3ADCA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
246
Chain Sequence
b'HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 87
structure length 246
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3adcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adcA01
1SXJD 4KYIB 3CF2A 3CX7A 5DN6D 4LV6A 3V00A 1U9IC 2WHXA 4DKXA 3RC3A 1ZCBA 1L2TA 1RKBA 2G0TA 2OLJA 3BD9A 3IQXA 4TLBA 5AUQA 1GRNA 5J47A 1W49A 3L43A 4G01B 4JKIA 4HB0A 2O8FA 2FSGA 3RS4A 1KOFA 1NNEA 3V4FA 2XTZA 4BRWA 4J0QA 2A5JA 2WAYA 1NKSA 2J7PA 5A0FA 2ZE5A 4QHTA 4L9WA 3QBTA 5GVSA 4EPTA 5LB2A 2FEOA 4M9XA 1P9NA 3SEAA 1R10A 4Q19A 4QHYA 3DHWC 3IBYA 2VSOA 1R8SA 3I8XA 1CF4A 5EQTA 1KK1A 4P4SB 4XVRA 2CHQA 2RGXA 2ZITA 2AFIE 3A8TA 2YWEA 2AKAB 3H0KA 2VA8A 3GJ6A 2R8RA 3R7WA 5IRCD 3KKQA 1DAGA 1GKUB 2BVNA 3DPUA 2GF0A 5IF9A 1P2SA 4B75A 1X1SA 3PUXA 1XX6A 2MMCA 3QKTA 3NEJA 1KKMA 4B35A 4U7DA 1N25A 1UBGA 2VL7A 4E09A 2JLWA 1MO6A 1NLZA 3UMFA 4E07A 3L2OB 3KJIA 1MRSA 2J1LA 1G5TA 2VLIA 2DY1A 1E94E 4EPRA 1P3JA 2ZRNA 4FINA 2NO7A 1MV5A 3EG5A 3KUDA 4DEYA 3QEOA 1FW6A 4C2UA 1GOTA 3GMTA 2KBFA 4AG6A 1RFLA 2ZYWX 4M0LA 1TU4A 4AIIA 1GRQA 3PUVA 1F2TB 2ZYTX 4C0QC 2BM0A 1KSHA 2GESA 2RHMA 3UATA 2YC4C 4MGIR 5C46F 1ZC4A 3SJZA 1EK0A 2Z6VA 3FHTA 4C7OB 5HCIA 1NSTA 2W00A 5DSZA 5KPDA 5TDHA 4TYYA 4TL6A 1IM2A 2PLRA 3OE7A 5D3QA 2WWYA 4M9ZA 2G3YA 2AD5A 4EQ6B 4AWXA 2P67A 1ZMXA 1FX0A 2FFQA 1XTQA 1KKLA 2IW3A 1E0KA 4B3GA 1W4RA 3K70C 4XVQA 2W0MA 4BRUA 1XEWX 2QAGC 4OHVA 1G5PA 1S9HA 1FFHA 4ASUD 3LVRE 4BZPA 5BN5A 4DC9A 1X8KA 5DE3A 2ZETA 1ZRHA 2GCPA 5H68A 2IX3A 3AVOA 1T8TA 2NO6A 1P72A 4NBSA 4QBFA 3TLXA 3IEUA 1RE0A 4Z54A 2ORVA 5KO2A 5E3HA 4WVFA 4C0BA 2IC5A 2ZIAA 4LYHA 4TTQA 3NBFA 4Q1CA 3B1YA 2EW1A 1IONA 1WMSA 5EP3A 1IQPA 5L3SA 3ZD6A 2GJ9A 3TBKA 1KJWA 1R4AA 2XITA 4TSFA 1TU3A 5FBLB 1A82A 1JEEA 1UFQA 4OHZA 1W36B 2FSHA 2OO7A 1IN8A 2RGAA 4C0HA 1T6NA 4D2IA 4ZDIA 2YHSA 2YJTD 3OHMA 1AGPA 1RW4A 2GJSA 4Q7MB 3IEVA 3VR4A 3TK1A 5FUYA 3OAAD 2V6IA 4UNRA 5KSYA 3GJ5A 1X8LA 1UDXA 2G0NA 3ADBA 2W0SA 1OE0A 5CB6A 2IYUA 1U99A 2C99A 3KQLA 3EPLA 4BUJA 2X1VA 5G53C 4TTRA 4G5OA 2VO1A 1CULC 1RJ9A 5FI1B 1JQJC 3K09A 3MSXA 3QKSB 1TEXA 3B1ZA 4D25A 2CDNA 1OIWA 1J8MF 1R0ZA 4GPTA 4BFZA 3A4NA 5JEEA 4TQ9A 4B73A 5JJLA 4WIAA 3IIMA 4L9SA 2WZQA 4XH9B 4B74A 4NCIA 1NVXQ 2GJ8A 2KE5A 2XTMA 2PH1A 4LHYA 1N5IA 1RIFA 2GCNA 2ZRKA 3DVLA 4HI0E 2FZ4A 2AXNA 2QNRA 2WJVA 3I8SA 3LXRA 4LJ4A 3SNHA 1DADA 5TXGA 1G41A 4V0MA 2ZSFA 1CU1A 5D3MB 1A2BA 4A0HA 4KITB 1HUQA 2ZU0C 2XB2A 2NZ8A 2VP9A 3LBIA 3OEED 5G40A 1V5WA 2FPLA 2QY9A 3UMRA 3ZZTA 1Z6GA 2ZEJA 1WDTA 3QQ5A 1UADA 1E9EA 1ZNZA 1XTSA 3DM9B 3T1OA 4BEBA 3O8RA 4E03A 2IYLD 3MUFA 1N6PA 5CYOA 4F92B 3PV0A 1KY2A 4TMKA 3U3RA 1S4QA 1M1YE 3UPUA 1HE8B 1OHHA 4RD0A 4NCKA 3BAFA 3W5IA 3HJNA 4WA7A 4CZ2A 3MJHA 2IYSA 3UG6A 4LPSA 3MJRA 2O5VA 2QP3A 4POAA 1QRAA 2QE7D 2KSQA 2GF9A 3ZVMA 1TMKA 5SZJA 5JI2E 1LB1B 1Z29A 2JEOA 1SHZA 3Q3JB 3PJRA 3NHAA 3IO3A 2X77A 3T61A 3CPEA 3U7GA 4YMUA 4M1TA 4BEJA 2RHDA 1SULA 1OH5A 1E2IA 2ZVQX 5B58C 1KNXA 3RRZA 3FDIA 4OL0A 3TW8B 2FA9A 4OI1A 2GHIA 2OCPA 1Q22A 1ONBA 1G7TA 3GJ0A 4D0GA 1NI3A 1CP2A 1CJKC 2CLSA 3QE0A 3C8UA 3RS3A 1Q3TA 2LKDA 1J8YF 2VH5R 1LF5A 2FEMA 1RYFA 4Q1AA 3IQWA 5J4YA 4A0GA 1W0KA 3LY5A 2KJQA 2OM2A 3GJ7A 5C18A 4LJ8A 1W36C 2QMOA 4YMTA 5DN6A 2ZANA 1E2EA 3F5FA 1Z0KA 1GSIA 4GZMA 2XOKD 2XNSA 2DFTA 5EE0A 4URVR 1NVVQ 3GLHE 3LBNA 1ZCAA 1R0YA 2OAQ1 3UG7A 1L4YA 2JLQA 4XTCS 3DO6A 2REOA 4DZZA 4MITA 5FOWA 3SYKA 4KODA 2UKDA 3CNOA 2DPXA 3DL0A 4DCNA 1E2GA 4Q01A 3UWOA 3SHFA 3GLHB 5KTYA 2ODWA 4NZYA 2PT5A 1ZU4A 2FNAA 3A1UA 3DMNA 3BH0A 2ZI9A 2J7KA 5TB5A 5AUOB 4B43A 3OF5A 1GAJA 1D2NA 4LSGA 1MT0A 3VHXA 1UKYA 3AKCA 2R6DA 4KI0A 4IEIA 2OEPA 5FL7D 1Z47A 5JMTA 1Q12A 2BBSA 4C7OA 3NH9A 4EKDA 1F2UB 1U94A 1XD2A 2H5EA 2ZS9A 2XGJA 1KO4A 3B9QA 3QG5A 1E3MA 2DB3A 3FYHA 2QEQA 2QENA 1E2NA 4TYWA 2C9YA 2PJZA 4IDOA 4A8JB 3U5ZB 4IW3B 4FMCF 4GZLA 1NBMD 2F1HA 2DHRA 2PEZA 4MKHA 4MRPA 4PQYA 1H8HD 3QKRA 4EPYA 3NKVA 4Q5IA 3CRVA 4L16A 2QRZA 1GL6A 5K8LA 1F5NA 4O3MA 1EFUA 2VTKA 4QGFA 3UKDA 3DKPA 5H8WA 1OFTA 2CVHA 4KCGA 2GXSA 3RANA 4C0LA 2WJJA 1X86B 2Q0HA 3A37A 3N5CA 2ZJ2A 3TRFA 4ACBA 4DLRA 4LOAA 1Q0UA 1JBKA 1KTVA 3FFBA 2JASA 1F48A 1E2KA 1P75A 3CWQA 4KV9A 3Q72A 2GVDC 3RRNA 1G64A 2IYXA 2ORWA 4M53A 4DSUA 2AR7A 4DBLC 1Z6XA 1VYTA 2REXB 2DBYA 1B23P 3VR2A 3GLFE 2GCOB 2EYQA 1DPFA 5CLQA 1D8TA 1JAIA 3JVVA 1DTSA 5CITA 4NYJR 1A2KC 1AQUA 4FMDF 2RH5A 2YINC 3ZZUA 1EGAA 2QT0A 2WAXA 3CR7A 4MGKR 4MYUA 2XJ9A 5FR1A 4B34A 3AVWA 2VP4A 4IOLA 2AWNA 1W5SA 4AYWA 1W44A 4Q1DA 1X3SA 2W58A 1WQ1R 3N2IA 4Y0AA 2GXAA 2R9VA 1IJFA 4JLKA 2PZGA 2O0JA 3FE2A 1VKJA 1P5ZB 4ASUA 2WSMA 4L5BA 5A5GA 5A4JA 3TIFA 3BORA 3Q9LA 3VHLB 1N0WA 4S35A 4HUTA 1US8A 3I92A 2FG5A 5KYKA 2XB4A 1YZLA 3EIHA 4IVPA 4GI7A 1G3IA 1Z8FA 1E2DA 4Q4AB 2CE2X 4BLSA 4BWYA 4IJMA 4M22A 4Q47A 4RCYA 2LWIA 4NP6A 2O8DB 2WWFA 3ZQ6A 2VSXA 5FOXA 2BJVA 3QPVA 1P9RA 1XMVA 3UANA 1PLKA 3LX5A 3RS5A 1UEIA 3S1AA 1JQLB 1HH4A 3TW4A 1K5GA 2FPKA 3DM5A 3KZ1E 4R2IA 5FBVB 1P9WA 3OAAA 4JBYA 4G5QA 2VF8A 3THOA 4H9GA 2A78A 4N0EA 4JT2A 3NWJA 3IO5A 3I3SR 1VMAA 2DWOA 2ZUCA 3C15C 3KQNA 1XFAA 2D06A 2R6AA 4ZCIA 1XTRA 1CRPA 4IVQA 2F1IA 4PC3A 4JLDA 1HV8A 1XZPA 1SVMA 4B3XA 4FMBB 3TQCA 4OK3A 2VIIA 3QXSA 1S96A 4A8JC 1N2CE 3U2QA 3WYFA 4M4SA 3AVXA 3WNCA 3AVUA 4WW0A 1UDWA 4H1VA 1HY3A 1XXHE 1KJYA 1D6JA 4G5SA 1LW7A 1E2LA 2ZU6A 1NIJA 4UNPA 1T9HA 3CX6A 1SVKA 4B32A 3SDZA 4PSKA 4BLTA 2CEAA 4QBHA 1D2EA 4JLJA 1EG7A 5HZKA 1KZGB 1ZIPA 3JZMA 4PHTA 4RZ3A 2J0QA 3OEEA 4AKHA 1QHHA 4QJ3A 2Q21A 5AUNB 2RGNC 2F3TA 3U60B 3TR0A 2IWRA 2QP4A 3P1JA 4B2IA 3UXMA 4Q66C 4E5UA 5KSZA 3KKNA 3KQUA 1HURA 3U61B 3I62A 1W47A 1EFCA 5CK4A 1G3QA 3TSOA 3VU9A 4GP6A 3NC0C 1IHUA 2N1BA 4FMCB 5EP2A 2G9NA 4DT1A 5FTLA 3MGCA 4A0FA 2E87A 4XD7D 3IIJA 3SI7A 1E6CA 2CVFA 4Q4HA 3RHFA 3TR5A 2QE7A 1XPOA 4GOXA 1UPTA 1ZUIA 1IN4A 2HV8A 2JJ8A 2ZRHA 2MSEB 3W90A 3AGQA 3MCAA 2ZRFA 4RD4A 1OYWA 3V4RA 3U4QB 4AD8A 2A2ZA 3HR7A 3C5HA 3CZPA 2ZRPA 4NMMA 2YWFA 5DYIA 1OH8A 2IS2A 1MOZA 5AR1A 3TH5A 5BN3A 2PLFA 4A2PA 4H1UA 4LYFA 1SZPA 3FMOB 3IUYA 3O8BA 1CLUA 5ELXA 5FR2A 5IT5A 4XJXA 4XSGA 2F9LA 2A7QA 5CDFE 1TQ4A 4ZKDA 2WIBA 4M1KA 1YJ5A 3ECCA 1UKZA 2BEKA 2CMKA 2RGBA 4R98A 3X1DA 2ZJAA 1Z22A 4FMDB 4UJ3A 2IF0A 4XWOA 1RYHA 2O8BB 3HPRA 3F0TA 4B6EA 2XOKA 2WBLC 2ZJ8A 1SKYE 1P7CA 2IS1A 2NPFA 5JRJA 2P6NA 1IJEA 3QVUA 4B3FX 4BFWA 4GOJA 3ZS8A 3CW2A 1XU4A 3N70A 4Q1FA 1U2RA 1N5JA 3MD0A 3M6AA 5HKKD 1Z6TA 1IOZA 1NY5A 1AZSC 4Q1EA 3WNBA 4RZ2A 5F3WB 4OQXA 4M1MA 1XPRA 2A5FA 4JVSB 2D7CA 4AY2A 3O47A 2RGEA 3CLVA 2GXQA 5EP1A 2IUSA 3GLIA 4R9UC 2ZSDA 4DIEA 3WP1B 3B78A 5FFMA 1Z63A 2ZUBA 2Y8EA 4HYYA 1JECA 3U3MA 3R20A 4JJKA 4MA4A 1GNPA 2FJUA 2PMDA 4AKIA 5E7IA 2N46A 1PLLA 3SJCA 5FL7A 3THXB 4JLAA 2GBLC 1COWD 1YR6A 1PLJA 4RJLA 3W8NA 5J4KA 2IEYA 3GJ3A 2XEXA 4PPFA 3R9XA 4ZI3A 3HU2A 3THYB 3FKSD 1R5NA 4FI3C 4Q9KA 4ZDKA 1IXZA 1E9CA 1VG8A 1E9DA 4JVMA 2GEVA 3KTAB 2HCJB 4MYHA 1NBMA 3U3OA 1KO5A 1H8HA 1LS1A 1N3BA 4HUQB 2H1LA 1W0JD 1M7HA 1WE2A 1RC8A 4DIDA 1G8FA 4DLXA 4K81B 4A6XA 4TN1A 3KQHA 4AC9A 1YR7A 2OE2A 2AL7A 2UZ3A 5BWMA 2V54A 2OG2A 3HU1A 4JMPA 5TARA 3K70D 5DH9A 2CJWA 4Q18A 4QKQA 1GWNA 5M04A 3D7MA 3ASYA 3RC8A 1KNQA 2HF8A 2VSFA 2FU5C 4PZYA 4TMWA 5AK0A 1DAIA 4A2QA 4B3DA 3QG1A 4F4IA 4NPHA 1SGWA 1NY6A 4KFRA 5L3VA 4HZUB 1Z0AA 1G8PA 1T4GA 3FHOA 3G5UA 4LJ5A 1JPNA 3T5DA 3BFXA 4C4PA 3KJEA 2ZRJA 3MFYA 4M21A 4QBGB 1T8UA 2EQBA 1U90A 2VHCA 1II8A 4HDCA 5JWHA 4KYUA 1DAEA 1VPLA 4JSYA 3BBPA 1OJLA 1XTJA 1G5RA 1RRGA 2J0UB 3CBQA 3GJXC 3KKMA 4QGHA 2ORIA 1QHIA 3C7KA 1W48A 4FWTA 3CUEF 5CYPA 5AUPB 1KI6A 1G8YA 3ZVRA 1X6VA 3TE6A 2F7SA 2BV3A 1KI1A 2ZAOA 1FTSA 1G8GA 1GFIA 1ZNXA 4NU0A 4AYTA 1JB1A 1E99A 2P65A 3EZ7A 4XOIA 5B2ZA 1JR6A 5FOSA 5LB4A 2QAJA 4Q4LA 2OXRA 2P5SA 3F3YA 4G0NA 1FMLA 3SJBA 4QBIA 5H70A 1OIVA 2DCUA 2ONKA 5KSPA 1OXXK 5FUVA 3WXMA 5FH9A 3WYGA 2LKCA 4EJSB 1IY0A 3L8ZA 4HLUC 4TL7A 2ERYA 1GKIA 1FOEB 2FSIA 2ZUDA 2KWIA 3NVAA 1E9RA 4B71A 4CGZA 2O0KA 2GK7A 2ZS7A 3ICQB 4LC1A 5L3QA 5FTJA 4DSTA 2BWJA 4N0DA 2R44A 3RWOA 1DAMA 5CIWA 1NG9A 4NYJQ 2V7QD 3B1XA 4D0LB 1VYVA 2B6HA 3LH5A 3QXHA 1E4YA 2YNMA 2O8CA 3LFUA 4US2R 1XCGB 3TJZA 2JDID 3SN6A 3FHCB 1VIYA 4FD2A 3ZD7A 2QSYA 4Q9HA 5F2EA 3PEVA 4RZXA 4P4TA 2N42A 3C5CA 1KMHB 2A9KA 3FKQA 3QOFA 1SXJE 2ODNA 4US1R 1S1CA 2HJVA 4EFNA 4RD6A 1UJ2A 1S0UA 4ARZB 3NH6A 3K0FB 2Q3MA 3SYNA 4KBFA 3CPHA 1EWRA 1Z28A 1S1MA 3ZYCA 1GNRA 8OHMA 2V55B 3CM0A 4TLAA 4PPGA 3RYTC 3WRXC 2WWWA 4U5XA 2ZRAA 4DLZA 2HT6A 5CLLA 4HAXA 1Q21A 3CX8A 3L8YA 2FFAA 1JR3D 2QM8A 4M1OA 4JS0A 4P0TA 5SZHB 4UNSA 5FPHA 4M9QA 4LGMA 5JSZB 3SYLA 4CEIB 3VNVA 3U7EB 3Q85A 2IYVA 2EFDB 4XD7A 1F6BA 1ODFA 2H57A 4NCJA 5FI0B 1W36D 4PO1A 2XXAA 4URZR 3K0AA 4BZQA 2FDCA 2H16A 1U9IA 1FP7A 3X1XA 4KU4A 1H8ED 3NG1A 4PHHA 4LDJA 1AKYA 4FN5A 4OKSA 4EAQA 1Z07A 1M2OB 2CLCX 3GLGA 3NHBA 4UJ5A 5CM9C 1YE8A 1ZJ6A 1DELA 2AKYA 3WHLA 4TTPA 4MYCA 2IA5A 4IXMA 4WBSA 5JCPA 3I32A 1DG1G 3KXLA 5FOUA 1T3SA 2ZSBA 3Q8XB 4V0LA 5JWRA 2IXEA 2EU8A 2FWRA 1KIMA 4L15A 3R8CA 4EJSC 3RS0A 4M8NE 3LXXA 1PZNA 1OFUX 3P4YA 1G1MA 2F3RA 2JGNA 2YOGA 4M1YA 3IILA 1KK3A 4HLCA 4NCNA 2WJGA 3FOZA 3QPUA 5EE5B 5E7MA 1SHKA 4GMXA 4YMWA 3VTKA 2VRWA 4PC1A 1NN5A 2ZQ5A 2DWQA 1NMZA 1FTNA 2ZTSA 4QNRA 3LW7A 4TT3D 5EZ6B 5HKKA 5LBIA 1VG1A 3QUSA 2J3EA 4FCVA 3K53A 3JZAA 3PIRA 4KVAA 1G3MA 4GBMA 4Q4JA 1CRQA 4BFUA 2B8WA 1GKYA 2IS6A 1HQCA 3U7FB 3AQ4A 1DBSA 1QHYA 2CE7A 2G6BA 3OZXA 4KJZA 4LV8B 2Q3HA 3SE0A 4MKFA 4DDVA 2QMUA 2D74A 3REFA 3WYAA 1BYIA 1WXQA 4BFSA 4RFSB 2WTUA 2CL0X 2SHKA 2AWOA 3ZIAD 1C1YA 1COWA 4NYIR 3B1WA 1ZP6A 1Q20A 1TUIA 2TMKA 4MRSA 1QBKC 5J4LA 3R8FA 4AG5A 3IKJA 4DWJA 3FKSA 3AP2A 3HWSA 4X8LA 2QBYA 1GILA 1T3LA 1RPZA 1BIFA 1BS1A 1I2MA 2CXXA 2QGNA 3I61A 2JJ2D 5GJBA 2J59A 4OQMA 3CO5A 1E1QD 2W2VA 4LYAA 3A1SA 4CEHA 2FMXA 4IOJA 1W0JA 3I73A 1KO7A 4OK6A 2PZFA 4DDTA 3LAWA 1XCPA 1U8ZA 5TY0A 2IYZA 2VF7A 4EDHA 1AS3A 1OB2A 3H86A 3NBXX 4W5WA 2QAGA 2XAUA 2F43B 2NG1A 2EFHB 1T91A 2IXGA 1XJ0A 3EWAA 2C9OA 4OQFA 1E2JA 1ZU5A 1P2UA 1VCMA 2VHQA 4JL6A 1NN0A 4Q7JB 4Q9LA 3DOEA 1AM4D 3BJIC 1MABB 5KNBA 1G9XA 3EWSA 1AGRA 1NIPA 3NBYC 5P21A 1E9AA 4I1VA 4UQOA 1E1RD 4BLPA 2BDTA 1AS0A 1XEXB 4EJSA 3GD7A 4TMVA 1JXMA 4X8MA 3WMFA 3U3JA 1NL3A 2CLDX 2PMKA 3K0CC 4Q9JA 4IDNA 2DWPA 1Z2AA 3FPAA 2QTHA 1KYIA 2HYDA 2HUPA 1Q1ZA 2OFOA 3H84A 221PA 2PX3A 2NMVA 3ZVLA 2CHGA 4LJ9A 5DLQC 2VBCA 3BOSA 3TUZC 4JLVA 4P4SA 2ZXUA 3SQXA 1FZQA 3CRRA 4RFVA 4YONB 1I2DA 5C1BA 5DIFA 4GSYA 2JA1A 3SC3A 4B6FA 2J0VA 1NLFA 4CEJB 3W34A 1ZD8A 1N5LA 3KL4A 4M1WA 5FPYA 2YZ2A 1YR8A 1UAAA 2Z5FA 1P60A 4QL3A 2J46A 3CNLA 4DCUA 2W6JD 4IRUB 4JVNA 4UXJA 5BYKA 5EE1A 2VHJA 3K0FA 5DHAA 5CK5A 1QDEA 3EZ6A 4MGYR 4M1SA 2I3BA 3FWYA 2C96A 1G21E 1UM8A 1QF9A 3IHWA 2DYKA 2ZR7A 3C14C 2CL6X 2LCFA 2CNWD 1TQDA 1KK0A 1OPXA 3G82C 4B33A 4PC2A 3NEYA 3QXCA 3MWKA 1GITA 3BB1A 5B64A 3KFXA 1JEDA 1E32A 5E7JA 2WWXA 2Z4SA 1F2TA 1P73A 1U8AA 1K8RA 2V7QA 4B76A 1FNMA 3CWZA 1KGDA 1LVGA 2WIAA 3MLEA 1R0WA 2JAQA 2JDIA 3FB4A 3VX3A 1CEEA 2RGDA 4TQUS 3C16C 4NYMR 3F8TA 3K8YA 1XWIA 2VYFA 5C2JB 5AJZA 1ZUHA 2C04A 2D7DA 2ODBA 1EXMA 3TNFA 2F9MA 2WM9B 1YKSA 3KDSE 3B13B 4KAXA 1XTKA 1CKEA 3AUXA 4LCBA 4R7ZA 5ANRB 5EXPA 1DO2A 3EASA 4LK2A 1PVOA 3H2YA 5BXQC 3DDCA 4TL9A 3PXGA 5LD2B 1AN0A 4BQSA 3AB3A 4G3XA 4DLSA 3JVUA 2PBRA 5JLJA 2L0XA 1OFHA 3BH7A 3KB1A 1GM5A 4OHXA 4DLTA 3FMFA 1NP6A 3TAUA 3CR8A 3QIAA 4DLWA 1W46A 4M2LA 1AKEA 3B1VA 1N6NA 4MUAA 4FXPA 3SHWA 4JZKA 1GP2A 2D62A 2X19A 2BMFA 2P2LA 3A1TA 1JR3A 121PA 2FE4A 2ZE8A 4KFSA 3EC2A 3TGPA 3SR0A 2X2EA 5EE9A 1U0LA 4G5RA 4Z8XA 5JEDA 1W7AA 1M8PA 2Z4RA 2QZ4A 2ANCA 4W5HA 3VX4A 2OV2A 1G3UA 3HYRA 2GA8A 2B7CA 3IBGA 3OIWA 3U44B 1U0HC 1E2PA 1P62B 1UBFA 2K5UA 2QN6A 1H8EA 1O3YA 3GLFB 4HSEA 3AF3A 2IT1A 4IFBA 4OBEA 3GPLA 3ETLA 3REGA 3K0EA 4HB3A 5TV2A 2X2FA 1AIPA 4P32A 1MO3A 4ZKEA 4Z1MD 3B6EA 3QEJA 2WSSD 2ZR0A 1NJGA 4HDOB 2J9RA 3OIYA 3SFZA 4PZLA 3AM1A 1WA5A 4WXRA 1OKKD 3T35A 4A2WA 3AH8A 1GIAA 4Q03A 3H1TA 1SVWA 1OIXA 1CS4C 1IAQA 2D4HA 3QKSA 4NDZA 5FL3A 4O2LA 5DI3B 4IEEA 1BMFD 3T34A 3D31A 4WZBE 2BKEA 4PC7A 3PITA 3NBZC 2WICA 3CKLA 3I4LA 4AKEA 2YYZA 3UMSA 3QBVA 1DAFA 4KSCA 4C2TA 1GZSA 2WJHA 4BLOA 2EVWX 2GEUA 3AVVA 2QT1A 2ATVA 1QG2A 2ANBA 4IDQA 3ZJYA 2GXUA 3I1FA 3LNCA 4JL5A 5D3MA 5JHGB 421PA 2PEYA 1G19A 2Q6TA 4TT3A 5JHHB 2ZPTX 4IFEA 4F93B 3AF1A 4DB2A 1E96A 4JL8A 2PCLA 3QI2A 1Y3AA 4MQBA 1II0A 2IHBA 4RVCA 2QQEA 1M6NA 1X8JA 1XMIA 4A82A 4JSTA 4V02A 1D2MA 1DOAA 2NIPA 4IDHA 2IYWA 1E9BA 4UXIA 3CB4A 4NE2A 2HEIA 2JLYA 2V1XA 3ZIAA 1Z0FA 2H17A 4A6PA 5JZVA 1WF3A 3M4YA 5FPSA 5AWFC 3LLUA 4ZIRB 5LD2C 2ZE6A 1I4TD 3T15A 4BZXA 1Z2CA 1E79A 2GAOA 2ATXA 1BH2A 4FW9A 4TMXA 1IY1A 5GVRA 3T12A 2BHRA 4HDQB 4CDGA 1G16A 1G291 1TL7C 1XEWY 2JJ2A 3B2EA 5G3ZA 5H1YA 3SS8A 3B8HA 4DDUA 1E1QA 2BBWA 2WOOA 1NF3A 1ZW6A 3PUWA 1XXHB 1ZINA 2VP2A 2ZRLA 1Z06A 5EZ5A 3U7HB 4WOPA 3W6OA 4W5JA 4WZ6A 2NPIA 2J45A 4YC7A 4X8OA 2IYYA 5F98A 1Z6AA 3NTUA 2H92A 3I5YA 2BBOA 1SVLA 4URWR 2R6GA 4MUBA 3HR8A 2QM7A 2ZREA 4I4LA 1DE0A 3IDQA 3SBEA 1UEJA 1JI0A 4TL8A 4OJKA 4CVNA 1GNQA 1YQTA 4QHSA 4B44A 4ZCLA 4AI6A 2JIZD 2OCBA 1HE1C 1LY1A 3ZDQA 1CTQA 1M7BA 2AXPA 6Q21A 3X1YA 2C77A 5IHPA 5B57C 2ZRIA 2XZLA 1E1RA 5FUXA 3VR5A 2WKRA 3E1SA 3SOPA 3EARA 2PL3A 3M0EA 1Z3IX 4D80A 2ZJBA 1UKVY 4PX9A 4NYIQ 5E95A 3R7WB 3GLHA 3PFIA 4YDSA 1QVAA 1ZUNB 1Q1BA 2W2TA 2R6CA 4C3ZA 1U0JA 2FX3A 3W6PA 1M7GA 4RSGA 1J90A 2I1VB 1M34E 1MO5A 2BIFA 3E2IA 4D0NA 1EFTA 2V3CC 1LF0A 5IDVA 3A6PC 3G0HA 1YZTA 4RY2A 1AZTA 3BH6A 1JXOA 1NN1A 3J81k 1F3OA 1F2UA 5JECA 1YHNA 3RLFA 3T1TA 3AVYA 1E2QA 1G6HA 2CK3D 1RRPA 3AP1A 2BJWA 4L4UA 1XD8A 4LJAA 3ZGXA 2OCAA 3QVVA 3Q7QA 4A8JA 4KLZA 5J5CA 2OSBA 4HLQB 2W6JA 1Z0IA 2WPDD 1YRAA 2JLSA 3FVQA 1SKYB 3W3AA 1Q1EA 3EIQA 4JYBA 3LD9A 1VHTA 1LTQA 4DLVA 3K9GA 2CNWA 2GILA 3CF0A 4KHZA 3PEWA 4BFXA 4I1UA 4RD3A 2EFEB 4PXAA 1FX0B 2RAPA 4A4DA 2NQ2C 2NO1A 4OJQA 1N0UA 1ZYUA 1GTVA 2FV8A 3DMDA 2BMJA 3PQCA 3LQRA 2RGNA 1KK2A 3CZQA 2C03A 2G83A 2UZIR 3QXJA 4ESHA 2Q3FA 4I99A 3W8RA 4XVUA 1J2JA 2IYQA 3GFOA 4D4LA 4BPBA 3ADCA 2QQ0A 2GCOA 1N6OA 2X8AA 2GETA 4II7A 4PQFA 4OI4A 2FN4A 4AKGA 3VMFA 1VCIA 3U44A 3OFND 2QUZA 3WNDA 4QC2A 5HPYB 2PT7A 1G6OA 4IVRA 3GLFA 2GNOA 1XCMA 1C9KA 4LJ6A 2AK2A 4A36A 4EPWA 2C5LA 1YZKA 3O8DA 1PUJA 3RABA 1Q44A 3BRWD 3T1QA 2AFHE 1VCNA 1L7VC 4MGZR 3IPXA 3GFTA 5JWOA 3MAAC 3PEUA 1W5TA 4YLGA 5CB8A 2YKGA 1DO0A 3OESA 4Q4AA 2HT1A 3KB2A 3EAQA 4RD2A 5CJ2A 2REBA 4UNQA 3PEYA 2OLKA 1CJUC 4BFYA 2O8DA 4DUGA 1RJ9B 3QENA 3AVPA 1XRJA 3WBKA 4NL4H 1ZM4A 1D9ZA 1RZ3A 2ZM5A 2OHFA 1E98A 4NTZA 1IXSB 4V0ME 4B3BA 1BOFA 5JBQA 1WBBA 2D2FA 3P27A 2B7BA 3R9WA 4Z1MA 4RKFA 1L8QA 2WSSA 4BASA 1AQYA 1B0UA 1Z83A 2YC2C 3KJGA 1OYYA 4BLQA 1ZBDA 3SZRA 1OKKA 4MDEA 2UVQA 1W2GA 3L0SA 5FBRB 1G3RA 4F4CA 5EXTA 3BIFA 4URUR 4MKIA 1E2MA 1BMFA 2FF7A 3HP1A 4IXNA 4TZ6A 1J70A 2FPMA 3CNNA 4JBXA 1JPJA 5K8IA 1DS6A 2BCGY 2IEZA 2GBLA 1J99A 2FFBA 2FZLA 3Q7PA 4D6PA 1E0AA 4I1SA 4XWAA 1LNZA 1TUEA 1XBTA 3ADKA 1OLOA 2XSZD 1IXRC 3CH4B 3X1ZA 4US0R 1I4DD 1TF2A 1Z0JA 1Z0DA 3GCGA 5FOTA 2GZHA 521PA 5BW8A 3V9PA 4JLOA 3EW9A 2PZEA 2IYTA 4ZO4A 1FQJA 5FBQB 2F1JA 5F9HA 2NTYC 1SVSA 3PUYA 2MMGA 4XIGS 3NDBB 1ESNA 2GKSA 2IK8A 4LYJA 4A1FA 1KAOA 2JJ1D 3U6KA 2ZI3A 4JJZA 2H18A 1JNYA 1N0VC 4JLMA 4DSNA 4BGDA 3EX7C 4Z8YA 1XMJA 5BQ5A 1PUIA 2OBMA 4PO8A 3EZ9A 3BERA 1NMYA 1XJCA 3AV0B 4B47A 2ZYVX 3I72A 1UF9A 5HTKA 3EA5A 4CYMA 1KO1A 3I5XA 3MRSA 5GJVC 1D5CA 4V0NA 2C78A 1E2FA 2O52A 1OXUA 3KX2A 3TVDA 3U4QA 1TTTA 4PO9A 1Y63A 4D26A 1OV4A 4C0SA 2GEDA 2OXCA 4D81A 2WJIA 5L3RA 5E4FA 2ZRMA 1SXJB 1WRBA 3A4LA 1MRNA 3THWB 2KBEA 1KI7A 3BB3A 2G1JA 5HCNA 4BFTA 2JCSA 1EX7A 4G5GA 4PTLA 5GJWC 4A15A 4GDFA 2OILA 3BFKA 3VKWA 4C0AC 2B21A 2A30A 1CR0A 4WAUA 2WJYA 4NH0A 3LRPA 2FOLA 2ZRGA 3IGFA 4JLPA 1ZNWA 2QROA 1VHLA 4QXAA 2V8OA 3A1VA 2JLVA 2HXYA 5DYGA 5CIQA 2JIZA 5EXXA 3K09C 2O8BA 2GWHA 1KI4A 4QG7A 5CDFA 3AKEA 3RSOA 2V6JA 1FQKA 2QMEA 2JLZA 1MKYA 4ZDWA 1TF7A 1S9DA 2GK6A 2AX4A 3WP0A 3CIOA 3K9LA 3WHKA 4PFSA 4JLNA 1GL7A 2IS4A 1L4UA 4NCHA 2GVZC 1Z08A 1XNJA 3KUCA 1XD2B 1ZM9A 4HLUA 5KSOA 1N6KA 3EPJA 3K9NA 3VR1A 5JS8A 3BB4A 4A0RA 4HAVA 2ZI4A 2FH5B 3PG5A 2OT3B 2ZJOA 2G1KA 2ZS8A 1N6HA 2V9PA 1E0SA 3EA0A 2Q9BA 3GEIA 3LWNA 4KVGA 2H7VA 3FMIA 3DZ8A 1ZM2A 4HAUA 2DFNA 2OZEA 2AN9A 4PHGA 5SZKB 2IUUA 2XZOA 3QKRB 3THXA 2EWVA 1IBRA 1O87A 1W4AA 3VR6A 5EXSA 5KDLA 3EPKA 1G7CA 3ND9A 4GFDA 4N1AA 2EFCB 2ZSAA 1JR3E 1MR3F 3H4MA 4XTRA 5F9FA 4ZCMA 4PAMA 4ESVA 4ZDJA 3THYA 3ICEA 2CK3A 2PCJA 4OHYA 2ZVPX 1W2HA 3A36A 4URYR 3KTAA 2WPDA 3KXIA 4I81A 1NVUQ 1NKTA 1FL9A 2ZRBA 3FTQA 5KU1A 4LJ7A 2OBLA 3BK7A 4GOKA 1XB2A 2ERXA 4HUQA 3IHLA 5HZHA 1KI2A 4BE7B 2JLXA 4HLDA 1NJFA 2HLDD 1ESMA 1CJVC 4JLBA 1LS6A 4QFMA 1VG0B 3AP3A 4BFVA 2BM1A 2XNDD 4CT4B 4R71A 4PSVA 3A4MA 2YWGA 2VHUA 2WWHA 3T1VA 4FIDA 1EWQA 2OFXA 2HF9A 4Q7LA 4EFMA 2I4IA 1SVIA 1R5BA 5J4HA 3LX8A 1IN5A 2RGCA 4D4MA 1AJEA 1GVNB 4TMTA 2BKUA 1EX6A 1S3GA 2ZYUX 4LHZA 2IL1A 4WXPA 1SVOA 3OIUA 4HZUA 5FTMA 3RRMA 3AVTA 1YU9A 1E79D 3B85A 4MRRA 1SXJC 4N3NA 3ZLJA 5K8UA 5KDOA 5GJCA 2FFHA 1OB5A 1OH7A 1CBUA 1US8B 3RDPA 3TSZA 3OFNA 3RNLA 2XX3A 2ECKA 2BMEA 4HAYA 4LX0A 4ACAA 4K8OA 2J0UA 2VP6A 3CRMA 3E5HA 4GNKA 1OH6A 4QGGA 2Q9CA 5AJVB 1Q57A 1OT3A 3QKUA 5UKDA 3P20A 3HU3A 4OI0A 4YXWD 2WOJA 4IOMA 2YWHA 3TMKA 1YRBA 1Z5ZA 3GP8A 1JJ7A 3S1AB 1G17A 2QORA 2HYIC 4DLYA 1K6MA 4LUCA 4BECA 2J41A 5JFGA 4LHVA 3B60A 1TX4B 1ANKA 2A5GA 2BMDA 3AEZA 1WB9A 4MDFA 2J87A 2H8KA 5LDDC 4YMSA 5DNYB 2YVUA 3LW8A 5KUTA 5AJYA 3LV8A 2JLUA 1ETUA 4B2PA 1XP8A 2BOVA 1KDOA 2Z83A 4PZZA 3OIVA 4QGAA 1G8HA 4ZI2A 1KHTA 3TVTA 4MRVA 4OK5A 4X8HA 3QNUA 2WMOB 3MWLA 4AURA 1NSFA 5DO9A 1ZVQA 3FFAA 2HJGA 4ERNA 2V1UA 3RSLA 2W83A 4UXHA 3BGWA 1CIPA 3TUJC 4U00A 1RRFA 4DCTA 2BBTA 1XD9A 2EWWA 3VFDA 1A5TA 1OSNA 4TZ0A 4PR0A 1SKQA 4KXFB 3ZH9B 4P31A 3Q5DA 3P32A 4RD1A 4B48A 3UK6A 2RCNA 4MRNA 4OI2A 1U98A 2YOFA 3ND8A 1QHHB 3HPQA 1ZNYA 1WBDA 2CBZA 1KMHA 5JRZA 4LY6A 1TNDA 5KNDA 4ARZA 1WP9A 3VKGA 1NRJB 4I1OA 3B7GA 1N6LA 2ZI6A 3EXAA 3VU9B 2XSZA 1OW3B 2BCJQ 1FNNA 1OXTA 1SXJA 3D8BA 3THWA 5EUQB 4LBYA 2GTPA 4DT1B 3L0PA 3SQWA 2R6FA 5KOYA 2PJRA 2Z43A 4GT1A 4Q4HB 5C4GB 4DRZA 4C9BA 5LPNA 4HAZA 2YV5A 4V0OA 1W1WA 4JYCA 2QPAA 3LVQE 1J7KA 2ZE7A 2QPOA 2XTNA 2J5XA 3BE4A 1U8YA 3QY0A 2FGKA 3K1JA 2JJ1A 1ELOA 1KDPA 2F6RA 1T5LA 5FOVA 5JJKA 4Q9IA 3C4JA 1KY3A 2RMKA 1EFHA 5JSZA 4CEIA 5EJEA 2IWHA 3MG9A 3SU8A 3OEHD 1DEKA 4JIMA 3M1IA 3TQFA 4TQAA 4B2LA 2R2AA 3AKYA 4DXAA 1QG4A 1YZUA 1JALA 1XF9A 3E70C 4TLCA 4DJTA 3QSYA 2O8EB 1VG9B 1GUAA 3AF4A 2BEJA 4LRWA 2QA5A 2VP5A 1GDDA 2QL6A 2VQSA 1XJQA 3WRYC 2CHVA 1KDTA 3K0SA 1IN7A 1MH1A 2MSCB 2DFLA 4BLRA 1Q3HA 4ITRC 1U81A 1TADA 4Q00A 5EP4A 3VR3A 3WBJA 4A92A 3L0OA 2P6UA 1KI8A 3B9PA 4NONA 3K0CA 3A58B 2GZDA 5G3YA 5BYJA 4W9MC 2O0HA 1KSJA 3GLIE 2B92A 2ZR9A 5KNCA 1KMQA 5TVKA 3BXZA 4ILEA 1EESA 4R2HA 2WWGA 5KPJA 3WMGA 4JKYA 2P0EA 4LC0A 4IKEA 1G20E 3KFVA 1P61B 2D2EA 3BC1A 3GLIB 4PSAA 4W7SA 3EPHA 1XDBA 4DUGD 4P3YA 1TEVA 2QG6A 4LHWA 1QHXA 1ZAKA 1XTIA 2CL7X 5C4MA 1HYQA 4RCZA 3QF4B 4TYPA 5JI3E 1KAGA 1KSGA 2CCJA 3MMPA 3AF2A 4ON9A 1S8FA 4QM7A 4PPNA 1JAHA 4LI0A 4QM6A 4TLEA 1OF1A 1NBME 2QRNA 1BYUA 2F1RA 4Q1BA 1WCV1 5IK2D 2NOAA 2ODEA 4OHWA 3ZQJA 2GAAA 4Q48A 4E22A 1NMXA 3AKDA 2BC9A 2KB0A 3ZS9A 2ZROA 4MKGA 4YDHB 4PHFA 5AJXA 1ZIOA 3MWYW 2C9CA 1TAGA 2JATA 2ZRDA 3GQBA 3HYTA 4URXR 4RFSA 1OXSC 2VPPA 5CJPA 1RRCA 2ZAMA 5DI9A 2FGJA 1CXZA 4KLNA 2FSFA 2XZPA 2IBMA 2B8TA 3D6TB 3QXXA 4HZIA 2PX0A 3AVQA 4EPVA 5FPKA 1NLYA 3U6BA 1R6BX 4P33A 3KKOA 3W3ZB 4P4UA 1D9XA 1FUUA 1VTKA 2HCBA 1I4LD 3EIEA 1QHNA 3LBHA 2JLRA 2CJWB 2QU8A 3NIBA 4LBVA 4LHXA 3VKHA 1CR4A 4YQFA 1YZQA 2IYRA 1HT1E 1EFRD 2W6ID 1R2QA 4KFTA 3WMEA 5JCZA 1RVDA 4EQ6A 2WMNB 3ADDA 1E2HA 1E69A 3U3KA 2IUTA 1PJRA 1ZC3A 3PR1A 5CM8B 821PA 4IHQA 3LDAA 2HLDA 5EUMA 2ZJZA 1R0XA 3DKVA 3GJ4A 4XSHA 1DAHA 2NO0A 2XNDA 5L8VA 3BFVA 1T3HA 1YZNA 3W6NA 1T0JB 2RGGA 3DEFA 3P4XA 1II8B 1OXVA 2F43A 3P26A 4HB2A 2J7PD 4DCVA 1E9FA 1ZD9A 1KSFX 4KSBA 4MYTA 1N6IA 1A4RA 1QHGA 2DFKB 1MABA 1CR1A 3BS4A 3RS2A 1P2VA 3HDTA 1G7RA 3VNUA 2GDJA 1T5IA 4LV5B 2F55A 4GP7A 4LBWA 2OESA 3CRQA 3LLMA 1KI6B 3LA6A 4EUNA 4CT5A 3K9HA 3SBDA 2ZI5A 4L8GA 1G18A 3KQKA 1XEXA 3L0IB 3ONWA 2QGZA 2MSDB 1N6RA 1HT2E 1ZD1A 2G77B 3L82B 1SQ5A 2WV9A 4LZZA 4ABYA 1PV4A 2XJ4A 1HEIA 1R5OA 3SJAA 2YOHA 2NO9A 2QP9X 2P6RA 2AD1A 2GZAA 2RB4A 5SZIA 1CJMA 1M74A 5HR5A 4D82A 1VYUA 5FPTA 5JS7A 2QI9C 1LFDB 3Q5EA 1DARA 4PAOA 3UWKA 1G4UR 2ONJA 3W9YA 3X2SA 4YXWA 2O8FB 4RZUA 2C95A 3DZDA 1AS2A 1N5KA 2EYUA 4OQLA 721PA 1NG1A 2GJAA 2NGRA 2HDNB 1IY2A 2ZSEA 4RKEA 5JJIA 5KDDA 4C0JA 3VAAA 4LWZA 4CEJA 2WVJA 4HEJA 3TKLA 4DDWA 5L3QB 4QJ5A 3B82A 5AJWA 1TF5A 5FBWB 1GL9B 1R8QA 3NDPA 2ZJ5A 1VIAA 3T5GA 3TAHA 1QHSA 2C98A 5FTKA 1UBCA 1DVRA 1TQ2A 1MO4A 3C41J 1KI3A 4K46A 4QOSA 4F7WA 2OBNA 3EZFA 621PA 1QVRA 2O8CB 3AUYA 4HB4A 5B30A 1QZXA 4QNMA 3W5JA 2R65A 1XMSA 1DG3A 1R7RA 2CCKA 4Q21A 3RS7A 1C4OA 1GG2A 2Q9AA 5HE9A 3GJ8A 3KKPA 2W2XA 3OE7D 4F91B 1JJVA 2OUKA 4M9SA 2Z0MA 1KZ7B 3CRW1 3ASZA 2WWIA 4TMZA 2P3SA 1X1RA 4G1UC 4UKDA 4AYXA 1F60A 2A5YB 3NC1C 4JVLA 4O0MA 5G41A 1YR9A 3IPYA 4F4JA 2C8VA 4FCWA 4NHOA 3PUZA 1LV7A 1HA3A 4LPKA 3RWMB 1XZQA 2V4ZA 3DOFA 3QJYA 1KO8A 4IOKA 1P6XA 2GJKA 1OFIA 2QTFA 1GRRA 5K8TA 1HTWA 1P2TA 4KO8A 4Z51A 1YVDA 2R62A 3FMPB 4O25A 2O8EA 4HATA 2D3WA 4DCSA 1UBEA 3PCRB 1P4SA 1VDZA 2IHYA 3EZ2A 3TUIC 4GMDA 1K5DA 4CW7A 1AA9A 4LJYA 5HE8A 2IXFA 4TSFD 4OQNA 4C0KA 2XXAB 1AK2A 3EC1A 3GLGE 1FPMA 1E9SA 4CRWB 3K0AB 4PAQA 3R9IA 4KBGA 2ZI7A 5DISB 1CR2A 4S2EA 1ZM7A 2I1QA 5BN4A 2EFGA 1E0JA 1VCOA 4YMVA 2NZJA 4PPQA 4DEXA 2ZJYA 3A1WA 1W4CA 4QRHA 3MWJA 5DGXA 4QJ4A 3GLGB 1TQ6A 2VHTA 5TMPA 3GFPA 4PC6A 3OEHA 2OAP1 4ZPXA 4EPXA 5EE3A 4DSOA 2A3RA 1XEFA 4CF7A 4U02A 3SFVA 3QF4A 1V43A 2CCGA 4TLDA 3PVSA 2A5DA 1ZM3A 3GEEA 3KXKA 1VECA 3RRYA 5L3SB 4Q02A 4LBZA 3KJHA 3CH5A 1FMJA 2C2HA 4WZAE 4IDPA 1KDRA 4DLUA 1II9A 1Z6YA 4MH0R 2QMHA 4V03A 1H65A 2KI5A 3CONA 1DAKA 3ZZ0A 1YZGA 2E9SA 3AF0A 1E4VA 3AGPA 4NKRA 2ZRCA 4PANA 5DI3A 4GRAA 3O8CA 4GL2A 4D4JA 1W4BA 2VEDA 3VQTA 4Y0VA 4FWIB 4Q4JB 1CJTC 1NVWQ 2G88A 3FGNA 3B5JA 3ZVNA 5FTNA 4V0KA 4EIWA 2DR3A 2OFWA 1NVVR 4CIDA 4F38A 3TSWA 3QF7A 4JT4A 4XWKA 1NN3A 3X1WA 1TPZA 3BWDD 1IN6A 2VP0A 1OHHD 1S2MA 3UIEA 1KI9A 4TWZA 4NYMQ 2P5TB 1G4AE 1FP6A 2OCYC 3QPWA 3WY9A 1UKEA 4ZV4A 2WKPA 5GADl 5IK2A 4TYNA 2E1RA 4FCTA 1BKDR 3LQQA 4B3CA 2QBYB 3RAPR 1A1VA 3IIKA 3CPJB 3PENA 1BO6A 3NXSA 3GEHA 1HQYE 3D3QA 4PQRA 5DHFA 3T06B 4DHEA 2AHOA 2AK3A 3N2EA 4KFUA 4Q7KA 1KJZA 2QSZA 4DB4A 5J40A 4CEHB 1S3SA 4DVGA 3RVBA 4C30A 4TYQA 2QPTA 2WKQA 4O2RA 4D4KA 4HAWA 4EFLA 5FUWA 4ZIRA 2QTVB 4JBWA 2HXSA 2GRJA 1T0HB 2J0SA 2RKOA 3K70B 4OYHA 5KHOC 3LO5A 1FUKA 2QAGB 1XPUA 4A9AA 1W0KD 4AK9A 2IF2A 2W6IA 1EFRA 1G7SA 4UNNA 5J4VA 1Q1QA 3CF6R 2ASEA 1A7JA 1XXHA
chains in the Genus database with same CATH superfamily
1SXJD 3DXFA 1EK2A 3LCRA 4XYBA 1F06A 3RRJA 5K45A 2FN8A 5FUBA 4IYJA 1U9IC 2P4HX 3TZHA 2EDAA 3RC3A 2QRHA 3IP7A 4NPAA 4CMHA 4I5FA 1RKBA 2G0TA 3BD9A 5FI5A 3PXUA 4X97A 1UT8A 3M6XA 3H5OA 1GRNA 4K9MA 4QAQA 1VZ2A 2D00A 1YR3A 3L43A 1KAEA 4HFMA 1T36B 1F51E 1RTKA 2MIIA 1KOFA 1MAVA 1NQWA 4JKIA 4F56A 3JYPA 4FFMA 3R75A 4ZEOA 1XQXA 4BRWA 4EENA 4G0UA 3PXEA 3G3EA 4HNUA 3JQBA 1DJNA 1D0IA 1PKEA 5GVSA 2EJUA 1P5JA 3MF4A 5JZBA 1CNEA 5BV0A 4QSHA 1P9NA 1PV1A 2A8YA 5JD6A 4EPVA 5IBPA 1SC9A 3RVQA 3KJQA 3OTQA 4B4OA 5EWJA 2HBRA 4Y9UA 3Q3EA 5IHXA 4YJ2B 1HRKA 3EXG1 3ZD8A 3WSTA 5ITSA 3BSSA 3BKXA 1MW9X 4XVRA 5KJEA 2VHEA 1HT3A 4K7JA 4LF8B 1QLWA 2YWEA 5CJJA 3HCBA 5BXYA 2AKAB 3IDAA 2VA8A 1A0OA 3CFYA 4KN8A 2VPZA 1DC5A 4EF4A 3A0UA 4UE2A 4OLQA 4P4NA 3KKQA 4P34A 4WOCA 1DEHA 4B75A 5JO0A 3RVNA 3LDUA 1X1SA 3T88A 1BDMA 4FDUA 4KAAA 1PL8A 2F59A 4GVLA 4HVTA 1UMKA 2OV1A 3PGJA 1KIFA 2OSVA 3R6GA 1DQRA 4GOND 1UP4A 3TSAA 4YH1A 4U7DA 1N25A 2IVZA 2VL7A 1MO6A 1ZZGA 4RTMA 3L2OB 3KJIA 1UK7A 2CMFA 2IIQA 1H2XA 2MT9A 1XRLA 4EPRA 3O2SB 2DLNA 2HFKA 2GRAA 1XU9A 3E9DA 3J7TA 5EKTA 5ULLA 1N8KA 2AZTA 3WISA 2RE8A 1GOTA 1BU8A 5LNK1 2HNBA 3ITKA 3OQBA 3AIMA 2EIHA 1RFLA 5JCOA 4LRQA 3D8NA 3NDJA 4KQGA 2ZYWX 4UEKA 5JU6A 1U2ZA 3VU1A 1VPEA 5HMLA 3MJSA 1GSAA 2CVOA 1F2TB 3PUVA 4CM4A 3Q2IA 3Q11A 3IKLA 1A8SA 2JW5A 3GT3A 2QD5A 2RHMA 3GEGA 5CU7A 2JFXA 4MGIR 3IMCA 3V2HA 1PR2A 1ZC4A 2JPDA 3IT2A 3K2IA 3MUOA 2OFFA 4LSMA 3FHTA 3DBRA 4NECA 2O9JA 2WLTA 3QPDA 4QLOA 4QOGA 4C7BA 5KPDA 3FKJA 1WS6A 3S2EA 1LKZA 3WWOA 4TYYA 1CUXA 2FSSA 4TL6A 2ZWVA 2GF2A 3GLSA 3AM4A 4N65A 1IM2A 2A7XA 2PLRA 4RJ2A 2BGLA 2QTGA 5D3QA 4MWTA 1PFVA 4TV8F 5E6RB 3HKEB 5DX1A 1GRCA 4KR9A 5CEFA 5DYTA 2VH1A 2ZKIA 1BW9A 2IHKA 2WZBA 2FFQA 3ZWYA 1XTQA 1P0IA 2ZPUA 3V8PA 3W9SA 1U04A 1E5LA 4Y2RA 4E08A 1USGA 1EUDA 3HSYA 4J91A 3ECSA 3KKZA 1IIRA 2WHPA 2W0MA 3UK0A 4BRUA 3TBFA 1QH8B 2H2IA 2JI9A 1I8TA 3B2QA 3P9ZA 1EM8B 3LVRE 4LC9A 4ITVA 3S8YA 3AKZA 2OCGA 2PBLA 4IXDA 4DC9A 3N7UA 4YACA 5C32A 3A70A 4JYAB 1LLQA 1P72A 3ICOA 3TLXA 1MVOA 1Y8AA 4V3BA 1P0CA 4H6XA 1HLFA 3DYBA 3F78A 3Q0EA 4D9BA 4Z54A 5K9ZA 1AQJA 3SLGA 5DCLA 4MVJF 5CBPB 5CXQA 4YX9A 1MGOA 1C2YA 1EWVA 5F1OA 2ZUFA 3TTYA 1WMSA 2QTLA 5KYNA 1IQPA 2A58A 4M0MA 3DYVA 2QQGA 4B3RB 4EO9A 3ND7A 1KJWA 3HY3A 3KAPA 5FBLB 1DWQA 4MS3B 1W36B 4FU0A 1XZBA 1IN8A 3UJ9A 4EG0A 3LXMA 2Z2KA 4D2IA 4PCAA 4ZDIA 3OHMA 1JB9A 1RW4A 4ERXA 4J1QA 4UOZA 1M2NA 2YJZA 5LUAA 3MJCA 1N5MA 2EFYA 2V6IA 1NI5A 1BDBA 2H4ZA 2IEXA 3GJ5A 3D3WB 3HGTA 3HJRA 3ADBA 1M2KA 4I8DA 2XMCA 4WLOA 2XF2A 4RGVA 3T9EA 3CH7A 4QIIA 2AFHA 1JFTA 3KQLA 1DUIA 2FQ1A 2X7JA 5C7OO 3S1SA 3EPLA 1C9MA 3AQIA 3AZPA 2BR3A 2IXBA 4JEHA 1E7RA 4J94A 2X41A 2X4GA 3LTNC 5FP0A 3TEMA 5DHUA 3KE8A 1TEXA 2FOXA 4FDAA 4DG5A 4D25A 1ZBQA 3QZUA 1H3FA 4XFJA 2C92A 5H7XA 1OIWA 1ECPA 1U1GA 3LYAA 4GPTA 3A4NA 2J6IA 2WHQA 3H1GA 4N5DA 4TQ9A 2VHXA 3PIDA 4IO0A 4UASA 3AJMA 4WIAA 2WZQA 3QBEA 2GR9A 3SFTA 4YJKA 5ICEA 1QBGA 1C81A 2GJ8A 2KE5A 3NFRA 4L76A 3C7AA 2DHDA 4CIBA 2GCNA 3O8CA 4E1AA 3AEUA 1U6IA 1N2IA 3SNHA 5HGJA 2IX9A 2ZBRA 3ZY6A 1DDOA 2IU4A 5TXGA 4E1VA 2C2WA 5A4DA 3T1YB 4V0MA 1RP1A 4YRFA 2ZSFA 4ZO7A 1N1DA 4PNZA 4XM2A 5K5EA 3BKWA 1A2BA 1QYRA 1THTA 3KAKA 5TR9A 4KITB 2YYSA 1D1TA 4RM2A 2NSYA 1T9ZA 4GR9A 2ZYAA 3SZUA 1QX3A 4I9UA 2QY9A 2RBEA 2XI4A 4YYZA 1WO8A 1Z2OX 1K97A 2A88A 2EKBA 3M1LA 3NKFA 5JVDF 5K20A 3K31A 4GM4A 1WDTA 2B1GA 1ZNZA 3NGLA 3S4YA 1AXGA 1P4AA 4JXZA 3KT3A 1JWAB 4MW1A 3PHLA 1S4QA 3UPUA 3ENNA 2E4VA 3RFTA 1HE8B 3IELA 1IRIA 3BMCB 4DV6B 3D43A 4RD0A 1CQIB 1WV0A 2K2WA 4BGVA 2PKEA 4WA7A 1AMUA 2AFVA 4CZ2A 1E66A 5GZ6A 2IYSA 3ZU4A 3MJRA 4WNCA 3ORHA 3NEPX 5A1JA 1E3WA 2C0PA 1QRAA 5C8VA 4EW1A 1YU6A 2IEDA 4H6WA 1ULZA 1ENZA 2ZSKA 1PFGA 2V6MA 2AG1A 3O3CA 1ACMA 3DTVA 3NHAA 3OIFA 2X77A 3Q3JB 4XE5A 4C04A 4EL5A 4UHKA 3PJRA 4YMUA 4FSDA 1K92A 5J3JA 4G8DA 3MN1A 2C7BA 1XZGA 1E2IA 1GCUA 4J0EA 4V24A 1XO1A 1W35A 2OYCA 1POXA 1RABA 2GHIA 2OCPA 1CJKC 1CP2A 4IJVA 2FCAA 5SY6A 1R4MB 1PX2A 2VH5R 3GU3A 2X7HA 2Z8YA 3IT1A 3ONEA 1VLZA 1D4ZA 1OILA 3L1KA 4K3VA 4K0RA 1KQFA 3QU5A 2E49A 1K6JA 5IULC 4KGVA 3L7YA 3I23A 3FVRA 4KVFA 4TV8B 4X64B 4E94A 5C18A 1KMIY 4F96A 3SDSA 3OIDA 2QMOA 5DN6A 2YFKA 4JU8A 5AP9A 1T4DA 1X9GA 4GKBA 2XKKA 1RXYA 3RYCA 2XOKD 3R0JA 1C1DB 3TQHA 4LOLA 5A5EA 4OQDA 1RM4A 3VOBA 4ZO6A 1C29B 2Q5IA 2DHQA 3WLRA 1L4YA 1JHXA 1LFAA 3DO6A 3O4RA 1ZN9A 3RK1A 2WT9A 4MITA 2RI6A 3OZVA 5LYJA 5FOWA 3SYKA 1V4VA 2UKDA 2XLBA 1PDWA 3ZWKA 1VI6A 4Q01A 3UWOA 1GPH1 3KLOA 4H35A 1KEEA 3ZHZA 3N5KA 1HZDA 4NZYA 1RRVA 1ZU4A 2HRDA 1BVYF 1UPCA 1YRQA 3DMNA 5REQB 1LC3A 2ZI9A 2G72A 2J7KA 1LPPA 1LJLA 3C24A 4NEHB 1D6MA 3WGUA 4B43A 4LSGA 4MW9A 5CGQB 5EMJA 4ETWA 2D5BA 1UKYA 3LI2A 1H2YA 3AKCA 3ELUA 3LUBA 3MT8A 1EK5A 4PCLA 4X60A 2QMZA 4EW3A 3FYUC 4IEIA 2GASA 5M2QA 2QD3A 2ES4A 3GRAA 1Z47A 1TXGA 5DBOA 1QK5A 2BBSA 2R2GA 4TTTS 4EHIA 3ZUGA 3SHTA 1VIDA 4HDNB 4R9RA 1U94A 1XD2A 5B6IA 1U8XX 2H5EA 3Q7SA 3ZWOA 1CRWG 3LHKA 1IZ9A 3MGBA 3PSHA 2DB3A 1V9LA 1GADO 2BGGA 2P8SA 4L3OA 5CM2Z 1QKIA 1E2NA 4D0RA 3P9NA 1MIOB 3GYBA 4LXQA 5CFZA 2FAXA 4FGWA 1R0BA 2C9YA 3L05A 4GX0A 4W1SA 3UGKA 4A8JB 3CVWA 3U5ZB 1RYDA 1LD3A 4FMCF 4GZLA 3VZPA 3FDFA 1YDWA 2F1HA 5C4IA 2DHRA 3V9AA 2VJOA 1NOJA 1NRWA 4KYTA 2B82A 5HIJA 2BMWA 3QKRA 1HZZA 4L22A 3NKVA 4ZQFA 4MHTA 2GD0A 4HX5A 1GL6A 2QT9A 3I9V6 3R7NA 2VTKA 4QGFA 3RSSA 2OBXA 2XMPA 2CVHA 1R64A 3RANA 5K7SA 4QWWA 4C0LA 4CLOA 4CMIA 4OD0A 2P6RA 4AY3A 4M9CA 3MK31 3TRFA 2BTQA 4LWPA 4LOAA 2Z3VA 1VRVA 1CUSA 1TLLA 1USVA 2O8NA 2X3UA 2IH5A 1E3JA 1Z4PX 1T35A 4FGJA 2VUUA 1RM0A 2RFLA 1P75A 3CWQA 4XAQA 4G2TA 2R5FA 4OHUA 2JHAA 2XUIA 3D5QA 2AR7A 1FA9A 1CS0B 3DE2X 2YQ5A 3W1VA 1VYTA 2DBYA 1JG2A 3W5UA 4GRDA 1KOJA 2Y0CA 1C3OA 2NX2A 4D6XA 4NYJR 1UXHA 5LZ9A 3W5BA 2ZCJA 1BC5A 2VS1A 1JG3A 3QXIA 1EGAA 2QT0A 5JVDB 1VXOA 3BBLA 5T5QA 4BKOA 3ZWQA 4CHGA 1AN9A 2X4LA 4CR7A 3DLHA 1MOSA 2R9VA 3FYSA 5B7NA 3F90A 2O0JA 3FE2A 5CGZA 1VKJA 4CKBA 1P5ZB 3BQNB 2Z57A 5KTSA 3HV2A 3VTZA 2FQQA 3RQIA 4P08A 1HE4A 3DD5A 5A5GA 2FEXA 3DMGA 1UM9B 1CQWA 3CV3A 2VDVE 1ZESA 1GZ3A 3I92A 1C7FA 2BTOA 5KYKA 1SC4A 4OMUA 3C3MA 2HQSA 5BMOA 4IVPA 3WYBA 2I3ZA 2IOHA 4E7OA 1VHDA 1IULA 1SIOA 4ARAA 3A31A 1T13A 1U3GA 5CB4A 1WUTA 7MDHA 4IJMA 4PLYA 4EG4A 2O8DB 1SKBA 1GT6A 1Z4QA 2OR3A 2VSXA 5D5PA 3TO5A 5ICSA 3Q6MA 3IPCA 2R8EA 1F0PA 3OLWA 4OAQA 2A0XA 3LX5A 5WRFA 2AVDA 3C98A 3TW4A 3UB4A 4R2IA 5G2OA 1P9WA 5CG2A 2LIVA 1A9YA 4JELA 5LQNA 4G5QA 1FFDA 2CLEB 3I6QA 1E5XA 2EP8A 2HA4A 2PM8A 2VF8A 1XTTA 4B7XA 2A78A 2JFQA 3UMMA 1U80A 4N0EA 4BX3A 2AZXA 2XR1A 4BO6A 3NWJA 4ZOQI 3WKCA 2I65A 2JFHA 4E21A 4U19A 3KO8A 5EINA 1XFAA 2R6AA 1XTRA 1CRPA 1NNUA 1NV9A 1SWVA 2JGLA 5F7OA 1FK8A 3DMTA 5KYVA 4HWGA 5FOQA 4U6SA 1UP6A 2QXTA 3U3XA 1HV8A 2BGJA 1XZPA 3LOQA 1N2BA 4UNIA 4BE9A 3D1JA 4OK3A 1RPNA 3QXSA 1YS9A 2A1IA 4M87A 5IKPA 1N7GA 2J5BA 1XZLA 3RUPA 5AKHA 1V6AA 4UEWA 3T4UA 2XPCA 4ICIA 1OU0A 3IESA 2FW1A 1MXHA 3B6MA 3E9CA 1GZUA 1UDWA 1IL0A 3I0MA 1QGZA 1XXHE 1DKQA 4H1VA 4KXUA 4ZU6X 1D6JA 1NJ5A 1E2LA 1NIJA 1V16A 3CLKA 4XIFA 1K3FA 3DZFA 3VPFA 1SCQA 1XQ6A 1T9HA 2AJ8A 1CP3A 4ZJYA 3SDZA 3GGGA 4QBHA 5LCXA 3D3EA 1D2EA 1KZGB 3T0IA 4AZ3A 2IZ7A 5H81A 4ZXPA 2Q21A 4JYPA 2W43A 3U60B 1HBJA 2IY9A 7REQA 2QD4A 2QP4A 3P1JA 1I6WA 1I4OA 4A16A 4BBAA 2ZCVA 4Q66C 3MEQA 5JBXA 3G79A 3KKNA 1G66A 4GLLA 2IUFA 4MMZB 1ZGHA 5GM2A 1OI4A 2EP5A 4N4AA 4RYLA 1LNSA 1W47A 3OQHA 3QVKA 1AA6A 3V6LA 3MAJA 2HMWA 2BMAA 3SWXA 3VU9A 1ZGCA 1B3BA 4GP6A 1XLUA 3JQGB 3BEOA 3DCJA 1XQWA 3VH3A 2QMYA 4FMCB 3ZLTA 1LBIA 2E87A 2O2JA 3SX2A 2HSEA 4WLVA 3TR5A 3MS2A 4Y1GA 4AJPA 4G4SP 1LRKA 1POWA 1ZUIA 1NPDA 4A6DA 3L7IA 5ARDA 3QA3E 4IDCA 3AGQA 3OU2A 1LJUA 3V4RA 1A8UA 4DA8A 5G0UA 2DZDA 3HR7A 5JNSA 3CZPA 2XDYA 1L1RA 4OX9B 3HTXA 1ZGBA 4MPTA 3GCDA 1T26A 5A06A 1FNBA 1E20A 1OWOA 1IY9A 2PLFA 4GE3A 2NLOA 5LLDA 3KTDA 4B9AA 1SZPA 4HSGA 3OT4A 3FSGD 1BE1A 3Q0TA 5FR2A 4BBPA 4WJZA 2XTJA 5HIKA 4II3A 3QUCA 2F9LA 4XSGA 1NVEA 3UGJA 2PQMA 4UBKA 2A7QA 5DTRA 3CZMA 4D5GA 2BEKA 4KK3A 2CMKA 4OXRA 4R98A 1FEZA 3LECA 1GYRA 1P2FA 1K27A 3VU8A 2VX2A 3IYLW 4M1QA 2HGZA 4GBJA 3OFKA 2NT4A 1TA9A 3WVNA 2O8BB 1VGQA 4B6EA 1YQWA 1SRQA 2VPXA 4WUTA 2EG9A 2XWPA 3OJXA 5DBGA 4EB6B 3FLBA 1QCYA 1V1MA 2BFNA 2V59A 2XB6A 4JXJA 4B3FX 4NBLA 1N5RA 2B6NA 4MYRA 4JHLA 4RJJA 2R8ZA 1NU6A 2C4TA 4S3MA 2XUZA 3WNZA 4E4RA 5I7FA 3OT1B 5EJ5A 5JNUA 3LLVA 4RIHA 2AOTB 3M6AA 5HKKD 2E18A 5IYZA 3OH8A 1IEQA 1BMTA 1TLFA 4M1MA 2C1ZA 3RAFC 4TM7A 1O57A 4EWLA 2A9JA 5E2BA 5EP1A 4S04A 5J2UA 1TE2A 4CWAA 5LU8A 2QUAA 2NSDA 2Y0BA 3BL8A 3V97A 4YDQA 2Y8EA 1D2CA 3WQHA 4B40A 5M3BA 3EEIA 4BVHA 4UZFA 4A8HA 1UFOA 3R20A 4U7JA 1DRUA 1GPJA 1NVTA 3TZEA 3CZ5A 4XKJA 3MRXA 4FKMA 5FL7A 4J90A 2QOEA 4AAYA 5T57A 5J4KA 3C8MA 3P5BA 2QUJA 5ER9A 2R47A 3W8NA 5KAMA 1P5RA 1AKWA 2PLAA 1R0SA 3AL0C 5K4GA 4ZOBA 4YUYA 5BN1A 2QXUA 5BSWA 1YUBA 3THYB 1R5NA 3RU2A 2XRYA 4ZDKA 4MS1B 1E9CA 2VQFB 3I64A 5BRJA 2GTRA 3MWFA 1GGVA 1Y5MA 4R1QA 2BEUA 1NBMA 1NW7A 3PC7A 1YBVA 2ONYA 5IX8A 3BT7A 1F12A 1H8HA 2VDRB 1N3BA 1B6SA 2XT9A 1R9NA 1D6SA 4TV9A 3VPXA 4JDUA 1NM5A 5C8DA 4YXFA 2COEA 2FPGA 2HUNA 4DBVO 3RAEC 4WERA 1TVKA 3WJ7A 3KDPA 4IUCS 4X95A 2DUWA 3M9LA 4WA8A 4TN1A 4YRSA 2VSYA 2RHCA 2DG2A 3H5VA 4ZCQA 3MW8A 2OE2A 1ZDMA 2AL7A 3R3UA 2V54A 4HQNA 5TARA 1GUYA 2CJWA 4F11A 2CV0A 1GWNA 3DF9A 3MINB 5TF4A 1JFFA 1VJ0A 4JQYA 1ML3A 2ZDGA 2RGWA 2XDQA 1IQ0A 3RTGA 3SQNA 3K7EA 4B3DA 4L5CA 2YMQA 2A14A 4MRMB 1SGWA 3KVOA 1GN8A 4QEDA 2CMGA 5FUMA 2LUOA 2AS0A 3PJGA 4M0EA 2I1WA 1E64A 1T4GA 3T5DA 2P78A 4NOKA 3VI3B 1RWKA 3NZEA 1J07A 4HVCA 4C4PA 3KJEA 1M66A 2Q4TA 4M3NA 3CISA 3NUQA 3SLKA 3AR8A 4YCCA 4DKJA 1JSZA 4L51A 1EAMA 1T8UA 4CUZA 2VHCA 4NCXA 1II8A 3GVIA 3GWGA 3O9VA 3IQFA 1NAHA 3IB6A 1E6EA 1VPLA 2HREA 4LRTB 4UU1A 3A3NA 2CZGA 2GS9A 5L4SA 2ECOA 1Y9ZA 1T34A 2GDZA 1XTJA 1Q19A 4AULA 1RRGA 3H9GA 3ML1A 4GICA 2B61A 2FKNA 2B35A 1QHIA 1SN7A 1W48A 2LXNA 2PS0A 1LI5A 3C7KA 3CUEF 1HNNA 3LPMA 3L92A 1G8YA 2IP4A 3H4VA 4FBLA 1AGXA 4HO1X 4XQ9A 3TLGA 2NUTA 5JCJD 3FLEA 1IBKB 3FWKA 5K6RA 1REQB 2I4MA 2XBUA 4Y2GA 3AHHA 5JPDA 5K0JA 4KXWA 3NRJA 2GZ2A 2D2XA 3H8JA 1VCHA 1Y6ZA 4X5OA 5K99A 1FTSA 1RMQA 5C7LO 2B0JA 9ATCA 4EY8A 1PWYE 1E99A 4Z4CA 1K7SN 3U4IA 5FOSA 2QAJA 4Q4LA 2J33A 3CZ4A 3NHLA 2OXRA 3F3YA 4G0NA 3JQ9A 4HXYA 1FJ2A 1XNGA 4LN1A 1U3FA 4Q6BA 2ZUSA 2FR8C 2BN4A 3EAGA 3G17A 2JIDA 1AOXA 1E1DA 4V0SA 1ZGGA 3PEFA 1ZK2A 3DKRA 3MQFA 3F2VA 2FSIA 2X9GA 4R2KA 5B1IA 4ZYXA 2WWRA 4YGXB 1E9RA 4B71A 5T3UA 5FCDA 1RWQA 4G1EB 4B6JA 1PV2A 5IF3A 5L3QA 3F6EX 1NUUA 2OGSA 2JK1A 3T52A 4N0DA 4RF3A 4OHBA 1NKVA 2GUWA 5CYFA 5L4NA 1NZDA 1DAMA 2VNIA 3P97A 1BE6A 4KQJA 5CIWA 3RWOA 4V1CI 1J33A 2V7QD 3RYHB 2VVTA 2BDUA 2CNNA 2YNMA 4HUJA 4QU5A 4A10A 1QZZA 1HKHA 2LRHA 3Q3GE 3S2UA 3SN6A 4OGKA 3QLUC 4E5VA 1GVHA 3E7DA 2QSYA 3UJ7A 4D9GA 1Q7TA 3LQ4A 5T64A 1QYWA 2XE6A 5LP6C 1HYGA 3QJGA 5CUQA 2LVBA 4UVGA 5BW6B 2N42A 1GCIA 4CU5A 5FWNA 3QOFA 1PEYA 1FFGA 4N7JA 4ARIA 1Z38A 2EKZA 4X71A 1S1CA 3G2OA 1UJ2A 5TMEA 3NH6A 3X1KA 2D1QA 3W5HA 3FBWA 2NU9A 1V37A 1YCDA 2Q0QA 5E9QA 4YUXA 5A5VA 1CNFA 2ZFUA 3CPHA 1U6KA 3LKDA 3SMVA 3HM9A 4F47A 2DOKA 4EKGA 3WMRA 3CM0A 4TLAA 5IAKA 5FBKA 3TM5A 4YCMA 5EY5B 2WWWA 3P0IA 4C03A 1KJQA 2ZRAA 3DVRX 1KWGA 2PZLA 2ZBEA 1U5BB 3ITDA 1KAMA 3PQ4A 5COBA 5AYVA 1TM3E 1Q21A 2KX7A 3G59A 3VO8A 3CX8A 2V96A 2FFAA 5BOVA 1V96A 3F47A 2QM8A 2H7YA 2EARA 2IE8A 4M1OA 5I4CA 2X15A 3W2EA 5SZHB 1IDOA 4BLWA 4EDHA 5FPHA 4M9QA 4XJVA 4LGMA 3I28A 1BHQ1 5JSZB 4RTNA 3ZY2A 2WINI 1E1MA 3A27A 3U7EB 4EFKA 3VNVA 4DTCA 5LN1A 2G7ZA 2IYVA 3E2PA 1MLDA 3IMGA 4FZRA 5J2TF 5DK6A 1F6BA 2H57A 5HF8A 2ROQA 4NCJA 1HFEL 1BJRE 4ZO8A 1TYAE 3GZ4A 3TTUA 3KJFA 2XXAA 4KXLA 1JAXA 2BH2A 3ELBA 4QGBA 1Z34A 3DNPA 2OXFA 4KU4A 4GI3A 4PYQA 4CTNA 4JI2B 1J0XO 1FVHA 1RQXA 1WKCA 4TM8A 1N75A 3N8DA 4NXNB 4UHFA 1GAEO 1SU4A 3TQOA 3HCCA 3ZCRA 2JL1A 1MBZA 1NFRA 3LLCA 3GLGA 5LDGA 4DF3A 2I8LA 1ZJ6A 4MB0A 5CFPA 3WHLA 3C3DA 4TTPA 4F21A 4D5EA 2IA5A 3QLJA 2FPRA 4WBSA 1H0HA 3RC7A 2O5CA 1OVGA 2XCIA 3JSXA 3W04A 2B4YA 3AHGA 3KXLA 1UXJA 2WUGA 4TVKA 5JWRA 4J4BA 4GI1A 3BYZA 3PNOA 1EXDA 5F77A 5BP7A 3R8CA 4M8NE 5IZ4A 2J4DA 1VSUA 3UAOA 4H15A 1BXRA 4N9QA 3EOBI 1AXRA 2VUHB 5EZSA 2JGNA 2G80A 4M1YA 1GTSA 4F1JA 5DOZA 5B3JA 1T9CA 1SHKA 2UDPA 3NDRA 1D0VA 2TECE 3TB6A 3TDKA 4QTUB 2DWQA 4DJAA 3R6TA 4QNRA 3RUHA 1FVOA 4F2WA 3D4OA 3NHWA 4UAGA 3QUSA 4Z7QB 2CDCA 2ERCA 4P5DA 3WDLA 3NIFB 1YQGA 3A9WA 4O8ZA 3JYLA 1FSGA 1PEKE 3WLFA 1VLVA 1C8LA 1GKYA 2P90A 2AZ4A 2OV4A 2X23A 3KPWA 4U7TB 3U7FB 2H08A 2IS6A 2CE7A 4KJZA 1PD1A 1NW4A 1Z2DA 3AERB 3AY3A 3N07A 4LV8B 1K8QA 4Z9AA 5JE8A 2QMUA 1QRSA 4C5AA 4LK3A 2MSWA 4RABA 5EYPB 5I5GA 4RFSB 2XXJA 2CL0X 3LKZA 4R8MA 2SHKA 2AWOA 2IJGX 3MZ0A 1COWA 4UUAA 3HN2A 4WJLA 1VP3A 2VDQB 1TUIA 4NBUA 3SSAA 1KYXA 2J5KA 5J4LA 1QLHA 4AG5A 1NMQA 1OX5A 3LYLA 1T8PA 4HJRA 4UCFA 3ANXA 3IKJA 4YAEA 3SI7A 3FKSA 3LWBA 2XNHA 3KIPA 4J3JA 3AP2A 4RQUA 4X8LA 4BDTA 5BNIA 2QBYA 4XYLA 1BIFA 1BS1A 2QGNA 4L72A 1ODTC 4WKPA 1I5OA 1LX7A 3I61A 2JJ2D 4R6WA 2J59A 1JLRA 4AJEA 2XUJA 3B6KA 3SIXA 2W2VA 2YQ4A 2ZW9A 5CLJA 3NASA 2CW5A 4P54A 1K7FB 2O7SA 4WL0A 3ZDRA 4C3OB 3KTOA 3W4KA 2FMXA 4IOJA 1T25A 3I73A 3DUWA 4AUKA 3HHEA 3L41A 4DDTA 2JHGA 1XCPA 4JT8A 4Q16A 3MYYA 2QTVA 1Y6FA 5FJJA 1U8ZA 4KXVA 5TY0A 2CYAA 3OF3A 2IYZA 2VF7A 1I6KA 3K20A 1IEWA 4N6GA 3ZUPA 3Q7TA 2M2IA 2R751 5JSKA 2QAGA 4FDTA 1PBNA 2UZAA 2GPTA 2NG1A 3BMOA 3IBSA 2A0YA 4H1HA 1XJ0A 2AEFA 3NWOA 5ECYA 1E2JA 1BDIA 5DM1A 1P2UA 1VCMA 2VHQA 1QP8A 3WTCA 3DOEA 2YHUA 4C89A 1MABB 2NSHA 1QM5A 1URPA 3IT0A 4COOA 2VUIB 3OX2A 4NMXB 1T8SA 2PWBA 5AOAA 1AGRA 1ZN7A 1N5DA 5KQSA 5CDUA 1T9AA 2I9KA 1IXYA 5B3AA 1QANA 4O1IA 2OM6A 1T36A 5HJ7A 4BLPA 3Q3IA 4L5AA 4O2AF 3MT7A 1X14A 1QIMA 4OATA 4EJSA 5IKMA 2DT5A 4N8SA 5BMVF 3ZCUA 1VM6A 4BUCA 3R76A 3WMFA 1EXWA 3Q0GA 3U3JA 2V7WA 3K0CC 3OM9A 1PUXA 3OE1A 2QN3A 2RGYA 5ADVA 2DWPA 3FPAA 4B31A 2VHWA 4ROSA 3P4UA 4RPGA 1NP7A 5FBZA 5L6LB 1LI7A 1L5RA 3PVCA 5JW6A 3AJRA 3ZKAA 2ZCUA 1A9QA 4HDSB 2CHGA 5DLQC 1CDZA 3K6JA 3TUZC 1C7RA 3SQXA 4FGKA 3W5DA 3NFYA 3OQJA 1U0OC 4OHMA 3LZ6A 4Z2YA 5J2TB 5D3KA 5HOEA 5DIFA 1QK4A 3AR9A 3DH0A 4WKOA 3UMVA 2J0VA 2NVBA 4BO8A 3TRKA 3S68A 3AY6A 4E30A 3ODPA 3A2LA 4UUOA 5E1OA 1B76A 1N5LA 5BQXA 1KPGA 5KVQA 3KL4A 2C9ZA 3K9WA 4H3KB 1RJMA 2YZ2A 4L73A 5F7XA 1ZEJA 2IFTA 3GRRA 2PUHA 4PG5A 3K8OE 1P60A 1U7DA 2J46A 4QL3A 2Q2OA 3A6ZA 4DCUA 4OYRA 3GDGA 1CUCA 1WXGA 4IRUB 1KZHA 4CV2A 1HL3A 2V5UA 5AK4A 2V45A 2VHJA 3FB1A 3JQAD 5DHAA 2OYSA 4NPCA 4MGYR 5EGSA 3TCNA 1I7QB 2I3BA 4C20A 1G21E 4RE5A 4YS6A 1QF9A 3C14C 4FEYA 2EX4A 3MMZA 3G82C 1BNCA 3IUBA 4B33A 3NEYA 3USES 5BR7A 4Y0NA 4WH0A 3MHTA 1G9SA 5AK3A 1KR5A 1SUSA 3EZNA 4FE7A 3VDNB 1I6MA 3DXYA 5E7JA 2Q5EA 1F2TA 1P73A 3QU4A 3L0YA 4BY9E 4UDNA 4W6QA 3TWOA 3G1UA 4WKBA 1NULA 4D9IA 3RW9A 3MHPA 4I42A 4BNJA 3GMDA 2SECE 4ZQHA 4NYMR 3F8TA 1CY6A 5ER6A 2VYFA 1QIEA 4L85A 2H00A 1ZUHA 3O74A 3TKYA 1EP2B 2C2YA 2XCSB 2Z1NA 3SLLA 3KDSE 1VPDA 1Q0PA 5E6RA 3RKUA 4BNTA 3HKEA 4NBTA 4M7PA 5ICMA 3JZIA 2IV2X 4L08A 1CUWA 1SG6A 2Y1GA 5BXQC 3DDCA 2HD4A 4BX0A 1WDLA 4V0QA 4E2YA 3DOHA 1ZVMA 3NR2A 4XIJA 3AB3A 3V8NA 2FW9A 3AUAA 4YCJA 5BPHA 2XUAA 3INTA 1QH8A 3UUEA 4CCAA 4YCLA 3AFIA 2L0XA 1K2VN 1PL7A 1C4WA 2V97A 1RHQA 1EM8A 2IHUA 4L6AA 3FMFA 1NP6A 1NT4A 1KR2A 1UBUS 3G7SA 4FYHA 3QIAA 4IIGA 1XRPA 4U2GA 3B9RA 3E58A 4M2LA 2JFFA 2JK0A 5LC1A 4FXPA 3KV1A 2V0GA 1GP2A 1UZUA 3EUWA 1C30B 4JC4A 1FW8A 3A1TA 4B8WA 4CKXA 5CA1F 1OREA 2ASVA 121PA 3BCSA 3TX2A 2OVBA 5J43A 4BKMA 3OIGA 1ZQ1A 2ZE8A 3EC2A 5CBPA 1CJCA 2J9ZB 4M7RA 4J7XA 5NULA 3I42A 4I4IA 4WMLA 4NBVA 4QUKA 5JEDA 4E31A 2F67A 1T43A 3ZCTA 4HN9A 2ANCA 2QRLA 3T1NA 2QUIA 3T9BA 3PD7A 4MOUA 1S2DA 4AIRA 5EQFA 1G3UA 3DA8A 3IBGA 4NEKA 1JDZA 2O6HA 3TAUA 4C7JA 3GGCA 3GAAA 3HADA 3NM5A 1KH1A 1Q16A 3O8LA 5KSYA 2QZPA 3U44B 3CH6A 1UBFA 2B34A 2K5UA 1J97A 1DC7A 2KYRA 2GRUA 2QN6A 3DVAB 2QVLA 3GBSA 4R0MA 5HM6A 1NW5A 4J0JA 2XD9A 4H7EA 3N2YA 3REGA 5CDTA 3DPSA 3GVHA 2X2FA 1V8PA 1MFPA 3D3WA 3W5VA 1TO6A 2VJNA 3HKDB 3UHFA 2XVMA 3SKXA 1RRKA 1BROA 4ZCPA 2ZR0A 1UZAA 4B4WA 2Z5GA 1AE1A 5ALFA 2EX1A 4PZLA 1KBQA 1OKKD 5BRAA 3AH8A 1T6BY 4UUQA 2M1ZA 3BD7A 3FM9A 1JSLA 3BULA 1H1TA 1OIXA 1CS4C 1IAQA 1EE9A 2Z9BA 3HCDA 4GD3Q 1X0XA 4O2LA 1XAGA 4YECA 3OOWA 4B0OA 1BMFD 4QICA 1O0SA 4O2AB 4QU8A 3WQRA 2CNDA 1QUEA 3NBZC 3PITA 1N8TA 2WICA 4B3MB 1YE3A 2R5NA 1XWWA 4MB6A 2D0PB 3SSMA 5AVRA 4KSCA 1Z7BA 2R6R1 4YR9A 1GZSA 2QTBA 4ND3A 1BDHA 3VUFA 2F3SA 2EVWX 1FU4A 1CHDA 1QG2A 4LECA 1YBHA 3UYLA 1KVTA 2PGLA 3I6YA 4IDQA 3ZJYA 3WWCA 3RTEA 3LNCA 3UGQA 2QRMA 2DFVA 4TT3A 5CIYA 3AFGA 3F9CA 1X19A 2VWQA 1T1GA 2ZIVB 1JZQA 4RK1A 4DB2A 1E96A 1OTXA 1ISHA 4D43A 1II0A 3VJMA 4RVCA 2QQEA 1M6NA 2YFHA 1X8JA 1KHHA 3FLAA 3H6HA 4FNGA 4XUGB 4ZT4A 3O4FA 4AXXA 1AO3A 4EB0A 1SU7A 2OP1A 2QJTA 2XNJA 4LJKA 2XRZA 3EDCA 1PF7E 1L8OA 2NIPA 3KDAA 4ZA2A 2YJ3A 1P4RA 1ZJYA 1L8XA 3CIFA 4NE2A 2XCLA 4RLQA 4X41A 2HEIA 5FA8A 1Z6PA 4IQ8A 3GD5A 1S8NA 4MLPA 3BMCA 1FFSA 2OQVA 3ESYA 3MUEA 1Z0FA 4L4YA 2HWWA 4G9BA 4MPDA 2Z8ZA 1H3NA 4PAWA 4MHSA 2FZKA 3M4YA 3O7WA 1JKMA 4WY8A 2I3AA 2O1WA 3MT9A 3I9OA 1TKBA 2OGWA 2ZE6A 3HGMA 5EKSA 1I4TD 3T15A 4BZXA 2AC2A 4YFYA 5JNTA 4BO0A 2ATXA 2H0QA 1E2BA 1PR6A 2NQTA 2PUWA 2VF5X 3HXPA 5GVRA 1C0EA 1L3BA 1MB9A 3R0IA 4MCHA 1TL7C 4C7XA 3SS8A 1HMPA 2Q1SA 1IBMB 3ZE6A 1PI3A 5DK4A 1ZXLA 2WOOA 4OP1A 1NF3A 1ZW6A 3PUWA 4GVXA 4DA9A 4IF6A 2DUNA 3H4IA 2E5WA 1Z06A 2HSDA 3S3TA 3U7HB 2WM2A 1J0AA 3W6OA 1NSYA 4W5JA 2NPIA 4GMFA 1H4VB 2BFWA 2FWIA 1Y4DE 2H07A 3WK5A 4I6EA 1RXCA 2EP7A 1XDGA 1Z6AA 2H92A 1R4MA 1XA0A 2MU1A 3KQMA 2OORC 2QIOA 3NTUA 1FB5A 3KT6A 1L1EA 1SVLA 4NENB 4PFKA 4URWR 1FY2A 4NNJA 1FFEA 3WLEA 3PHJA 3ZU3A 5A03A 2OHJA 2GPWA 2PN1A 5A9SB 2RD2A 2J09A 3A06A 1GUBA 4CVNA 2C3OA 4TV8A 1NF9A 1XT6A 2AJTA 1LGYA 3A2MA 4MVWA 4RTQA 4B44A 2QZ9A 7AT1A 1XWFA 2LNDA 4D97A 3SIRA 4BDSA 1KKUA 5DHQA 3E2MA 3WDKA 4P80A 3AMVA 5K0NA 4BFCA 4LQLA 3RAGA 5DBEX 4FMPA 2C77A 5K51A 1SUWA 4O3FA 5IHPA 2HR1A 4MQFB