3W8HB

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of stk25
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
EFSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 10
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 24
structure length 66
sequence length 66
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3w8hB00
3W8IB 3RQEA 4GEHB 3W8HB 3L8JA 3L8IA 3RQFA 3RQGA 3AJMA
chains in the Genus database with same CATH superfamily
4MI2A 3O4XE 3RQEA 2P63A 5JBXA 4U18A 2FBMA 2F6QA 2PPYA 3I47A 1RJNA 1WZ8A 3TRRA 3W8IB 1UIYA 1HZDA 3A4MA 4K2NA 3G64A 2FW2A 2IEXA 4U19A 4JFCA 3PZKA 3AJMA 3IRBA 3TLFA 4JYLA 3ADDA 3MYBA 4K3WA 5KJPA 3T8AA 3QXIA 2GTRA 1MJ3A 1Y64B 3H02A 3QK8A 4OLQA 2ZQQA 1EY3A 1NZYA 3Q0JA 4I42A 2VREA 4GEHB 4MOUA 3MOYA 1EF8A 3RQGA 4NNQA 1DCIA 5JBWA 1RJMA 2ZQRA 3AM1A 4IZDA 3L8JA 3QXZA 3ADBA 4OG1A 4FZWA 4EMLA 4I4ZA 3SLLA 3RQFA 1NZYB 4QIJA 3KQFA 3ADCA 2HW5A 4WCZA 3HRXA 3L8IA 2QQ3A 2VX2A 4U1AA 4NEKA 4FJWD 1Q51A 3Q0GA 1JXZA 3R9TA 3HINA 1DUBA 3OC7A 5C9GA 1EF9A 3P5MA 4QIIA 3A4LA 4F47A 2PBPA 4ELXA 4ZU2A 1UX4A 2DUBA 4JWVA 3H81A 3R0OA 4IZBA 3FDUA 4ELWA 3T88A 3RSIA 4JCSA 4IZCA 4ELSA 1UX5A 4KNPA 3SWXA 3A4NA 4FZWC 3Q1TA 4JOTA 1Q52A 2UZFA 2EJ5A 3W8HB 3T89A 4I52A 3R9SA
chains in the Genus database with same CATH topology
3ADCA 3O4XE 3RQEA 2P63A 3L8IA 3W8IB 3A4MA 4GEHB 3RQGA 3AJMA 4NNQA 1UX5A 3IRBA 3ADDA 1RJMA 3AM1A 3A4NA 3L8JA 3ADBA 3A4LA 1Y64B 3W8HB 3RQFA 1UX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8I B;  3RQE A;  4GEH B;  3W8H B;  3L8J A;  3L8I A;  3RQF A;  3RQG A;  3AJM A; 
#chains in the Genus database with same CATH topology
 4MI2 A;  3O4X E;  3RQE A;  2P63 A;  5JBX A;  4U18 A;  2FBM A;  2F6Q A;  2PPY A;  3I47 A;  1RJN A;  1WZ8 A;  3TRR A;  3W8I B;  1UIY A;  1HZD A;  3A4M A;  4K2N A;  3G64 A;  2FW2 A;  2IEX A;  4U19 A;  4JFC A;  3PZK A;  3AJM A;  3IRB A;  3TLF A;  4JYL A;  3ADD A;  3MYB A;  4K3W A;  5KJP A;  3T8A A;  3QXI A;  2GTR A;  1MJ3 A;  1Y64 B;  3H02 A;  3QK8 A;  4OLQ A;  2ZQQ A;  1EY3 A;  1NZY A;  3Q0J A;  4I42 A;  2VRE A;  4GEH B;  4MOU A;  3MOY A;  1EF8 A;  3RQG A;  4NNQ A;  1DCI A;  5JBW A;  1RJM A;  2ZQR A;  3AM1 A;  4IZD A;  3L8J A;  3QXZ A;  3ADB A;  4OG1 A;  4FZW A;  4EML A;  4I4Z A;  3SLL A;  3RQF A;  1NZY B;  4QIJ A;  3KQF A;  3ADC A;  2HW5 A;  4WCZ A;  3HRX A;  3L8I A;  2QQ3 A;  2VX2 A;  4U1A A;  4NEK A;  4FJW D;  1Q51 A;  3Q0G A;  1JXZ A;  3R9T A;  3HIN A;  1DUB A;  3OC7 A;  5C9G A;  1EF9 A;  3P5M A;  4QII A;  3A4L A;  4F47 A;  2PBP A;  4ELX A;  4ZU2 A;  1UX4 A;  2DUB A;  4JWV A;  3H81 A;  3R0O A;  4IZB A;  3FDU A;  4ELW A;  3T88 A;  3RSI A;  4JCS A;  4IZC A;  4ELS A;  1UX5 A;  4KNP A;  3SWX A;  3A4N A;  4FZW C;  3Q1T A;  4JOT A;  1Q52 A;  2UZF A;  2EJ5 A;  3W8H B;  3T89 A;  4I52 A;  3R9S A; 
#chains in the Genus database with same CATH homology
 3ADC A;  3O4X E;  3RQE A;  2P63 A;  3L8I A;  3W8I B;  3A4M A;  4GEH B;  3RQG A;  3AJM A;  4NNQ A;  1UX5 A;  3IRB A;  3ADD A;  1RJM A;  3AM1 A;  3A4N A;  3L8J A;  3ADB A;  3A4L A;  1Y64 B;  3W8H B;  3RQF A;  1UX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...