3W8HB

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of stk25
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
b'EFSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 10
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 24
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3w8hB00
3RQGA 3L8IA 4GEHB 3RQFA 3W8IB 3W8HB 3AJMA 3RQEA 3L8JA
chains in the Genus database with same CATH superfamily
1HZDA 4OG1A 3T89A 4GEHB 2IEXA 3Q0GA 3TRRA 4NEKA 3SLLA 3OC7A 3AM1A 1UIYA 2UZFA 3SWXA 1DUBA 5JBXA 4ELWA 3QXIA 4JOTA 1UX4A 2FBMA 4ELSA 3MOYA 4K2NA 1EF8A 5C9GA 3AJMA 3MYBA 3G64A 2EJ5A 2FW2A 3O4XE 4MI2A 4FJWD 4IZBA 2PBPA 4OLQA 3A4MA 4JWVA 3TLFA 4IZCA 1EF9A 1Q51A 4FZWA 3RQGA 4I42A 4JCSA 1RJMA 2HW5A 2ZQRA 3RQEA 3L8JA 3R0OA 3H81A 3RSIA 3ADDA 4F47A 2F6QA 3A4NA 3W8IB 3HINA 3Q0JA 4JYLA 1JXZA 3IRBA 2QQ3A 3L8IA 2GTRA 1Q52A 4EMLA 1MJ3A 1NZYA 3R9SA 2ZQQA 1DCIA 1EY3A 4MOUA 4WCZA 3R9TA 3T88A 4QIIA 4JFCA 3H02A 4IZDA 5KJPA 4I4ZA 3Q1TA 4ZU2A 1Y64B 3RQFA 3FDUA 2P63A 4U18A 3A4LA 4I52A 3QK8A 2PPYA 1WZ8A 3T8AA 1RJNA 4FZWC 4KNPA 4NNQA 3ADCA 2VREA 4U1AA 4U19A 4ELXA 1NZYB 4K3WA 3ADBA 3QXZA 2VX2A 3I47A 3PZKA 1UX5A 2DUBA 4QIJA 3KQFA 3HRXA 3P5MA 5JBWA 3W8HB
chains in the Genus database with same CATH topology
1Y64B 4GEHB 3RQFA 3A4MA 2P63A 3A4LA 3RQGA 3AM1A 1RJMA 3ADCA 4NNQA 3RQEA 3L8JA 3ADDA 3A4NA 3ADBA 1UX4A 3W8IB 3AJMA 1UX5A 3IRBA 3L8IA 3O4XE 3W8HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQG A;  3L8I A;  4GEH B;  3RQF A;  3W8I B;  3W8H B;  3AJM A;  3RQE A;  3L8J A; 
#chains in the Genus database with same CATH topology
 1HZD A;  4OG1 A;  3T89 A;  4GEH B;  2IEX A;  3Q0G A;  3TRR A;  4NEK A;  3SLL A;  3OC7 A;  3AM1 A;  1UIY A;  2UZF A;  3SWX A;  1DUB A;  5JBX A;  4ELW A;  3QXI A;  4JOT A;  1UX4 A;  2FBM A;  4ELS A;  3MOY A;  4K2N A;  1EF8 A;  5C9G A;  3AJM A;  3MYB A;  3G64 A;  2EJ5 A;  2FW2 A;  3O4X E;  4MI2 A;  4FJW D;  4IZB A;  2PBP A;  4OLQ A;  3A4M A;  4JWV A;  3TLF A;  4IZC A;  1EF9 A;  1Q51 A;  4FZW A;  3RQG A;  4I42 A;  4JCS A;  1RJM A;  2HW5 A;  2ZQR A;  3RQE A;  3L8J A;  3R0O A;  3H81 A;  3RSI A;  3ADD A;  4F47 A;  2F6Q A;  3A4N A;  3W8I B;  3HIN A;  3Q0J A;  4JYL A;  1JXZ A;  3IRB A;  2QQ3 A;  3L8I A;  2GTR A;  1Q52 A;  4EML A;  1MJ3 A;  1NZY A;  3R9S A;  2ZQQ A;  1DCI A;  1EY3 A;  4MOU A;  4WCZ A;  3R9T A;  3T88 A;  4QII A;  4JFC A;  3H02 A;  4IZD A;  5KJP A;  4I4Z A;  3Q1T A;  4ZU2 A;  1Y64 B;  3RQF A;  3FDU A;  2P63 A;  4U18 A;  3A4L A;  4I52 A;  3QK8 A;  2PPY A;  1WZ8 A;  3T8A A;  1RJN A;  4FZW C;  4KNP A;  4NNQ A;  3ADC A;  2VRE A;  4U1A A;  4U19 A;  4ELX A;  1NZY B;  4K3W A;  3ADB A;  3QXZ A;  2VX2 A;  3I47 A;  3PZK A;  1UX5 A;  2DUB A;  4QIJ A;  3KQF A;  3HRX A;  3P5M A;  5JBW A;  3W8H B; 
#chains in the Genus database with same CATH homology
 1Y64 B;  4GEH B;  3RQF A;  3A4M A;  2P63 A;  3A4L A;  3RQG A;  3AM1 A;  1RJM A;  3ADC A;  4NNQ A;  3RQE A;  3L8J A;  3ADD A;  3A4N A;  3ADB A;  1UX4 A;  3W8I B;  3AJM A;  1UX5 A;  3IRB A;  3L8I A;  3O4X E;  3W8H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...