3W8HB

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of stk25
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
EFSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
total genus 24
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3w8hB00
3AJMA 3W8HB 3W8IB 3RQGA 4GEHB 3RQFA 3RQEA 3L8JA 3L8IA
chains in the Genus database with same CATH superfamily
4KNPA 1JXZA 5C9GA 1WZ8A 3Q1TA 4GEHB 3A4MA 2VREA 3Q0JA 4WCZA 5JBWA 3Q0GA 3O4XE 1EY3A 3RSIA 3HRXA 4U18A 3W8IB 2IEXA 4ELWA 1HZDA 1EF9A 3MOYA 3A4NA 1Y64B 3H02A 3SWXA 4U1AA 5KJPA 4MI2A 4JOTA 1UIYA 2PPYA 3ADCA 4OLQA 4JFCA 4K3WA 3FDUA 4ELXA 4I42A 3KQFA 2FW2A 3HINA 4FZWA 3RQGA 1RJMA 3AM1A 4JCSA 2UZFA 2GTRA 2VX2A 3L8JA 4OG1A 1NZYB 2PBPA 3ADBA 3TRRA 3T8AA 1EF8A 3RQFA 3R0OA 2QQ3A 4EMLA 3MYBA 3T89A 3I47A 1UX4A 3L8IA 4MOUA 4NNQA 1Q52A 2HW5A 4FZWC 4FJWD 1DUBA 2ZQQA 3AJMA 3A4LA 3PZKA 3T88A 4QIIA 2ZQRA 4JYLA 1NZYA 4IZDA 1UX5A 4I4ZA 4JWVA 4NEKA 3QK8A 3ADDA 3QXZA 1MJ3A 3OC7A 3P5MA 3TLFA 2EJ5A 1DCIA 2FBMA 3R9SA 3W8HB 4F47A 4K2NA 2P63A 3RQEA 1RJNA 4U19A 3G64A 3R9TA 4I52A 4IZCA 4ELSA 3IRBA 3SLLA 5JBXA 4QIJA 2F6QA 4ZU2A 1Q51A 4IZBA 3QXIA 3H81A 2DUBA
chains in the Genus database with same CATH topology
3ADDA 4GEHB 3ADCA 3L8IA 1UX4A 3A4MA 4NNQA 3W8HB 3O4XE 2P63A 3RQEA 3AJMA 3A4LA 3W8IB 3RQGA 1RJMA 3AM1A 3L8JA 3A4NA 1Y64B 3IRBA 3ADBA 1UX5A 3RQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  3W8H B;  3W8I B;  3RQG A;  4GEH B;  3RQF A;  3RQE A;  3L8J A;  3L8I A; 
#chains in the Genus database with same CATH topology
 4KNP A;  1JXZ A;  5C9G A;  1WZ8 A;  3Q1T A;  4GEH B;  3A4M A;  2VRE A;  3Q0J A;  4WCZ A;  5JBW A;  3Q0G A;  3O4X E;  1EY3 A;  3RSI A;  3HRX A;  4U18 A;  3W8I B;  2IEX A;  4ELW A;  1HZD A;  1EF9 A;  3MOY A;  3A4N A;  1Y64 B;  3H02 A;  3SWX A;  4U1A A;  5KJP A;  4MI2 A;  4JOT A;  1UIY A;  2PPY A;  3ADC A;  4OLQ A;  4JFC A;  4K3W A;  3FDU A;  4ELX A;  4I42 A;  3KQF A;  2FW2 A;  3HIN A;  4FZW A;  3RQG A;  1RJM A;  3AM1 A;  4JCS A;  2UZF A;  2GTR A;  2VX2 A;  3L8J A;  4OG1 A;  1NZY B;  2PBP A;  3ADB A;  3TRR A;  3T8A A;  1EF8 A;  3RQF A;  3R0O A;  2QQ3 A;  4EML A;  3MYB A;  3T89 A;  3I47 A;  1UX4 A;  3L8I A;  4MOU A;  4NNQ A;  1Q52 A;  2HW5 A;  4FZW C;  4FJW D;  1DUB A;  2ZQQ A;  3AJM A;  3A4L A;  3PZK A;  3T88 A;  4QII A;  2ZQR A;  4JYL A;  1NZY A;  4IZD A;  1UX5 A;  4I4Z A;  4JWV A;  4NEK A;  3QK8 A;  3ADD A;  3QXZ A;  1MJ3 A;  3OC7 A;  3P5M A;  3TLF A;  2EJ5 A;  1DCI A;  2FBM A;  3R9S A;  3W8H B;  4F47 A;  4K2N A;  2P63 A;  3RQE A;  1RJN A;  4U19 A;  3G64 A;  3R9T A;  4I52 A;  4IZC A;  4ELS A;  3IRB A;  3SLL A;  5JBX A;  4QIJ A;  2F6Q A;  4ZU2 A;  1Q51 A;  4IZB A;  3QXI A;  3H81 A;  2DUB A; 
#chains in the Genus database with same CATH homology
 3ADD A;  4GEH B;  3ADC A;  3L8I A;  1UX4 A;  3A4M A;  4NNQ A;  3W8H B;  3O4X E;  2P63 A;  3RQE A;  3AJM A;  3A4L A;  3W8I B;  3RQG A;  1RJM A;  3AM1 A;  3L8J A;  3A4N A;  1Y64 B;  3IRB A;  3ADB A;  1UX5 A;  3RQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...