO A;  5COY A;  1PYB A;  1HH2 P;  2B2T A;  1SNC A;  2CKZ B;  4LUO A;  2PYK A;  4C2M H;  4A3I B;  1G51 A;  4H0L C;  2E8G A;  4WJ4 A;  2A19 A;  5FO7 B;  3G6J B;  1PH4 A;  3W8H B;  3V96 A;  3J81 j;  2K52 A;  4GN3 B;  1DZ1 A;  4FZW C;  1R9T B;  2EZV A;  1HZB A;  1STG A;  4EX5 A;  3RN2 A;  1ZXT A;  2OF1 A;  2CFM A;  4A75 A;  2WB1 E;  3ULL A;  2MO0 A;  1PH9 A;  1B2T A;  5FLX E;  4ME5 A;  1WFQ A;  5IP9 G;  1VQF A;  3A4N A;  3CD6 A;  1U9R A;  2FBM A;  1AH9 A;  1KXL A;  1VQB A;  2CH4 A;  4OO1 I;  3CCU A;  1NR4 A;  5HY6 A;  4U1A A;  4RMF A;  2VX2 A;  4OX9 Q;  5IP7 H;  1NZY A;  5KNC A;  1W3S A;  1YEZ A;  1Q1B A;  2HHH L;  1B4O A;  4KHP L;  4KKS A;  3CME A;  1IXR A;  2C5C A;  4CHT B;  2PZW A;  1XPR A;  1ASZ A;  3BDC A;  2JK8 A;  4HJ9 A;  1KDC A;  3P75 A;  5M5X H;  3OIP A;  5C44 H;  4CDF C;  4OHJ A;  1F2M A;  2VL6 A;  3CCE A;  3PUW A;  1UX4 A;  1SYG A;  4L5R C;  2A8V A;  3KYH C;  3QOL A;  1BBW A;  3PUV A;  5C5M A;  1PTO F;  1WTO A;  2FW2 A;  1CM9 A;  2AQ2 B;  4ZUI A;  2K05 A;  3KLS A;  3I3C A;  2ZJP A;  2VQF Q;  2NB0 A;  4A3F G;  4FJW D;  3PUZ A;  3HOW H;  1QIL A;  3CCL A;  4GOP A;  1KC8 C;  1PLF A;  1ZYR C;  1STE A;  2ID0 A;  3K0Y A;  1KAW A;  2B2W C;  2R7D A;  4U68 A;  3HOY H;  3RZD B;  1C4Q A;  3OW7 A;  2EXZ A;  4DR5 Q;  1K0R A;  1BCP F;  1E2W A;  3A54 A;  2ZTC A;  4PMB A;  4R8I A;  3A7A B;  3RLN A;  2R61 A;  2B39 A;  1O7Z A;  3TS2 A;  4DXF A;  4NKL A;  3K7A B;  4LNQ A;  4GKJ Q;  3AB9 A;  2MO1 A;  4BA1 I;  3R9T A;  1ENC A;  4HJ8 A;  4K3W A;  1PTO D;  1I3Q H;  4A3F B;  5AJ3 Q;  2RSN A;  4TSS A;  3E0J A;  3OYY A;  3MFG A;  4IJL A;  1HR0 W;  4AH6 A;  2K04 A;  5C4X B;  5EBC A;  3AQQ A;  5KJP A;  1LT6 D;  1F9P A;  1HTP A;  2XRS D;  4OX9 L;  1GUN A;  1EYC A;  1I50 B;  1QUQ B;  3E6Z X;  5BN3 A;  1EWC A;  2RDF A;  4C3J B;  3AU7 A;  4NXN Q;  2N3S A;  2JA5 H;  2IY5 B;  1STB A;  2JP1 A;  2I46 A;  3ICE A;  3SR1 A;  1K8M A;  2HIV A;  3D8G A;  3L8J A;  3SK8 A;  2C35 B;  2N88 A;  3P1H A;  3PF5 A;  4QCL A;  1F9Q A;  3N52 A;  4JI3 Q;  3EN2 A;  3NE5 B;  5I9O A;  3FMC A;  5J1Z A;  2EIF A;  5D14 A;  4ELX A;  3UDX A;  5LHY 1;  5ELD A;  2VQF L;  1SLJ A;  4L8J A;  3OPO A;  3PUY A;  3CCQ A;  3GTQ B;  1KLU D;  1O7I A;  3KBG A;  1KTK A;  3TEH B;  1M90 C;  3TME A;  2XIW A;  3MXG A;  3CU7 A;  2JEA I;  4EGV A;  4A93 G;  2K03 A;  4DR5 L;  1Q3L A;  1WTH A;  3Q22 A;  2BE5 C;  3HOZ G;  2ZTE A;  1V8Q A;  1XMO Q;  1IBM Q;  3J80 c;  3KLW A;  4KN7 C;  3S14 B;  4ELW A;  3GTL H;  1Q51 A;  2F0W A;  3UI2 A;  1HXY D;  4FYD A;  4A3L H;  4GKJ L;  4X3K A;  1TVX A;  3ULJ A;  1TWG B;  5KND A;  4FNF A;  3VR3 A;  3KJP A;  5J39 A;  3R8B A;  2B63 H;  2ZXO A;  2JA7 H;  4X3S A;  5C4Z A;  1YBY A;  5CC4 A;  2ZJQ A;  2JYO A;  2D62 A;  2IJ0 A;  3J81 E;  3I4L A;  3GTJ H;  2R7Z H;  5DLQ E;  2PQA A;  1BKB A;  2F0D A;  3EFX D;  4HIM A;  3D6W A;  1UEB A;  3F8T A;  4JCV E;  4OEM B;  1CFM A;  1E2Z A;  4A93 B;  1MJ3 A;  3HOZ B;  3NBH A;  4ZLT F;  3H81 A;  3TP5 A;  3I56 A;  1BOS A;  2FHT A;  2UXC L;  3L3O C;  1GUW A;  1HUN A;  3BVM A;  3CPF A;  4QIW B;  3S1Q H;  3PMF A;  1T5X D;  3HKS A;  1NBW A;  4MN3 A;  2EYF A;  3CXC A;  1TII D;  1B9M A;  2QIL A;  3F1Z A;  4JI3 L;  4POG A;  2VXW A;  4JI6 Q;  2VB2 X;  1VQH A;  3PSI A;  2K32 A;  3A0J A;  5M3F B;  1BNZ A;  1JT8 A;  3SGI A;  4ODG A;  4GNX B;  3JAM c;  3CPW A;  2EQS A;  2NVQ B;  3J81 i;  4DV0 Q;  2AHO B;  2A68 D;  3CKI B;  3OW2 A;  1C0A A;  1EY3 A;  3NK9 A;  1N34 Q;  1VQ7 A;  3R93 A;  3QIA A;  2N55 A;  1IBM L;  4YY3 Q;  5EKK A;  4DR2 Q;  1VCI A;  1A62 A;  1E22 A;  5JPN C;  1A3U A;  1PRT D;  3FDT A;  2JEB I;  4DF7 A;  4APV A;  1JWM D;  4A3D B;  4ZUJ A;  1CHQ D;  4K5W A;  4NDX A;  1SJE D;  4JOI A;  2B8F A;  3KF6 A;  4PMW A;  4HIK A;  4L6T B;  1E7Z A;  1EF8 A;  4R4C A;  5IT9 E;  1HA6 A;  2UUC Q;  3UE1 A;  5CBE E;  1STY A;  3HOX H;  3L9A X;  2J4X A;  1SRO A;  1S5D D;  3KLR A;  3P20 A;  1LT3 D;  1H9J A;  4G57 A;  5KRU A;  4LF6 L;  1V1P B;  2RHS B;  4R4I A;  1XPU A;  1E2V A;  3RQG A;  4YHH L;  4HSP A;  5A2Q E;  4HN7 A;  1QNK A;  5IWA Q;  4IQZ A;  1FGU A;  3HZX A;  4JVZ A;  3A4L A;  1O7Y A;  5LMN Q;  4A3C G;  4HMI A;  4DK1 A;  1X3Q A;  4A3E G;  3DWA A;  3GTM H;  2XVS A;  3RZD H;  3A55 A;  1II3 A;  3LX0 A;  4C1N I; 
#chains in the Genus database with same CATH homology
 1YJ9 A;  4DR7 L;  1VQ4 A;  4JYA Q;  4YWM A;  4AYB E;  4LUV A;  3STB D;  1Q46 A;  1CSP A;  1SMX A;  5IYC H;  1EIY B;  2VY3 A;  2Z6K A;  4A3B G;  4DV7 Q;  3HOX G;  1JMC A;  3VDY A;  2R93 G;  1EQR A;  2BA1 A;  4DV4 Q;  3G4S A;  3RQE A;  4BBS G;  3PO2 G;  1K9M C;  4IPD A;  1GM5 A;  4X66 Q;  4QGU A;  1MJC A;  4MTN A;  3CCM A;  4DV0 L;  1VQI A;  1SFO H;  4LF8 Q;  3BJU A;  5C4X H;  5M3M H;  3AM1 A;  5GAD C;  5C3E H;  3S1N H;  3TS0 A;  4DR4 L;  4K0K Q;  4L5T A;  2VNU D;  4AQY Q;  1C7Y A;  3RZO H;  4JI0 L;  1K83 H;  2DGY A;  1N34 L;  2Q2U A;  4JG2 A;  4NXM Q;  4UP8 A;  3CCV A;  3G71 A;  2UXB Q;  2A1A A;  3PIO A;  2OQK A;  4A76 A;  1PV4 A;  2EXD A;  1Z47 A;  1KL9 A;  3EIV A;  1EIF A;  4HID A;  4DPG A;  4DR2 L;  4X64 L;  1B70 B;  5M5Y H;  2YV5 A;  2L15 A;  3CC4 A;  1N32 L;  4C3J H;  4IOC A;  2OCE A;  2RF4 A;  4LF6 Q;  1MIU A;  2Q2T A;  4R4Q A;  5M3F G;  1E1O A;  3K80 C;  3HFZ B;  2CWA A;  2JA8 G;  4YHH Q;  5E7N A;  1YHQ A;  3F2C A;  3D31 A;  1Q1E A;  3PUX A;  4JI7 Q;  1CSQ A;  4QIW E;  2VW9 A;  2UUC L;  1QVF A;  1XNQ Q;  4LFB L;  3J80 i;  2Q2I A;  5IYC G;  1IYJ B;  1Q8K A;  1TXY A;  3B6Y A;  4LF9 L;  4A3K G;  1A63 A;  2KBN A;  5JJK A;  2NN6 I;  3CCS A;  2HIX A;  3E0E A;  4GKK L;  1EYG A;  2BH2 A;  2PQA B;  1TWH H;  3HOV G;  4R4O A;  2FXQ A;  1LTL A;  4IO9 A;  3M4P A;  3MEF A;  4J15 A;  5LMU L;  1GD7 A;  1KRT A;  2Y0S G;  5IWA L;  4GLX A;  3T1Y L;  2ZTD A;  4DR1 Q;  3FKI H;  1WOC A;  2NVX H;  3M4Q A;  1N33 Q;  1IBK L;  1XNR L;  4P73 A;  3KDF A;  3NEL A;  1L1O B;  4ME3 A;  5IY0 A;  3I4M G;  4LF4 L;  5GAE C;  3KF8 B;  3S1R H;  5FJ8 H;  4A3D G;  1Y14 B;  1J6Q A;  3I4N H;  1VQN A;  1OXS C;  4IJH A;  4DV1 Q;  3GTK H;  1JE5 A;  1U0L A;  5GQO A;  1V1Q A;  3TRE A;  2I5H A;  5FLM G;  3I7F A;  4JI1 L;  1QZH A;  1N9W A;  2VS1 A;  3D0F A;  3F2B A;  4A3M H;  4JYA L;  4IFD J;  1ASY A;  1KIX A;  4BBR G;  2Z6K C;  3S14 H;  2K14 A;  1GO3 E;  5IP7 G;  3STB C;  2GVB A;  1FL0 A;  5C4J H;  4RG1 A;  2K4K A;  3PGZ A;  4YCU A;  4DV7 L;  2F52 A;  4A3C H;  1TWG H;  2KCT A;  4DV4 L;  4A3E H;  1VQP A;  4HJ5 A;  3KDF B;  3RLO A;  1P8L A;  1OXX K;  4P72 A;  1LM0 A;  3BZC A;  4X66 L;  1K8A C;  4DR6 Q;  2JA9 A;  1N32 Q;  1I5F A;  5C44 G;  2Z0S A;  5K36 G;  1VQ5 A;  1WCM H;  2MNA A;  1TWA H;  4K0K L;  5IE8 A;  5H1S E;  1PFS A;  4AQY L;  3S1M H;  1PYS B;  3H15 A;  4DK6 C;  3AFP A;  3FHW A;  2KHJ A;  4JI4 Q;  2IHF A;  2UXB L;  3RR5 A;  3GDE A;  1L2F A;  1KHI A;  4DK3 C;  3L0O A;  3S16 H;  4A3B H;  1JJC B;  1YIT A;  1B7Y B;  2R93 H;  4LF9 Q;  2HHH Q;  3I2Z A;  4OWW B;  4BBS H;  3PO2 H;  4A3G G;  4KHP Q;  3UDI A;  4GN4 B;  2LXK A;  4A3I G;  3ADB A;  4DV6 L;  5C0X I;  3HOW G;  3E9H A;  1D8L A;  2K5H A;  4HIO A;  4GLV B;  1T9H A;  4JI7 L;  3U50 C;  3E9I A;  3T1Y Q;  2YU9 H;  1B8A A;  1L0W A;  4DV2 L;  3CC2 A;  1VQJ A;  3H3V I;  4YCV A;  3MXN B;  1X65 A;  4JBW A;  3T1H Q;  3HOY G;  2AWN A;  4XIG S;  5ELN A;  4QJF A;  3L8I A;  3GO5 A;  2KCM A;  4GEH B;  4C3I H;  1E24 A;  1Q7Y C;  2NN6 G;  1UE1 A;  2WB1 G;  4XTC S;  1YHA A;  4Y7N H;  5M3F H;  4MNO A;  2AKW B;  4JI1 Q;  3TQY A;  5GRO A;  2V1C C;  1X9N A;  1WI5 A;  2JA8 H;  1D7Q A;  1X6O A;  3I55 A;  3DM3 A;  4MZ9 A;  4DR1 L;  1YIJ A;  1TWC H;  1PHJ A;  2OTJ A;  1N33 L;  1PVO A;  1PYB A;  1N36 L;  1HH2 P;  2CKZ B;  4LUO A;  3S17 H;  5JJI A;  1IBL Q;  1RL2 A;  3W5O A;  4C2M H;  2NVQ H;  1G51 A;  1X3E A;  2H5X A;  4DUZ Q;  3JC6 6;  4DAY B;  2E8G A;  2E5L Q;  2A19 A;  4WJ4 A;  4A3K H;  1PH4 A;  3W8H B;  2VQE Q;  5GAG C;  3J81 j;  1X3F A;  4KLK A;  4OXP A;  2K52 A;  4DV1 L;  1VQ8 A;  4GN3 B;  3M7N A;  2OTL A;  1H95 A;  1X56 A;  4YCW A;  1SRU A;  3HOV H;  4OO1 G;  1HZB A;  4DAM A;  4EX5 A;  4HIK A;  3RN2 A;  1X55 A;  3CC7 A;  4JV5 L;  2QGQ A;  1KRS A;  2CFM A;  4A75 A;  2WB1 E;  3ULL A;  2MO0 A;  4BXX G;  4OWX B;  4POF A;  1PH9 A;  5HGQ A;  3S2H H;  1WFQ A;  5IP9 G;  1EOV A;  1XMQ Q;  1VQF A;  3I4M H;  2IHE A;  4HJ7 A;  1YJW A;  2K5V A;  3A4N A;  5IYD G;  4A3D H;  4B3M Q;  2UXD Q;  2UU9 Q;  2JA5 G;  3GTO H;  1UWV A;  2D0O A;  4DR6 L;  3CD6 A;  1DGS A;  2YTY A;  2I5L X;  5FLM H;  4GS3 A;  1AH9 A;  1KXL A;  1VQB A;  3CP0 A;  4LUZ A;  4OO1 I;  3CCU A;  1K73 C;  3ERS X;  4DV6 Q;  5HY6 A;  3T1H L;  4RMF A;  4BBR H;  1Y1W G;  2E2I H;  1Y1V G;  4JI4 L;  5FLX c;  4JI5 Q;  4OX9 Q;  5IP7 H;  1S40 A;  1W3S A;  5M5W H;  1YEZ A;  5AJ3 L;  3CCR A;  4DV2 Q;  1Q1B A;  4DV5 Q;  2HHH L;  4KHP L;  2IT1 A;  3CME A;  4JBJ A;  1IXR A;  2YTV A;  2QEX A;  1NTG A;  1XPR A;  4C3H H;  1ASZ A;  2JK8 A;  4FDB A;  4HJ9 A;  4DR3 Q;  5M5X H;  1PH5 A;  4LF7 Q;  1HJP A;  4P74 A;  5C44 H;  3CMA A;  2VL6 A;  3CCE A;  3G6E A;  3CQZ H;  1PH7 A;  3RLF A;  3OTO Q;  4Y52 H;  3PUW A;  2NZO A;  2VZA A;  5JEA G;  5C0X G;  1UX4 A;  1AE3 A;  3CCJ A;  4L5R C;  4DUY L;  2A8V A;  3KYH C;  1YI2 A;  1HNZ Q;  1N36 Q;  2N8N A;  4BY1 G;  3KOJ A;  3W8I B;  1BBW A;  2PMZ E;  3PUV A;  4IPH A;  1X3G A;  4O2D A;  1VQE A;  2P63 A;  1X54 A;  4NXN L;  1VQO A;  2NVY H;  1XTD A;  2ASB A;  3PO3 H;  4JBM A;  2PI2 A;  3K81 C;  2LXJ A;  4A3G H;  2K5N A;  1C9O A;  1VQK A;  1PH1 A;  1G29 1;  2ZJP A;  4A3I H;  3K8A A;  2VQF Q;  3FP9 A;  4A3F G;  3PUZ A;  3KFU A;  4QY7 A;  3RQF A;  2WAQ G;  3HOW H;  4JV5 Q;  4A3L G;  3CCL A;  4GOP A;  2WP8 J;  3S24 A;  1KC8 C;  3W1B A;  1R9T H;  1IBL L;  2UUA L;  2ID0 A;  1OTC A;  2Y0S E;  1KAW A;  2HQL A;  2JE6 I;  4DUZ L;  2E5L L;  2B63 G;  2JA7 G;  1XPO A;  1BBU A;  2R7D A;  2VUM G;  3HOY H;  4BY7 G;  2VQE L;  4UP7 A;  1HNW Q;  4DR5 Q;  2R7Z G;  1K0R A;  1YNX A;  2ZM6 Q;  5GAH C;  2ZTC A;  3HKZ G;  2AMC B;  1LUZ A;  3RLN A;  2Q2H A;  1QUQ A;  1Q12 A;  3TS2 A;  4LNQ A;  2E2J H;  2WAQ E;  4GKJ Q;  2MO1 A;  1XMQ L;  4BA1 I;  4WJ3 M;  4P71 A;  4HJ8 A;  1J5E L;  1XJV A;  1EQQ A;  1I3Q H;  4GOP B;  2UXD L;  4B3M L;  5AJ3 Q;  2UU9 L;  5BR8 Q;  1XMO L;  3PO3 G;  3OYY A;  4IJL A;  1HR0 W;  4AH6 A;  3AQQ A;  2MQH A;  1QZG A;  2HT1 A;  2RHQ B;  1WYD A;  1QVG A;  1I94 Q;  1MJE A;  4ALP A;  3A4M A;  4JI5 L;  4OX9 L;  4BXX H;  2F3I A;  2I5M X;  1E1T A;  4TQU S;  4DUY Q;  1QUQ B;  1UX5 A;  2YYZ A;  5IP9 H;  4DV5 L;  4B3T Q;  2R92 G;  4A3J G;  1LYL A;  2B29 A;  5IYD H;  1PA6 A;  4NXN Q;  1FJG Q;  4R1J A;  2N3S A;  4HJA A;  1BVS A;  2JA5 H;  1YJN A;  2IY5 B;  4DR3 L;  3M85 A;  4LF7 L;  2RCN A;  1K3R A;  3F2D A;  3ICE A;  2R6G A;  1Z9F A;  1GKH A;  1HZC A;  1Q82 C;  2HIV A;  3OTO L;  2JA6 G;  3CF5 A;  3L8J A;  1NMF A;  1Y1W H;  2C35 B;  2UUB Q;  4JI2 L;  1Y1V H;  4IPC A;  4AYB G;  3AJM A;  4UPA A;  1U5K A;  4GNX C;  4EQ5 A;  3U58 A;  3PF5 A;  1HNZ L;  3L2P A;  2E2H H;  4JI3 Q;  5ELO A;  1NY4 A;  3EN2 A;  2UUA Q;  3EBE A;  2EIF A;  3A5U A;  3AYH B;  4DKA C;  2MFI A;  1SN8 A;  3UDX A;  1VQD A;  2D0P A;  4X6A H;  1MKH A;  4IPG A;  2K75 A;  1SLJ A;  2VQF L;  1EFW A;  1SE8 A;  4GOP C;  3PUY A;  3CCQ A;  1Y64 B;  1JJ2 A;  3M4O H;  3PV0 A;  4BA2 I;  2N49 A;  1O7I A;  1JJG A;  3TEH B;  3RN5 A;  3GTG H;  1VS0 A;  1M90 C;  3ADC A;  4BY1 H;  3K0X A;  4JI6 L;  4KI0 A;  2JEA I;  4YWL A;  5IYB G;  5JEA J;  5C0X J;  3H3V H;  4A93 G;  1J5E Q;  1HNW L;  1VQG A;  3A5Z B;  4DR5 L;  3J7A 5;  3K7A H;  1HR0 Q;  4LF5 Q;  1PH2 A;  3HOZ G;  2ZM6 L;  2CQO A;  2ZTE A;  1IZ6 A;  1XMO Q;  3G48 A;  1VQA A;  1IBM Q;  1OXV A;  3J80 c;  3KLW A;  4NPS A;  4A3F H;  3O4X E;  3GTL H;  4PZ6 A;  4PG3 A;  4A3L H;  3GTP H;  4GKJ L;  4OWT B;  4LFC Q;  4DV3 Q;  4QQB X;  3ULJ A;  2ATW A;  1A0I A;  1SR3 A;  3KJP A;  4X62 Q;  2XTI A;  2NZH A;  3WWV A;  1OXU A;  2B63 H;  2JA7 H;  2VUM H;  2IX0 A;  1YBY A;  5BR8 L;  2ZJQ A;  1CKM A;  4BY7 H;  2D62 A;  4B3R Q;  4YY3 L;  3GTJ H;  1VQL A;  2R7Z H;  2NVT H;  4YWK A;  5DLQ E;  1S72 A;  1I50 H;  1N8R C;  3HOU G;  2PQA A;  1BKB A;  2IX1 A;  3ULP A;  3AFQ A;  4HIM A;  4IFD I;  1YZ6 A;  1CKO A;  3H0G G;  1I94 L;  4LFA L;  1UEB A;  1P16 A;  3F8T A;  4JCV E;  4A4I A;  3CAM A;  3J7Z C;  4JOI C;  2ES2 A;  3NEN A;  4JI2 Q;  4L5Q A;  4B3T L;  1L1O A;  4X65 Q;  4IOA A;  1HNX Q;  1Q81 C;  2JQO A;  3CW2 C;  3J81 c;  4JI8 L;  3K7U C;  4B3S L;  1FJG L;  1UE5 A;  1V9P A;  4AIM A;  4GNX A;  3I56 A;  5J3B A;  1EUJ A;  2UXC L;  3PIP A;  1QVC A;  5EAY A;  3CPF A;  2I0Q A;  4LWC A;  1V43 A;  4R4T A;  3S1Q H;  4PZ8 A;  3ZJY C;  4QL5 A;  3UE0 A;  4JBK A;  3HKS A;  1NBW A;  2UUB L;  2YTX A;  3CXC A;  4P75 A;  1VQC A;  2CCZ A;  1HZA A;  3F1Z A;  4JI3 L;  2QA4 A;  5M3M G;  1NJI C;  3ADD A;  5C3E G;  1KD1 C;  5C4X G;  2F4V L;  4OON A;  3GTQ H;  2XGT A;  2R92 H;  4DR7 Q;  1OXT A;  1S3O A;  5JJL A;  4POG A;  2CWP A;  2KHI A;  4A3J H;  4JI6 Q;  5LMN L;  3PF4 A;  1NMG A;  2PI2 E;  1VQH A;  3PSI A;  1NE3 A;  3A0J A;  3NBH B;  1KQS A;  2AWO A;  1JT8 A;  3SGI A;  5LMN W;  4UP9 A;  1GVP A;  3A74 A;  1HZ9 A;  4GN5 A;  4GNX B;  1K8G A;  2KEN A;  2ZJR A;  3S15 H;  3JAM c;  3CPW A;  3TRZ A;  1UE6 A;  1PH3 A;  2JA6 H;  3M3Y H;  1WJJ A;  2EQS A;  3J81 i;  3GD7 A;  1I6H H;  4DV0 Q;  3UDG A;  4NNQ A;  2AHO B;  3I4O A;  1YVC A;  3OW2 A;  4DR4 Q;  1C0A A;  1M1K C;  1HR0 L;  4LF5 L;  4JI0 Q;  2R7F A;  1N34 Q;  1VQ7 A;  2GVA A;  2ALY B;  4LW1 A;  1RJM A;  1IBM L;  4YY3 Q;  3Q8D A;  1YHB A;  3RNU A;  2BA0 A;  2OQ0 A;  4X64 Q;  2LSS A;  1VCI A;  4DR2 Q;  1A62 A;  1E22 A;  3KJO A;  3HKZ E;  3L7Z C;  4LFA Q;  4LFC L;  4DV3 L;  4LF8 L;  1CUK A;  2K50 A;  4H02 A;  2OWO A;  4UY8 C;  2JEB I;  4X62 L;  4APV A;  3ER0 A;  1VQM A;  4NXM L;  1AE2 A;  5IYB H;  3FKI G;  4JOI A;  4A93 H;  4B3R L;  1FVI A;  2DUD A;  3KF6 A;  4PMW A;  3BU2 A;  3PCO B;  1E7Z A;  2GN5 A;  2B3G A;  4R4C A;  4GLA C;  4JI8 Q;  2UUC Q;  2PNH A;  3UE1 A;  4B3S Q;  4L5S A;  3HOZ H;  1A8V A;  3JAM i;  4LFB Q;  3HOX H;  1EWI A;  2UXC Q;  5FJ8 G;  1SRO A;  3I4N G;  3U4V A;  1CKN A;  3DLL A;  4PZ7 A;  4LF6 L;  1L1O C;  4O0A A;  1PH8 A;  3AEV A;  4IFD G;  4GKK Q;  4R4I A;  2RHS B;  1XPU A;  2N78 A;  3RQG A;  4YHH L;  4A3M G;  1PH6 A;  2JJQ A;  3BZK A;  4X65 L;  1HNX L;  3S2D H;  3LGJ A;  5LMU Q;  2F4V Q;  5IWA Q;  1XNQ L;  3NEM A;  5IT9 c;  1UE7 A;  1W2B A;  1E3P A;  1IL2 A;  1FGU A;  2WFW A;  4JC0 A;  4KHZ A;  3A4L A;  4TVA B;  1Q86 C;  5LMN Q;  1IBK Q;  1XNR Q;  4A3C G;  3HOU H;  3W1G A;  4LF4 Q;  3KF6 B;  4DNI A;  3IRB A;  4NB3 A;  3M9B A;  4A3E G;  1RIP A;  3U4Z A;  3H0G H;  1G6P A;  1VQ6 A;  1JB7 A;  3GTM H;  1TWF H;  3RZD H;  3UDF A;  1VQ9 A;  2BH8 A;  1WCM G;  1CKN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...