3ADCA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
246
Chain Sequence
HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 87
structure length 246
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3adcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adcA01
4V0MA 1T9HA 1GVNB 4M9ZA 3B13B 3PEYA 1NVVQ 1TQ2A 4N1AA 3RS2A 5KYKA 2ZJOA 2P67A 4HEJA 2YINC 3MAAC 2H92A 3IHLA 2PH1A 4ZDIA 4TYWA 2CDNA 3EIEA 5EXPA 4L9SA 3WMFA 3RRZA 3ZDQA 3GLIA 3FFAA 1JI0A 2GCPA 2ZRBA 3H84A 4JL8A 4JSYA 4AG5A 2R65A 3CF6R 2DHRA 2GK6A 4RZUA 4W7SA 2WMOB 4B73A 4JKIA 4MRNA 5JSZA 1HEIA 4M8NE 1U94A 4KFTA 2A5YB 2KE5A 3VAAA 4ERNA 1UKYA 2O8EA 1G291 2W58A 1F60A 3L2OB 5KOYA 3I61A 3Q72A 3GMTA 4NYIR 4PZZA 2GWHA 3UKDA 1HY3A 3RNLA 1WQ1R 5DLQC 1N3BA 1E2HA 1XEWY 4JIMA 4ZKDA 2GZHA 1N6OA 2J7PD 3QKTA 2QEQA 2Z83A 5KSPA 5DYIA 2HLDD 1WB9A 1GL7A 5JZVA 3AUYA 2NMVA 1SVOA 1Z22A 1Z07A 1DAGA 3IBGA 4LOAA 2WJJA 2F9LA 2FPMA 1HUQA 4PSAA 3WYGA 1OHHA 5EE9A 4M21A 2BEJA 3ADCA 2B7CA 3B85A 3KZ1E 4WOPA 2C9CA 2IYZA 4I99A 2D7CA 3A58B 1IHUA 2R9VA 3SYLA 4O2LA 1ZNXA 2I1QA 3WNDA 3ZZUA 1ZUHA 2WM9B 3EC1A 5AK0A 5DISB 3U6BA 4NU0A 1IN7A 2OO7A 1UF9A 2MMGA 2ORVA 1ZU5A 3BH7A 1P62B 2GHIA 1XWIA 2ZEJA 1DAKA 4NTZA 2W00A 4FCWA 2VBCA 4BGDA 1G6HA 2VP6A 6Q21A 3RC3A 2PJRA 2PZEA 2JLWA 4LJ7A 1JAIA 1IY1A 3RLFA 4BZQA 1Y63A 1UEIA 1E9CA 2AK3A 5SZIA 5KO2A 4U5XA 4IW3B 1G19A 4FWIB 3SI7A 4HAZA 4HLUA 1ANKA 3DOEA 1OSNA 1ZM3A 5FOVA 5CLQA 3M1IA 1OFTA 4LHVA 2MMCA 1C1YA 4MDEA 2E9SA 4QBGB 1J70A 3TSZA 2XJ9A 5C2JB 3KB2A 3EX7C 3FKSD 4JBYA 1U9IC 3BOSA 4F4JA 3FMIA 3LV8A 4LPSA 5J4HA 2VSFA 2IYRA 1IN6A 2G83A 4I81A 4CGZA 3FDIA 2OCAA 2Q0HA 2QY9A 3HP1A 4V0KA 3OAAD 1AKEA 4KI0A 4BECA 2BM1A 2Q3MA 5L8VA 1E9BA 2ZJ8A 4NCHA 2O8BA 5JCPA 2NO6A 2BDTA 4LJAA 5B2ZA 5LB4A 4KLZA 2BKUA 2ZRMA 2Q3HA 2GAOA 3L0IB 2R6FA 1S9HA 2D2FA 4DCUA 2FZ4A 5JRJA 3G82C 3KQUA 2JIZA 2ZI3A 3LW7A 1OIWA 4PHHA 4R2HA 2ONKA 2FFAA 3IQWA 3H2YA 4P4TA 1QZXA 2CL0X 4PSVA 4XTRA 4DLWA 2XSZA 1DBSA 4P31A 3QQ5A 2CXXA 2EWVA 4ARZA 2G9NA 1E2LA 4ASUA 3KJGA 1N6IA 3U3OA 3RS4A 5EP4A 1W0KA 5HCIA 1E9EA 3BFKA 3X1XA 2OFOA 3U7FB 3AGPA 3GLIE 2YOGA 2KB0A 3F5FA 1RRFA 1VG9B 1KI6B 1N0UA 4NE2A 4TMWA 4NCNA 2QORA 1YKSA 3EARA 4S2EA 5AUNB 4ZDWA 2GETA 3EAQA 3T35A 2C9YA 4HZUB 1D6JA 1CS4C 2G1JA 1WDTA 1JJVA 1BH2A 2RGCA 4JT2A 2J0SA 2KSQA 1XBTA 2V6JA 1OFIA 2UZ3A 3JZAA 5A4JA 4QNRA 5FOWA 4A92A 1JB1A 4X8MA 4JLNA 3SE0A 4DLTA 4US1R 1SVWA 3SFZA 4A9AA 4CVNA 1NN5A 5L3QA 3NH9A 1AKYA 2KBFA 1KI6A 5J5CA 1M34E 2Q3FA 2ZRPA 1EK0A 3WYAA 2P6UA 3ZJYA 2ZJBA 2RH5A 2JAQA 1FP6A 1P73A 3L82B 4E09A 3A1WA 3KKMA 4KBFA 4A6XA 4JKYA 3GLGA 2G77B 1FNNA 3AVTA 4OYHA 4LC0A 3THYB 1XTKA 2QP3A 3FHOA 2QNRA 1XPOA 2ZETA 4D6PA 4ZIRB 4IOJA 2AKAB 4PC3A 1W4AA 3EG5A 2ZR9A 4DWJA 1KI1A 4CT5A 2X19A 3CH5A 1Z6TA 2GEUA 4JLMA 5JLJA 2WIBA 3K70C 2REOA 1OE0A 1KHTA 2DR3A 1JR3D 1I4LD 4LZZA 1P7CA 1D2NA 1G4UR 2FOLA 1D9XA 1ZC4A 3RHFA 3THXB 3K9NA 2JLRA 1IJFA 1S96A 2VH5R 3ASZA 1IY0A 2CNWD 4HAWA 4WXRA 1ZUIA 1XD2A 3SS8A 5BW8A 5CDFE 4ASUD 5EJEA 2ZUCA 4BE7B 5G40A 5JRZA 2C77A 4FMDB 4GFDA 3K09A 2O8EB 1CKEA 1NVXQ 2XNDA 5FI0B 1JR3E 3D3QA 1YJ5A 1ZU4A 5UKDA 1GUAA 5EXSA 3NBZC 2VHTA 1Q1BA 2X77A 2ANBA 3Q3JB 3L8ZA 3Q9LA 1NMZA 4UXIA 1H65A 1ESMA 3SDZA 4B2PA 2ZRDA 2DFLA 4QJ5A 4TYQA 3KL4A 1RC8A 5EXTA 1XXHB 2BMEA 4LJ6A 1ZP6A 2ZSAA 3T61A 1HT2E 1M7HA 1DO0A 1W5SA 5EE5B 4OQNA 1VG0B 4XJXA 4HDQB 4FMDF 3EZ6A 3OFND 2FDCA 5DHAA 1MO5A 3AGQA 4U7DA 2W2VA 2CLCX 4MGZR 2NTYC 4MGKR 4IXMA 1AGPA 1KAGA 1KJZA 1MRNA 4LYJA 3UIEA 1NN0A 5JWRA 1IXRC 5KHOC 1E4VA 2OXCA 4G01B 5J47A 1KSFX 2GVZC 2VLIA 2QSYA 1I4TD 1KK3A 1XXHA 2RHDA 4RD6A 4LYFA 2ZJAA 3NIBA 4IDHA 3VHXA 3ZVRA 4NDZA 3HDTA 1FPMA 4BFSA 1EX6A 2FWRA 4QOSA 2VP4A 2YNMA 3LAWA 3MSXA 4JYBA 3RAPR 2AXNA 4RZXA 1Z6AA 1ZIPA 2RGDA 5HKKD 3BJIC 2EWWA 1SXJB 2FMXA 3LQQA 3PEUA 3NH6A 4LCBA 4CEJA 3CF2A 3QKRB 2EQBA 3CPHA 5E95A 2D06A 4URXR 1RVDA 3A1SA 4QBFA 2VPPA 3GLFB 4JMPA 5JJKA 4W9MC 4TQUS 3H4MA 2XX3A 5CM8B 2UVQA 4GP6A 4MITA 4C0HA 3KQHA 2IX3A 3ZVLA 1E2KA 2KI5A 2WOJA 2ZRAA 2ZRJA 2GZAA 4GPTA 3RWMB 3GJ8A 4LV5B 2J87A 3T1TA 1AA9A 1A7JA 1N6PA 3UANA 5FOUA 2VRWA 3RS0A 3ZZ0A 4R71A 1P75A 2Q9BA 1OKKD 3THOA 1LTQA 1M7GA 2XZOA 3ZIAA 2WBLC 1RRGA 3K9HA 5CK4A 1T4GA 4AI6A 4KCGA 3GLHB 4NPHA 2BKEA 4QJ4A 1KI8A 3W3ZB 3QKRA 1PVOA 4B32A 4DEYA 1T3SA 5TV2A 3LBNA 2YOHA 3C41J 3AKCA 4EDHA 4I4LA 5DN6D 4TLCA 1IN4A 2WWFA 2ZI4A 3IO5A 4LHYA 4Q4HA 2AFIE 4GZMA 5G3ZA 2YWGA 1XMJA 4FCTA 3WMEA 3VFDA 4Y0AA 4W5WA 3TQFA 4PTLA 1G7SA 1KZGB 1Q1EA 1AZSC 2ERYA 2OILA 3NBXX 2OFXA 5KTYA 3ZQ6A 4Q1AA 4A4DA 3OFNA 4Q9HA 3I3SR 1GG2A 3NTUA 4Q7LA 4DKXA 3OIUA 4IOMA 3A1TA 4C7OA 2FX3A 2EYQA 3R9WA 1IN5A 4E03A 1AS0A 1ZW6A 3GFOA 1PLLA 1CP2A 4R7ZA 3DM5A 4RVCA 3MJHA 2YJTD 3B1XA 4UNPA 4PPNA 3ASYA 1IJEA 1NNEA 1AGRA 3QXCA 1CR0A 2WPDA 2BV3A 1RJ9A 1X8JA 2V9PA 4HZIA 1R8QA 2G88A 4PC7A 3IGFA 4CEHB 3X1ZA 4URZR 1X1RA 2BBTA 4RD3A 4EAQA 4PC1A 1OHHD 5FUXA 1Z0FA 5JJLA 1SGWA 1KY2A 3HU2A 5GADl 4WXPA 3QI2A 1XCMA 5K8UA 2R8RA 1M2OB 4ZPXA 4TMKA 2JDID 3SHFA 5LD2C 3BRWD 2RKOA 1FNMA 4M9QA 3LBHA 4WIAA 2WWYA 3W90A 1ZBDA 3NBFA 4HUTA 1KO4A 4DLZA 2QBYA 5KSYA 1ZD1A 3GLGB 4DIDA 3LRPA 5EE0A 3THYA 4FWTA 3MG9A 4G0NA 3CW2A 1G41A 1W36B 3B82A 3NC1C 3VX3A 4PHFA 5TARA 2HUPA 3Q85A 3FMOB 2PX3A 1ZM4A 2ZRGA 4WZAE 2P2LA 2IW3A 1NVUQ 1KY3A 1QHNA 1BMFD 1W49A 4MDFA 4Z8YA 1LW7A 3TMKA 4V0OA 5ELXA 3C5CA 1ELOA 4KV9A 2FGJA 3BXZA 2WWGA 1E98A 4AURA 3EZ9A 2JJ1A 3Q5EA 4KU4A 4OI2A 1Q3HA 1W0JA 3DZDA 1RPZA 1CF4A 2OBLA 4K81B 3CZPA 5FBLB 2IC5A 1UJ2A 1G9XA 2ZRKA 2EVWX 1IY2A 1F2TB 3E2IA 3IBYA 2ODEA 2BVNA 4RKEA 3KKQA 3W6PA 5B57C 4LJ8A 2N46A 4YDHB 2ZS7A 1UFQA 4C3ZA 4TWZA 2FU5C 1V43A 3VKWA 2QAJA 4PSKA 3HPRA 2XB4A 1TQ4A 3TH5A 2J59A 3E1SA 4IEIA 4R98A 1UKEA 1M6NA 1R5BA 2OAP1 2WSSD 2QROA 4DDWA 4JL6A 1T0HB 1XMSA 4R9UC 4JLKA 2E87A 4AY2A 2QM7A 4FW9A 4B48A 3IEVA 1SHKA 4LHWA 1N5IA 1U2RA 3RVBA 3TGPA 1W4RA 3M4YA 4M53A 4D4JA 2ZI6A 1QBKC 1Z0KA 2VF8A 2WSMA 4TT3A 3GEEA 1S4QA 2BBWA 4KSBA 3DL0A 3SYKA 2VP0A 3AVQA 4LBVA 5GJWC 4YXWA 2RGNC 4LPKA 1D8TA 1NSTA 3FPAA 3VR3A 5FUYA 3V00A 1LF0A 2ZSFA 4G3XA 1SXJE 1DAHA 1XMVA 4H1VA 2LKCA 4I1OA 4RD2A 1S3SA 1YHNA 3I92A 2EFGA 5GVSA 5DYGA 4QGGA 4JT4A 1IXSB 3N5CA 2CCJA 3GFPA 2W0MA 2CK3A 3U4QB 1OXVA 3JVUA 4RCYA 1FW6A 1SXJA 1Z6YA 1GFIA 1ZRHA 4JVSB 1JQJC 1Z3IX 2BOVA 4LBYA 1CR4A 1E9DA 1N5JA 1W4BA 1MO6A 2AR7A 1NF3A 4MYUA 3QJYA 1E1RD 3AF2A 1A5TA 1SVLA 4OKSA 2XAUA 2XITA 4B71A 2XZPA 3GJXC 2F43B 2H1LA 1VYVA 4PR0A 3OEED 4JJZA 3SJZA 3AH8A 5FFMA 4QNMA 1EWQA 5B30A 2QP4A 3B8HA 4ILEA 2WICA 4KVAA 2JATA 3FGNA 3K0FB 4TLBA 3TJZA 3SQWA 1KSHA 2UKDA 3WBKA 3W3AA 1KSJA 2ZJYA 3B1VA 3U4QA 1N5LA 3CNLA 1EFTA 2HEIA 2IK8A 2PLRA 2GJ8A 2WPDD 3THWA 1KDTA 4XOIA 1Z63A 2NOAA 1O87A 5HZKA 1DAEA 1R4AA 1II8B 3WBJA 1KOFA 1KGDA 2QN6A 4C30A 3AF0A 3QF4B 3ADBA 2IYLD 3CO5A 3ZD7A 4PX9A 1L8QA 4PAOA 3A8TA 2A30A 3UMSA 2ORIA 2WJYA 3CH4B 3FMPB 3EZ7A 3UMRA 2ZYVX 3EC2A 5KDDA 3BH0A 1W48A 1BS1A 3O8CA 4X8LA 3NEJA 5HE9A 3W34A 1DE0A 3T15A 2OESA 2V7QA 2YKGA 1GNQA 4BLTA 4C0BA 4URVR 2FN4A 3AV0B 3MWLA 2ZSDA 4KFUA 1W1WA 4TL8A 4BFYA 3FHTA 1DTSA 2J7KA 5HZHA 1JEDA 3FFBA 1S1CA 5IRCD 4B47A 1XXHE 2CLDX 4DLVA 1W7AA 1E2EA 1K5GA 1W5TA 3IPXA 1AIPA 5KDLA 1KO5A 4OJKA 1VTKA 4Q47A 1EGAA 3PJRA 4CEIA 4BRUA 1MABB 1E9FA 2D4HA 4ON9A 4AWXA 1Q3TA 3QIAA 5JEDA 3EA0A 4EPYA 1R8SA 1OKKA 1QDEA 3LXRA 2NIPA 1ONBA 3QKSB 1QHHA 4OI0A 5G41A 4IFBA 3OESA 2A78A 3KXLA 2UZIR 5SZKB 1E94E 2IYSA 3WXMA 4CRWB 4X8HA 5L3VA 4N0EA 2QM8A 1GAJA 4A6PA 4C0JA 4F4CA 4B3BA 4D26A 2EYUA 1FOEB 1FUKA 2ATXA 2VHCA 3TK1A 1Q1ZA 2KJQA 5P21A 1RYFA 3OZXA 4Q48A 2EFEB 4KSCA 4TMVA 2JLZA 2GF0A 4UJ3A 2WWWA 3ZQJA 4LRWA 1YR9A 1ZM2A 5DN6A 4CIDA 3DHWC 1A1VA 1J2JA 2EW1A 3EXAA 4HDOB 2FPKA 4GI7A 3BH6A 4M1OA 1T91A 1FX0A 2LKDA 3U3RA 2REBA 1G17A 1OLOA 2ERXA 2J0QA 1HTWA 2H16A 2ZXUA 1JXOA 3IEUA 4FXPA 2G0TA 2H5EA 1NBMA 3EWAA 1TTTA 2DFKB 1JJ7A 4E22A 5HE8A 3KFVA 3CNOA 1DAFA 3BERA 3K09C 3L0PA 1YR8A 3E70C 3TRFA 3WNBA 2Q9AA 4JLJA 2O0KA 1TUIA 1TQ6A 3MJRA 2JLYA 5JECA 1MO4A 1R5OA 3U7HB 3V9PA 5BYJA 1PZNA 2HT6A 1LB1B 2B92A 3QNUA 5FOTA 1UPTA 1KK1A 4ZO4A 4DSTA 5EE3A 1OIXA 2QRNA 4NYMR 4NYIQ 4ZI3A 3SQXA 1NIJA 4AYWA 2XNSA 1SKYB 3KTAB 4FMCB 3U44A 4GOKA 5HTKA 3D31A 4EIWA 2GXQA 4OK5A 4BFVA 5IHPA 3I62A 1BO6A 4OHZA 1VG1A 2FG5A 3O8BA 3SU8A 4D82A 1M74A 1P61B 2J41A 1XPRA 2GJAA 1OYYA 2HYDA 4O25A 4A0RA 3DVLA 2GJKA 5FPHA 2RMKA 2OSBA 3P4XA 4C0LA 1G8YA 3KKNA 1JAHA 4BZXA 3CM0A 4YMVA 1KMHA 1U9IA 3NDBB 2X8AA 5EUQB 1SVMA 1VIAA 5F9FA 2QQEA 2VO1A 4Q4AA 2B21A 1NVWQ 1UBGA 4RFVA 4QL3A 1WP9A 1ZNZA 2HYIC 2KBEA 4TMZA 2JEOA 2WAXA 2AHOA 2AWOA 1XPUA 1L4YA 3FKQA 4P0TA 3V4FA 2JJ1D 4D0LB 3AP1A 4AG6A 3TSOA 3AVUA 2PJZA 3BORA 1KI3A 2IYTA 2AN9A 3CX6A 1DADA 1G4AE 2ZRNA 4AKHA 3OEHD 3P1JA 4D4MA 5JEEA 1YZUA 4RCZA 2ZU0C 3AF3A 2AK2A 1PLJA 3AVVA 4PQFA 1WBBA 5EUMA 1S0UA 1EFCA 1GILA 1KI2A 4GMDA 4RZ2A 1FMJA 2RGAA 4AKEA 2IYXA 1Z0AA 1GWNA 2C2HA 2OE2A 3RRNA 2OV2A 3ECCA 4EQ6B 3LQRA 2GDJA 4JSTA 3FTQA 2KWIA 1NN3A 1Y3AA 4FIDA 3K0FA 4DRZA 3CZQA 2OCPA 1D9ZA 4Z51A 3A4MA 1E0SA 4DC9A 3BFVA 2F1HA 2QPTA 4UXHA 3PEWA 1VCMA 2OLJA 2AL7A 4MKFA 1B0UA 5GJVC 3CRW1 2IF0A 4IEEA 3QF4A 2NGRA 1OH7A 2W83A 1Z0DA 2GRJA 2ZVQX 3VNVA 2GF9A 3LWNA 3BB4A 1LS1A 2A5JA 2Z0MA 4TLEA 2MSDB 4RSGA 3A6PC 2CHQA 1A2KC 3PQCA 4OHWA 3ICEA 4TTQA 5AJZA 5JSZB 1KZ7B 2XTNA 1TQDA 3MLEA 4BUJA 1YZKA 1VMAA 4IHQA 1SXJD 1VYTA 1TEVA 1TAGA 5K8LA 3PUWA 3BBPA 5EP1A 4DLUA 2JJ2D 1LF5A 2GTPA 1ZAKA 1R2QA 2RGEA 4UNQA 3AM1A 1ZVQA 1MV5A 1QVAA 1XEFA 3ZD6A 1NY5A 1EG7A 1DEKA 1ZUNB 4I1UA 2C99A 1FZQA 2VSXA 1VYUA 1II0A 2HLDA 1PLKA 1E2PA 1P9NA 1VKJA 2BMDA 2CVHA 2FSHA 3B6EA 4PAMA 2ONJA 3TNFA 4TL6A 1TEXA 5HPYB 4MGYR 3U5ZB 3PFIA 2GCOB 3TVTA 1NG9A 5KSZA 2DFTA 2ZR7A 1Q12A 3QXXA 3CIOA 3CRRA 3MMPA 4CW7A 3DMNA 3CPEA 1E9RA 3REFA 4A0GA 2DWQA 1G3IA 1X3SA 1NG1A 1CEEA 2C8VA 1T5IA 4AC9A 2NO1A 4MRVA 1CLUA 1G18A 1ZD9A 2V54A 3ZH9B 5DGXA 3EWSA 3TVDA 3LY5A 4V02A 1P4SA 2OT3B 5H1YA 4TZ6A 1CR1A 2J46A 3K9LA 3CUEF 5LDDC 2QAGB 1EWRA 1Q20A 4Q1BA 1A82A 2Z4SA 1LS6A 3OF5A 3VHLB 2WWXA 3TR0A 3N2EA 4TQ9A 2PT5A 4RJLA 2BJVA 4OL0A 1RW4A 1IAQA 5JHHB 3EZFA 2JLSA 4JBWA 3K0AA 4BEJA 1UDWA 1X1SA 1YZTA 3AF4A 3L0OA 4Q00A 2OLKA 1BIFA 5M04A 2YWHA 4JVMA 2JLVA 3ZS8A 1Q44A 3VMFA 2IYUA 4FD2A 2C95A 1E96A 1US8A 2O8FB 1EXMA 2WSSA 3Q5DA 3CRMA 4Q7JB 1AK2A 3FE2A 1CJKC 1KI4A 2QTHA 2QAGA 2XZLA 1KIMA 2ZS8A 5FPTA 3T1OA 2A5FA 4KO8A 1DG1G 2ZITA 3CBQA 2O8BB 4IXNA 3SBDA 4IKEA 2J5XA 3Q7QA 3W8NA 1E2JA 4DDUA 1GRQA 3O8DA 1E1QA 4JLVA 1KK2A 1NY6A 3L43A 4L9WA 4F7WA 3VKGA 1M8PA 3P27A 3UXMA 2DWOA 4HB2A 4RZ3A 3QOFA 4F4IA 4BFZA 3Q7PA 5KUTA 5FUVA 2R6GA 4GSYA 1DOAA 1KMQA 2ZE8A 4IDOA 4G1UC 4ZI2A 2YOFA 4TL9A 4TLAA 2ORWA 4BZPA 4TMXA 2V6IA 4Q66C 2SHKA 5FTMA 3IILA 1OIVA 1KTVA 2A2ZA 4A0HA 3LD9A 4EUNA 521PA 1UKZA 3B9QA 4UQOA 3RDPA 4P4SA 2PMDA 2F1IA 2XSZD 2ZQ5A 1G5TA 2R44A 3ADKA 4HUQA 4MRPA 1GNRA 2GXSA 4UKDA 3GCGA 3CONA 2PL3A 1JECA 2L0XA 4KBGA 2VP9A 4D0NA 5HR5A 4KHZA 2O52A 5EXXA 3ONWA 1XU4A 1LFDB 4MYHA 4OK6A 3CB4A 3TAHA 4DVGA 3KJIA 4G5GA 3I32A 5K8IA 1KNXA 2QMOA 2OCYC 4OK3A 2QPOA 1XP8A 5JI2E 2LWIA 1H8HA 1G8HA 3K9GA 1HE1C 1X6VA 3EPJA 4IOKA 4BLSA 5CIQA 2ZIAA 1YU9A 1OV4A 2NO9A 3LNCA 4KXFB 4NL4H 5TY0A 1W2HA 4P4SB 1N6KA 3IDQA 3QXHA 2XOKD 1MR3F 3J81k 4B35A 4HLCA 1E0JA 1HA3A 4NCJA 3A4LA 2QE7D 1KDOA 2Z43A 2XGJA 1WE2A 4LHXA 1FQKA 1DAIA 3P4YA 1X8KA 5DO9A 2X1VA 2FFQA 1KDPA 1XZPA 2NPIA 2XTZA 4M22A 3CPJB 2FZLA 4DCNA 1S9DA 4A1FA 2W6JD 2QGZA 5DI3B 1U8AA 3REGA 4ZIRA 4TMTA 4N3NA 4CDGA 5J4YA 1WXQA 2C98A 3R20A 2V3CC 1LY1A 1OXUA 4HDCA 2J0UA 1E2IA 3B2EA 4B33A 3BK7A 5E3HA 3CRQA 5EE1A 1YZGA 3VR6A 1G8FA 5CJPA 4RFSA 3X2SA 1ZCBA 4C0SA 1NLZA 1JR3A 1DELA 3TW8B 1K8RA 1E79D 4A0FA 3THXA 4Q03A 4JJKA 1QHYA 1N5KA 1NRJB 5BXQC 3SZRA 2ZYWX 1U99A 1AJEA 4AKGA 4K46A 4M1WA 4GP7A 2QE7A 4X8OA 5DI3A 1DARA 4HAXA 5AJYA 1QHGA 3U60B 2IYWA 3HPQA 2ZYTX 4PPGA 1KK0A 3SBEA 1QHXA 2EFCB 3PITA 4H9GA 2GVDC 5D3MB 2PBRA 1QVRA 1G64A 1GSIA 2F1RA 3B78A 2A3RA 2PCLA 3PUYA 4LY6A 3W8RA 1Z2AA 4BFTA 2W2TA 3DZ8A 4QHYA 3T06B 3GLIB 1MT0A 4JLBA 2VQSA 2W6IA 2H7VA 3PR1A 3AKEA 4MRRA 2I4IA 3R9IA 1W47A 3GQBA 1F2UB 2YZ2A 3NKVA 5FOSA 2GCOA 421PA 1AN0A 1JR6A 1XMIA 4C2TA 4V03A 5AUOB 2DYKA 1JPJA 1YQTA 2G0NA 5HCNA 1UEJA 2CEAA 2PZGA 5C18A 2OM2A 2R62A 4QFMA 1U0JA 1FP7A 4EPVA 3TUZC 2WJGA 4LDJA 1K5DA 3WRXC 3SNHA 2IWHA 2CMKA 1Q21A 3CWQA 3HJNA 3BAFA 3PCRB 3V4RA 4M1TA 2ZROA 2RAPA 5CM9C 4Q5IA 2P65A 3O8RA 1GRRA 3BGWA 4EFNA 2D7DA 4OI4A 1YZLA 1SULA 1W0JD 2B8WA 4HLQB 4Y0VA 3X1DA 1DPFA 4D80A 3HU1A 1UADA 2V4ZA 2FSIA 4TTRA 1KO7A 2VIIA 1P5ZB 1FTSA 1W46A 4C0KA 1RRCA 1AS3A 1TNDA 1N6NA 3H0KA 3ZS9A 3AP3A 2MSEB 2RGXA 4PANA 1QRAA 5JHGB 3L0SA 4LUCA 3GLFA 4YMTA 1JEEA 2FSFA 2RHMA 3K8YA 1YRBA 2BM0A 2EFHB 3GJ3A 1JQLB 4LJ5A 4IVPA 4F93B 2DFNA 1B23P 2Z5FA 5EP2A 3FMFA 1PUJA 1VPLA 3R7WA 2PZFA 1HV8A 4IOLA 4M1YA 4S35A 5JS7A 3OAAA 3KXKA 4B2LA 2GCNA 3K0CC 1GKYA 5FL7A 3FHCB 3C7KA 1OW3B 1NIPA 4A2PA 3X1YA 4DJTA 4E5UA 4A15A 3GLGE 2D74A 4ZDJA 3JVVA 3WY9A 1M7BA 3MWYW 2BBSA 1OB2A 2N1BA 4TLDA 1NBME 3UWKA 4ESVA 1NLYA 1OH8A 1U0LA 2FF7A 2P5SA 1ZM7A 3Q8XB 2JLXA 4EPXA 4QM6A 2DPXA 1ZIOA 2C5LA 2W6ID 4EPTA 2FSGA 4QBIA 2NO0A 5FL3A 2C96A 4GOJA 3C16C 3GJ4A 4AK9A 3SYNA 4Q19A 5FL7D 1E32A 3IKJA 5DI9A 2VYFA 3QKUA 3EASA 4HSEA 5SZHB 2E1RA 1HE8B 3FKSA 5FPYA 4Q1DA 4B75A 3RRYA 2GEVA 4G5RA 1RZ3A 4UNNA 4DB4A 5L3QB 4HUQB 3TBKA 1DS6A 1E2QA 3FWYA 4JLDA 3QG5A 4MRSA 2IT1A 5L3SA 5JFGA 1ZM9A 4URYR 1GL9B 5D3QA 1YR6A 2AD5A 1E2NA 1E99A 4ARZB 2F55A 3TR5A 2XXAA 4LBWA 1S3GA 4MQBA 5JBQA 1I2MA 2GESA 4H1UA 5HKKA 4TZ0A 4PC2A 3HU3A 5H8WA 3ND9A 1Z29A 1UM8A 3EIHA 5EP3A 2OG2A 1KSGA 3U7EB 4AYXA 1Z08A 2EU8A 3QE0A 4C4PA 3BB3A 4CZ2A 4IDPA 3KKPA 3VQTA 4M1SA 3B1ZA 4JVLA 4XH9B 2IEZA 2B8TA 2I1VB 1P3JA 3QUSA 4DLRA 121PA 1XD2B 2H8KA 5EZ6B 1G6OA 5KNDA 3QEOA 5FPKA 2IS4A 5H68A 3ZLJA 1NKSA 4BPBA 4U00A 1TX4B 2HXYA 2FPLA 1E79A 3EZ2A 4NYJQ 1R0YA 3PUZA 3WHLA 2J0UB 2QMEA 2X2EA 4Q4LA 5E4FA 1L7VC 4DBLC 1FUUA 3RRMA 4EJSC 3GJ7A 2HJVA 2ZUDA 4A8JB 4Z8XA 1P9RA 4URUR 1JBKA 5TDHA 5FR1A 2NQ2C 3N2IA 1W0KD 1VIYA 3UWOA 2F9MA 3LO5A 4G5SA 4QJ3A 2WVJA 1T0JB 3M0EA 4XSGA 3RANA 3D6TB 2G3YA 3QY0A 2NPFA 1E9AA 4C2UA 3W9YA 3B1WA 2X2FA 3BD9A 4Q01A 4B3CA 2IYQA 1EFUA 2GJ9A 1KI9A 3R8CA 3G5UA 5EQTA 5GJCA 1SVIA 4XTCS 5CYOA 4EPRA 1Z47A 5C4MA 1F2TA 4KYUA 2OXRA 2QUZA 4WAUA 2WWIA 4L16A 1E2FA 3OEEA 1DAMA 3KQKA 3ZGXA 3EPHA 2PEZA 3GPLA 2WJHA 3ZZTA 5D3MA 4A8JA 4NYMQ 4B43A 2QTFA 2F1JA 4Q4JA 1CJUC 4GRAA 5J4KA 1N6RA 3I73A 1P2SA 2O0JA 2ZAOA 4PXAA 2FNAA 1T8TA 2OZEA 4Q7KA 2O8DA 4BFUA 2RCNA 4HYYA 2CCKA 2VF7A 4EPWA 1E2GA 3WNCA 3KXIA 3LXXA 2GA8A 1DVRA 1Z6XA 2CL6X 2NG1A 4G5QA 4B6EA 5TB5A 4B3DA 4IDQA 1R0ZA 4B6FA 5F98A 4FMCF 2FEMA 5J4VA 2WKQA 2ZE6A 1BMFA 4LV8B 1CULC 2H17A 1NBMD 3A1VA 4YMSA 2VL7A 2ZAMA 2ZUBA 1OH6A 1R5NA 4QXAA 2IYYA 3KQLA 4IDNA 5FTNA 1CR2A 2CJWA 4MYTA 4HAUA 2O8DB 1Q0UA 4DT1A 3A36A 4N0DA 1XEXB 4M4SA 4QGAA 1ZCAA 3K1JA 4NBSA 3AF1A 4XD7A 2WWHA 2CE7A 4Q21A 4B2IA 2V8OA 4OI1A 4CT4B 3NDPA 1W44A 1A2BA 3GEIA 3X1WA 1NMXA 5G3YA 1Z5ZA 1T6NA 4IJMA 3I5XA 4PZYA 2R6DA 3HYTA 1PV4A 4MYCA 2A5GA 4D4LA 3DKVA 1XD9A 3T5DA 2ODWA 4P32A 4OQXA 4YDSA 1G1MA 4MKHA 4OQMA 1XRJA 4LSGA 5B58C 1L2TA 2CJWB 3MGCA 2HT1A 1II9A 2J45A 1NLFA 1XEXA 3LLMA 2F3TA 4QG7A 3U6KA 1P2TA 3R7WB 2YYZA 1RYHA 2VP5A 1TMKA 1N0VC 2CBZA 4WA7A 1DO2A 1XB2A 3RS5A 1IN8A 5AR1A 2IS6A 1R10A 1P72A 3THWB 4C7OB 3SJCA 4CEJB 2QSZA 3H86A 1U81A 5CIWA 2JGNA 1EX7A 4XVQA 2ZE7A 3IHWA 1BYIA 3CX8A 4PO9A 4PFSA 2QT1A 3AVPA 3VTKA 2IL1A 4OJQA 5AJVB 3T34A 3AVWA 1MKYA 4JS0A 621PA 3MCAA 1W36C 1CRPA 3IO3A 2FFBA 4CEHA 3NXSA 2FEOA 3IIJA 1IONA 1ZD8A 5J4LA 5KSOA 3PEVA 1CJTC 1Q57A 2GILA 2ZI9A 1XFAA 3JZMA 1J99A 4QGHA 1NI3A 1Z0IA 5ANRB 4EFLA 2IBMA 5IF9A 5LD2B 1R6BX 5GVRA 2C03A 2OHFA 2IXFA 4EFMA 5FI1B 2DWPA 5L3SB 4Q4HB 4WZBE 2J1LA 4LJYA 3VR5A 1R0WA 4HZUA 4LC1A 3VU9A 4CEIB 1CBUA 1KAOA 3PENA 1TU4A 1MABA 1HYQA 1CU1A 5FOXA 2QRZA 1G7TA 2GZDA 2VHUA 3DM9B 3CNNA 1K6MA 1KNQA 5C46F 3OE7D 4V0LA 1E0AA 5DIFA 1HURA 2IF2A 2R2AA 3KKOA 3PIRA 2A5DA 4DLXA 4L4UA 2B6HA 4C9BA 5JWHA 1ESNA 3CRVA 1D5CA 1WA5A 4YONB 2ZI5A 3UK6A 2N42A 2WJVA 4LJ4A 3AKDA 2YHSA 2ZANA 1AS2A 1TF5A 821PA 2QTVB 1OPXA 3ZVMA 1Q1QA 4QGFA 1BKDR 2ZSBA 3LVQE 2ODBA 3UATA 2BWJA 3VU9B 2P6RA 1CJVC 4KFSA 1GRNA 1RJ9B 4DLYA 3LFUA 3U2QA 2GBLA 2REXB 4LBZA 1P6XA 4HB0A 3SN6A 1E69A 2GJSA 4LI0A 1XJ0A 2NZJA 2HXSA 1WCV1 2NO7A 2HF9A 2ODNA 2ZVPX 3F3YA 5IT5A 3BFXA 1KKLA 3HWSA 5KPJA 1X8LA 2ZR0A 3VR2A 4MUAA 4TSFD 3C8UA 1P2UA 4IVQA 5BN5A 2PEYA 2WTUA 1BYUA 3ETLA 2JJ2A 1VG8A 3GFTA 1GTVA 1M1YE 4NONA 3KJEA 3P26A 1LVGA 2XNDD 2ZI7A 4D25A 2AD1A 2CCGA 1CIPA 5IK2A 4DSUA 4RD0A 3WP0A 4QKQA 2QBYB 3BIFA 5DSZA 2IUTA 2CNWA 5BN3A 5DE3A 3KX2A 5JI3E 3MWJA 5C4GB 1G3QA 1E1RA 2XEXA 1G7CA 4D4KA 1OH5A 3ZIAD 4XVRA 3PVSA 3TUJC 3G0HA 1TF7A 4RD4A 4Q9JA 4B74A 4BQSA 2DBYA 3UG7A 4DSOA 1R0XA 1YR7A 4QHSA 4BLPA 1KO1A 3IUYA 1CJMA 3UMFA 2XXAB 3MFYA 2OEPA 3VKHA 1Z8FA 1TADA 2VEDA 4Q4JB 2LCFA 1G3UA 3K70B 2V1XA 3HYRA 3CKLA 5F9HA 4F91B 2Z6VA 4QM7A 4GNKA 2AFHE 4QRHA 2C78A 5CITA 1U90A 4V0NA 2WIAA 1MOZA 1HQYE 5FTLA 4GT1A 1SHZA 2HJGA 4TYPA 2OFWA 1TF2A 3NHBA 5BWMA 5B64A 4Z54A 721PA 2IEYA 3QVVA 4I1SA 1UAAA 4URWR 3TLXA 2QA5A 1EESA 3QPWA 4BLQA 3QXJA 4FINA 2IWRA 2JIZD 1MRSA 2YVUA 3LX8A 1XTQA 2GEDA 4RD1A 2EFDB 2GKSA 4DT1B 3E5HA 2FV8A 5FUWA 2WMNB 1NSFA 3DPUA 4YLGA 3RWOA 3TUIC 2K5UA 2R6CA 3S1AB 2QPAA 4NKRA 1N6HA 1WRBA 4JLAA 1WBDA 1V5WA 4KVGA 1SVSA 1BOFA 3QBVA 4BFXA 1PJRA 2FJUA 2HCBA 1FFHA 1KJWA 3C4JA 5JMTA 1CTQA 5GJBA 2WOOA 5FPSA 3RABA 3RS3A 2F6RA 1N2CE 3WRYC 2IXGA 1GKUB 5LB2A 3DOFA 1XZQA 2VTKA 3WP1B 3DKPA 1F5NA 1R7RA 4Z1MD 2OUKA 4M2LA 4GL2A 3FYHA 2DY1A 4B76A 1P9WA 3C15C 2ATVA 4NMMA 1GNPA 3EIQA 1UDXA 2C04A 2IUSA 2WV9A 4Q1EA 3B7GA 1GP2A 4KITB 2QT0A 2Y8EA 5FH9A 1OFUX 3EA5A 3GLHA 3BWDD 2XB2A 4XVUA 4ESHA 4W5HA 1EFRD 2MSCB 2OCBA 2PCJA 2IUUA 3UG6A 3NG1A 2ZE5A 4A8JC 3K70D 1AQUA 3RSOA 2G1KA 2ASEA 2ZREA 3QPUA 4KAXA 4WVFA 4LJ9A 4BFWA 2H57A 1T5LA 3CR7A 4TT3D 5AJWA 1GZSA 1E3MA 4UJ5A 3QENA 1E1QD 3ZYCA 1T8UA 3OHMA 1YZQA 1ZINA 4PPQA 2VHJA 1T3LA 4HI0E 3VR1A 4GDFA 4M1KA 2F3RA 4R2IA 2VHQA 3U3JA 1VCIA 4DSNA 2FA9A 4K8OA 5AWFC 1TUEA 3QKSA 5IDVA 1Z83A 1U8YA 3TE6A 3EPKA 5KU1A 3U3MA 2XOKA 1ODFA 4Q1FA 3D8BA 2BC9A 4FCVA 1KDRA 1RIFA 1W4CA 3IIMA 4DCSA 3PG5A 1ZJ6A 3QXSA 2IYVA 3R8FA 1EFHA 4A82A 3I5YA 1G3RA 4US2R 4PO8A 5FR2A 1E6CA 3AVYA 3QF7A 4L8GA 3CWZA 3LLUA 3TKLA 1U98A 4FN5A 3A4NA 2WZQA 2BJWA 4HAVA 4MKGA 1QG2A 2ZYUX 5DNYB 3ZVNA 4AYTA 4DHEA 5E7IA 3FVQA 3MD0A 4Q7MB 5JCZA 3NWJA 1H8EA 3TIFA 4DIEA 4DUGD 5BYKA 2ZS9A 3SOPA 3P32A 1ZNWA 4NP6A 2ZU6A 3TSWA 4UNRA 4YMUA 3SJAA 1D2MA 3VNUA 4B3GA 3AP2A 4JVNA 1SXJC 5CYPA 4F92B 1UBFA 3EW9A 3I72A 4M9XA 5CDFA 3W6NA 2BCJQ 3LA6A 3T5GA 1X86B 4TYYA 4LGMA 1CRQA 3IPYA 1LNZA 4OHYA 2GBLC 4LYAA 2XTMA 2AXPA 3D7MA 3TAUA 1G20E 2I3BA 3WHKA 2QL6A 2FH5B 4CYMA 1QHHB 4ZDKA 4I1VA 5IK2D 4DB2A 1KKMA 4GBMA 3KQNA 4PQYA 2ZJZA 3K53A 1KO8A 5KNBA 4PO1A 4GZLA 4P3YA 1NN1A 1OFHA 1GM5A 3AQ4A 4LHZA 3BE4A 2HV8A 1P60A 1T3HA 2WHXA 3P20A 2BHRA 4HLUC 4DDVA 1JNYA 1IM2A 4XIGS 2W2XA 5BQ5A 2O8CB 2JASA 2IS2A 4ACAA 2O8FA 1WMSA 3WYFA 3I1FA 2ZPTX 4JLPA 2A9KA 3F8TA 4DLSA 2QENA 1XJCA 5H70A 1IBRA 4QBHA 4ITRC 4PQRA 1TL7C 3OE7A 4LK2A 3U7GA 2PT7A 4CF7A 2YC2C 3QBTA 4W5JA 1AZTA 3R9XA 3KUCA 1IXZA 3I8XA 4D0GA 5JJIA 1FX0B 4II7A 2IA5A 4XWAA 1UBEA 1SKQA 5A0FA 3CR8A 4MUBA 4UNSA 3M6AA 1KYIA 5FBQB 2CHGA 4EJSA 3OIVA 5FTJA 4G5OA 3RC8A 2ZRFA 4LWZA 2O8CA 4ZKEA 4L15A 1N6LA 5SZJA 2W0SA 2QMHA 1TU3A 1JPNA 1G8GA 1COWA 1KJYA 1WF3A 4AD8A 2OBNA 3GLHE 4MH0R 3FOZA 3GJ0A 5DHFA 2H18A 1TPZA 2ZTSA 5KPDA 5JWOA 3KB1A 1C4OA 1NMYA 4POAA 1D2EA 2ZRIA 4IVRA 5J40A 2P6NA 4XSHA 4BEBA 4LV6A 1XEWX 5LBIA 3QPVA 4F38A 3A1UA 5FBRB 2WKRA 2Q21A 2CVFA 3IIKA 2J7PA 5KNCA 1OT3A 1QG4A 2J9RA 3KTAA 3U44B 1GOTA 4BLOA 2TMKA 2JLUA 3U61B 1U8ZA 4EJSB 4YXWD 3AVXA 3DEFA 1AM4D 4NZYA 4B34A 3GLFE 4WBSA 2O5VA 1DG3A 1QHIA 2QMUA 2CE2X 2ZJ5A 4PAQA 3SJBA 1LV7A 3FB4A 4EQ6A 3W5JA 1FMLA 1GDDA 1EFRA 1XF9A 221PA 3S1AA 3LVRE 2JDIA 2FE4A 1F6BA 1NKTA 4OBEA 1G3MA 2DB3A 1VHLA 5BN4A 3NBYC 3OEHA 3I4LA 1ZMXA 2V7QD 2QZ4A 2QI9C 1J8YF 1YVDA 1IQPA 1ZYUA 2WAYA 3MUFA 1COWD 2RGBA 3QG1A 4NH0A 4TTPA 4JZKA 3N70A 4OHVA 4O3MA 2OBMA 2P0EA 2ZRLA 3TQCA 4B3XA 2AKYA 3PV0A 2JJ8A 1XTIA 4YMWA 3B5JA 3B60A 2IHYA 2QG6A 3AKYA 2R6AA 3NVAA 4DDTA 2YWEA 4KJZA 4HB3A 2F43A 3C5HA 3LH5A 5AUPB 3UPUA 2P5TB 3ND8A 4Q02A 4PHGA 3BS4A 1VCNA 2W6JA 1I2DA 1FQJA 1N0WA 3SEAA 2ZRHA 2PMKA 1E4YA 2VSOA 5L3RA 2CK3D 1E2DA 3K0SA 2AWNA 4BWYA 1AQYA 2BMJA 2BEKA 4P4UA 3QSYA 1OJLA 3B1YA 1II8A 1C9KA 3KUDA 4MGIR 3MWKA 3KDSE 5EZ5A 4DCVA 4ZCLA 1MO3A 2D2EA 3CF0A 3O47A 4HLDA 4DUGA 1U0HC 2BIFA 1NVVR 1Z6GA 4IRUB 4YC7A 3BC1A 3LBIA 1XJQA 3GP8A 1XTRA 4P33A 2RB4A 2CL7X 3EPLA 1N25A 3NEYA 4NYJR 2HF8A 3NC0C 4ACBA 1GL6A 2ZRCA 4RY2A 4A2WA 4IFEA 1JXMA 2VA8A 4NHOA 1YRAA 5CK5A 3SFVA 3AEZA 4BRWA 2JA1A 4Q9KA 5AUQA 2HDNB 2J3EA 3A37A 3HR7A 3K0EA 4JLOA 4Q9IA 2Z4RA 1NJGA 4GOXA 4MA4A 4ZCIA 1L4UA 2D3WA 3H1TA 3KFXA 2CHVA 1JALA 5DH9A 4YQFA 2OAQ1 1QHSA 2GXAA 1RRPA 1XNJA 2PX0A 3WMGA 2IHBA 2BBOA 1FTNA 1F2UA 3F0TA 3VX4A 4FI3C 2ANCA 3LW8A 2RGGA 2IS1A 2QGNA 4PC6A 4Q18A 1PUIA 1XCGB 3LDAA 8OHMA 1SQ5A 3ADDA 2O0HA 2GXUA 3L8YA 4KYIB 2JCSA 4M0LA 3RYTC 2AX4A 2GAAA 5CLLA 4J0QA 4LX0A 1XTJA 3SC3A 1G16A 1VDZA 3SHWA 1FL9A 1O3YA 1KI7A 1I4DD 4JL5A 4QC2A 4WW0A 5JS8A 4M1MA 4KLNA 5LPNA 4XWOA 1J8MF 5A5GA 3RS7A 5K8TA 2ZM5A 1OXSC 1W36D 2BCGY 4PHTA 3MRSA 2PLFA 1UKVY 1SZPA 1Z28A 3KJHA 4Z1MA 2YV5A 4LYHA 1CXZA 4OQLA 3GD7A 4BLRA 3W6OA 1GIAA 2Q6TA 3T1VA 4JBXA 1Q22A 1Z06A 2Q9CA 1VHTA 2YWFA 1OB5A 1VECA 1SVKA 4Q1CA 4DXAA 1P2VA 2C9OA 2YC4C 3B9PA 2IXEA 4HB4A 4TQAA 4O2RA 2B7BA 4BASA 3DMDA 1UBCA 2DCUA 5G53C 1YE8A 2BMFA 1RFLA 1RKBA 2FGKA 1E9SA 4D2IA 3HR8A 3RSLA 1ZC3A 2CLSA 1J90A 5AJXA 2GK7A 5F3WB 1G21E 2VP2A 1E2MA 5CB8A 3DDCA 1YZNA 3OIYA 4KODA 4M9SA 4FMBB 4Q9LA 4ABYA 2QU8A 5C1BA 1GITA 1F3OA 4QHTA 1S8FA 3PUXA 4PPFA 3K0AB 4TN1A 1MH1A 5E7MA 1W2GA 3PUVA 4DZZA 1OXXK 4PZLA 1ZNYA 5TMPA 1S2MA 4C0AC 1OYWA 1S1MA 1Z2CA 2D62A 1US8B 3AUXA 3IQXA 3TW4A 1G8PA 2ZSEA 5FBVB 2NZ8A 4HAYA 5FTKA 2ZJ2A 4XD7D 1G7RA 2QAGC 2J0VA 3AVOA 4UXJA 1E0KA 2QP9X 2WJIA 1KMHB 1Z0JA 4L5BA 1SKYE 2F7SA 2WKPA 3C14C 3CLVA 4AKIA 1A4RA 1HH4A 2V1UA 2ECKA 2V55B 4Q4AB 3VR4A 1J7KA 4EKDA 4B3FX 4E07A 2JLQA 4MKIA 3ICQB 3LX5A 4XWKA 5TXGA 3GJ6A 3QVUA 4B44A 1GKIA 4DCTA 2QQ0A 4DEXA 1XD8A 1H8ED 1XTSA 1HT1E 3NHAA 2XJ4A 3K0CA 3U3KA 1F48A 1OXTA 3I8SA 4C0QC 4NCKA 1G5PA 1NJFA 4D81A 4US0R 1H8HD 2A7QA 4GMXA 3SR0A 4A36A 2HCJB 3QEJA 4OQFA 4U02A 5TVKA 5E7JA 4AIIA 1QF9A 1XDBA 4ZV4A 3BB1A 1ETUA 2GNOA 3PXGA 1NL3A 5F2EA 5KDOA 1OF1A 1XX6A 2G6BA 3OIWA 1VCOA 2RGNA 3AB3A 3CX7A 3GJ5A 4TL7A 4RFSB 4WZ6A 5FBWB 4JYCA 1RE0A 4O0MA 1HQCA 3T12A 4TYNA 4OHXA 4V0ME 2FFHA 3T1QA 4TSFA 5CB6A 4NCIA 1G5RA 3GEHA 3W5IA 4A2QA 2P3SA 3DO6A 1XCPA 5CJ2A 4ZCMA 1NP6A 4KFRA 1IOZA 4RKFA 4HATA
chains in the Genus database with same CATH superfamily
1HKHA 4GLFA 4S1WA 2CBGA 4FZRA 1T9HA 2FR8C 3R0IA 4WJZA 3SZLA 3SIXA 3HUUA 4L57A 4YGXB 3B13B 3NBAA 4M6WA 1TQ2A 3UF0A 3ZGNA 1Y33E 3OFVA 2ZJOA 2P67A 4NV0A 1TLLA 4PX2A 4RXTA 1I94B 4BXOB 3AEUA 3IHLA 4X95A 3BMOB 5EWJB 2YJ3A 2W2LA 3T4PA 4BCCA 4PGGA 1MFZA 2DR0A 2FYTA 2W6PA 4TYWA 4Y2JA 3IJPA 4L9SA 1XHLA 3MUNA 3RRZA 3ZDQA 3H84A 2CHUA 3UAZA 2I2WA 4M0MA 1PJSA 1GGMA 1QQ6A 3CF6R 4XD2A 2ZUSA 1JE0A 2IIQA 4E1AA 2AJCA 4M38A 4TX1A 2O7RA 2FAXA 4JKIA 2QLNA 2EGGA 4MRNA 1TJPB 4DQKA 2GCIA 3HJFA 1U94A 1OWLA 2A5YB 1JHUA 3LWDA 3G0IA 1G291 1ZZEA 3NIWA 5DASA 5ER6A 2Y0PA 2Q6LA 4AJ1A 4QPPA 5BY2A 4LDZA 2GEJA 3DBIA 3Q72A 3GMTA 1SBYA 2Z5GA 4DWVA 1QF6A 4PZZA 4Y7DA 1RZRA 1HY3A 4ZI3A 3QHQA 4BKOA 3S8MA 3Q6IA 1N3BA 1E2HA 1JQ5A 2IQIA 3A70A 4NSNA 1R3DA 1CFJA 1DBVO 4E5MA 4IILA 1N6OA 2J7PD 1U3TA 2KW5A 4I4TA 3QKTA 2YVAA 2QEQA 2Z83A 4URHA 5DYIA 5AOAA 5KSPA 5HQ3A 5JSFA 1L7OA 3G68A 1SVOA 3DOJA 1Z22A 4BNIA 2B8JA 2VJCA 4F06A 2FPMA 4IFIA 2UUCB 5IAEA 1NT4A 4I3HA 5LFAA 3E9DA 2AI3A 5AVUA 3ZDYB 5IULC 1Z8DA 1W8DA 4WKCA 3V55A 1WCWA 1IHUA 3BXXA 4UCQA 1ZITA 4FHCA 3SYLA 1WPQA 4DNPA 2NN3C 2WM9B 3EC1A 3MJ4A 1QLHA 4CUJA 1QUFA 3SGLA 4NU0A 4GI5A 1P7WA 2OO7A 4C14A 1C0IA 2PGOA 4XUCA 1ZU5A 3AIOA 3IYLW 5EIBC 4ZTUB 3ZIDA 2ZEJA 1J42A 1PIWA 1DCFA 3RWBA 4K9PA 5BNTA 4FCWA 3S55A 3BZWA 2G82A 4TXLA 2B99A 2CKMA 1U3VA 1VOTA 1Y5LA 2VJPA 4LJ7A 1JAIA 1IY1A 1H69A 2G9VA 4EO7A 3O82A 2ZJ1A 3U4HA 4TV9F 5SZIA 1CQJB 1J9EA 4KRGA 5F23A 1VGQA 3F73A 4U5XA 1PF7E 2YJ5A 1G19A 4HOYA 5FWYB 4K6GA 4H7PA 4HLUA 3FPBA 4TQGA 4YFYA 3AUAA 4EJ0A 1V3TA 1JDNA 2JHPA 1DQYA 5JLAA 1OFTA 4BGEA 2BKAA 2E9SA 4LMAA 3UXEA 2JFFA 1ID8A 1YQWA 4FLMA 1X7YB 3FKSD 4HRAA 4JBYA 5DBHX 1H0KA 3FMIA 4I1RA 2CNDA 2C97A 3F67A 4I81A 2VQFB 3TZ6A 4LFBB 3I52A 4KXQA 4X7RA 5E6SA 2QY9A 5T57A 3U39A 2D6FA 4V0KA 3OAAD 9ABPA 5EN4A 5DBEX 2HDHA 3ROZA 3KQSA 2ZJ8A 4KGZA 2V6FA 5BYBA 2NO6A 1GPAA 2BDTA 4HQNA 4PX3A 3AB8A 4CLRA 3QLTA 2BKUA 4KLZA 1ISIA 2AFVA 3L0IB 3U3DA 1S9HA 4DBZA 1FK8A 3HQ4O 4CM9A 3H17A 5LXTF 2D2FA 2OHGA 3CKMA 2FZ4A 3K3PA 4BMCA 4DCUA 5DDIP 2JIZA 2ZI3A 4PHHA 4RA6B 4Y2HA 2FFAA 4M8LA 1HT3A 4R2KA 4ZU1X 2B3TA 2XSZA 1NBHA 2LTAA 3WLEA 2CXXA 2EWVA 1U8TA 1N8KA 5B1IA 5C4IA 4ASUA 1JNXX 3KJGA 3FCAA 3LIIA 4ZQIA 3PKIA 1RXSA 3V48A 4LG1A 3GYBA 4ZMSA 2JFWA 4D96A 4NBUA 4C7BA 2HNKA 3S8EA 5IJ9A 3JD1A 3BUSA 4M99A 2Z6UA 4C2TA 1X2BA 5A0VA 1K98A 3ZBTA 1K6IA 2VZ0A 1E7SA 3GNLA 5C81A 3U7FB 3UV3A 2KB0A 4RPLA 2C9BA 1F4VA 4AZ3B 4XE5A 4DQLA 3J7AC 1N0UA 4NE2A 3RUCA 2KPOA 2E2WA 4NCNA 1YKSA 5BSMA 4S2EA 2E89A 2QN3A 5I7WA 2VWGA 5K6TA 3HEAA 2IUEA 2RGYA 3R3ZA 2C9YA 4IP0A 1QG6A 3G7SA 4AP5A 4EYEA 1EX9A 2Z5LA 5DSTA 3DZGA 2KSQA 3OMXA 3TFWA 4N7BA 4DSAA 4O02B 2FHSA 4MINA 2NU8B 2XRMA 3IOYA 1NMEA 1OFIA 4C03A 1W59A 2JFYA 4U6QA 1QRSA 1MBZA 2NZUG 3WGYA 2P9YA 3JQGB 1NNUA 5E9QA 4UHCA 1RXCA 1GPBA 2NU9A 4Y98A 4OHUA 2IVZA 5LNK6 1A9ZA 1W6RA 3KIPA 3STTA 3WRYA 4EX6A 4XGKA 3TYXA 2YQ5A 4EB3A 2Q3FA 3G0DA 3L1KA 1EK0A 4F8JA 3GLFB 4P6VF 2RH5A 2JAQA 2VAXA 1P73A 5F77A 5CDYA 5JAIA 3CVWA 4ZT4A 4YP0A 4KBFA 1I0ZA 4A6XA 2HF2A 4HC4A 4JKYA 4E4YA 4KNPA 2GASA 2ZUVA 4OYHA 3TNJA 3THYB 1T1EA 4BQRA 1EVZA 4QUEA 5KEIA 5K2MA 1VZ2A 5CRIA 1QSGA 3WTBA 5AI8A 2CF5A 1K1EA 1NW6A 3D4IA 1XLVA 3SYMA 4DXDA 4CFZA 3A3OA 3EPRA 1YRYE 3HJGA 1FB5A 4O8ZA 5ITZA 4KE7A 2IEGA 3JQBC 1JL3A 3EDMA 3ES9A 3VR6D 1A9SA 4B3JA 2HMVA 1UKBA 3OA0A 4GPBA 3WYEA 3PX2A 3QGMA 1D9XA 5KYUB 1PVDA 3UV6A 4PRYA 4HYTA 1ZC4A 2VCHA 2IOQA 4HDNB 3VHRA 3FBGA 1G66A 4L0MA 4HAWA 2VH5R 3R7AA 1KEEB 1S02A 3VO9A 1ZUIA 3KPWA 2XCOA 4WN9B 4CDRA 5C5IA 1UDRA 2OCDA 4BE7B 1GTL1 1MTOA 2C77A 3G9ZA 1DMSA 3K09A 5IM4F 4INOA 4PBTA 1JR3E 3D3QA 3OC6A 1MW9X 1NURA 4MS3B 2AFHA 5GOZA 3DPSA 2OC9A 1ZU4A 2Q5HA 3C2QA 2UZ1A 3QWBA 2OZLA 4F46A 3W5CA 2X77A 3W1EA 4J4BA 4LZAA 8ADHA 3L8ZA 4UXIA 1HGXA 4UAJA 2AYXA 1EE2A 4GPAA 3KL4A 3ZCUA 1XXHB 1ZL0A 4XUGB 3IURA 3ZDBA 5IVDA 1AU9A 1YZHA 2VYVA 4YUAA 1W5SA 2YBDA 1P3Y1 1ML4A 3H5OA 5J63A 1I36A 1G0NA 1A76A 2ZJFA 1PZEA 1VG0B 3PHHA 4HDQB 4KK4A 2E85A 4XJXA 1BRTA 1OZFA 2BEUA 2I3AA 3OFND 5ALJA 3L7JA 1MO5A 1PZGA 1QFJA 3OKPA 5DNVA 3SX0A 2JGRA 1QTNA 4JDUA 4AJNA 1NI5A 2Z8YA 1ZDMA 2SCUA 4CR6A 3HYCA 1KJZA 4J0IA 3QWAA 2UYHA 4LYJA 1NN0A 5IT4A 1IXRC 2LZ0A 4I19A 3F46A 3GRFA 1PL8A 4G01B 3BGSA 4WCFC 2CWWA 2JVIA 2QJTA 1E6UA 1KSFX 3P9KA 4ND1A 4R3WA 5I7EA 5J47A 1SC6A 2LUOA 1I4TD 1IH8A 1SB8A 2HA6A 1FJGB 4P1ZA 4M46A 4PFKA 3NT4A 2ZJAA 1FPMA 3ZV6A 4WDQA 3L93A 4K0KB 3LAWA 4UVGA 3NRBA 4KTTE 4BB6A 3QELB 3KQMA 1C30A 1ZIPA 4D7AA 1IBCA 3HXTA 5E2BA 1RWPA 1YS1X 4FP9A 3SK0A 3U9LA 1CERA 3LQQA 3FTDA 4BMPB 2ZB8A 4CDNA 3NH6A 2GM5A 4WBNA 1ZVKA 5C8YA 4LYDA 4M0CA 2X15A 4YJ3B 2EQBA 4QLOA 1Y3BE 2A7XA 1BD4A 3NASA 1RVDA 2VK2A 4OJMX 2VPPA 2VDRB 4JMPA 3CURA 4W9MC 5DXAA 2XX3A 1YQUA 4GP6A 1J8VA 4C0HA 2WMDA 1G4HA 3RVKA 2IX3A 1KZYC 3L6EA 4OP3A 3AERB 2REQA 3DTVA 3QYAA 2JZOA 4GPTA 5BOSB 4LV5B 3J80A 4UNIA 4YRMA 1X1TA 1YE3A 1GNLA 1J2TA 1I6MA 5GP1A 4DGQA 3T1TA 1PJCA 2O9JA 1JW9B 2VRWA 1DJLA 5IP5A 1VMDA 2H1IA 1LTQA 1XAHA 2ZZNA 1RRGA 2HRDA 2W2QA 1H5UA 3EVCA 4AI6A 1T4GA 4L4ZA 2JFZA 1YH3A 4K26A 4PN3A 2BKEA 5IMSA 3NYWA 5DT9A 4C6TB 1VJTA 2PUWA 3QKRA 4D8TA 3U81A 5TV2A 3VO2A 4WFQA 1ZH8A 3AKCA 3GIDA 2PMCA 4TLCA 4TV8A 3BILA 3HYNA 3JYHA 1R12A 3BIOA 4W1SA 3VZBA 3IO5A 5U4QA 3EDOA 4LHYA 1JTEA 2YWGA 3WMEA 3P0RA 1EDDA 2OQ2A 4W5WA 5EQJB 3ETGA 1TO1E 3H5RA 1L5NA 3TQFA 3H9JA 1AV7A 1M73E 5BOVA 2X0FA 4BUCA 1G7SA 1YIOA 3T3EA 5IAAA 1AZSC 5E3JA 2OILA 3NBXX 4E94A 5AW2A 4RK1A 1CB7A 4Q1AA 3PZBA 1HRDA 5EAIA 4X64B 3PNKA 3TRRA 4Q9HA 3NTUA 3GOHA 1C0KA 1PG5A 1UJCA 3OFSA 3OIUA 4D3DA 5D5QA 2E21A 4Z86A 5CNJA 2WHPA 5K2OA 5C80A 1ZW6A 2WD7A 1U2EA 2NYVA 1KHHA 1UJNA 3IPLA 3LSYA 2HK8A 1NUHA 1NE2A 4PRKA 3WO1A 3QXCA 4WH0A 4C4AA 1XZGA 1J06A 3OLZA 2HGZA 1RJ9A 1FUEA 1X8JA 4GE0A 2JAOA 4IMJB 3ANSA 1JBEA 4IWNA 4PC7A 3W05A 3S1SA 3D3JA 4CEHB 4ZO9A 1TA9A 3K92A 3MILA 4EAQA 5EHNA 3W5VA 4K6KA 4XEUA 3IVMA 4PO3X 2YDYA 3KKEA 2EIHA 2RGRA 2PL1A 3ROPA 4JI7B 3WLKX 4LQDA 4MICA 5K3OA 5K05A 3I9FA 3L7DA 4R1UA 4ZREA 2ZGVA 1Q0SA 2VHWA 4KAAA 4ZODA 4K6FA 3UXYA 4TMKA 3BHJA 4IYRA 1PP4A 1GKLA 3BRWD 4MZXA 4OCZA 3ZNNA 3PLAE 1N2OA 1FNMA 5LBUA 3NU1A 4HQOA 2I4RA 3SE7A 2ZXFA 2AKEA 3CW8X 1QQAA 1C9MA 4N5IX 4GF5A 5FB3A 1QTRA 3IXLA 1YONA 1EY3A 5KSYA 3GLGB 2C7BA 3WDSA 3LRPA 4Y3UA 1UFVA 2LIPA 3PDIA 1HDOA 4H08A 3MG9A 5KWJA 1Q0HA 4O2BB 4DLAA 4YRFA 1WY5A 1Z25A 2XF2A 2XIJA 3UK1A 3I6IA 5KYXA 1Z18A 2WYUA 1L4FA 5JDCA 2QLBA 2PR2A 2YWXA 3Q85A 4GRIA 4WINA 2PX3A 3ELYA 2ZRGA 3NAGA 3NCTA 1TLFA 2IEAA 2IW3A 2MYUA 2TECE 2ZCVA 1NVUQ 1KY3A 1DFGA 1KPGA 1QHNA 3EFOB 4ZQEA 4V39A 3V8NA 1AUQA 5I01A 4RULA 1RRKA 1LW7A 4XZ3A 4CKBB 3RUFA 4A03A 1ZHOA 1ELOA 2WE7A 2FGJA 3EVBA 3GX1A 2WWGA 1N36B 2YR0A 1ADGA 4QTZA 5DVZA 1F0PA 3Q5EA 1H9CA 3QZUA 5M5BA 1FFGA 2NU7B 4IF4A 5BVGB 3JY6A 3MWEB 3OTHA 3QPDA 4K81B 3IIIA 3CZPA 4ZZ0A 4N5HX 1ENZA 3ENNA 1U1CA 5GZ1A 4WOCA 2IYOA 2EVWX 1IY2A 1F2TB 1ZWKA 2ZRKA 3KR0A 1UMCB 3VFDA 3W6PA 4MPTA 3ZU6A 3EMBA 1OMOA 1LQTA 2JGDA 3AM5A 4IBOA 1EMDA 3HKCB 4J0EA 1UFQA 3NTQA 1QYDA 2H52A 4XWYA 3TSYA 4I55A 1M76A 5EUCA 1N9GB 1M8GA 3FLBA 4MQFA 4G26A 1GZHB 1Y7HA 2AN3A 3AHJA 4PSKA 4WSOA 1VRCA 4ES6A 1Q5PA 1LJLA 2DTEA 5SV2A 3GA7A 3IDFA 3CRNA 1LUAA 2EL7A 2NUBA 2C54A 3PGJA 3E1SA 4IEIA 4AO7A 1UBSB 1L5ZA 3EOAI 1M6NA 1MG5A 2D0DA 4XYBA 5T8KA 4DDWA 4JL6A 1T0HB 2ZAIA 2E87A 4IQ0A 4C89A 1P7ZA 3CX3A 4FW9A 3T5CA 5AVOA 1NVEA 3G6KA 4PGFA 4LHWA 2P4SA 3NR2A 4JASB 1BXGB 4JJEA 4LQ4A 5J9FA 4MV5A 1SD1A 1W94A 3H2BA 2HQSA 5EIBD 5MDHA 1QBKC 1Z0KA 3G8DA 5GOTA 1HSZA 3CINA 3AW8A 3DCJA 3QTLA 2GCGA 4KSBA 4R1SA 5IYZB 2CFSA 2GLTA 1AMUA 4K3VA 5B53A 1NSTA 1L5HB 3VR3A 4N3AA 1B2RA 3R40A 3DOCA 1DX6A 1YOVA 5HCUA 2B36A 3OUZA 4JP3A 2J9FB 2NADA 1NQOA 2LKCA 3JYQA 2QDXA 4I1OA 4BO6A 2PGIA 4MARA 3VH2A 2GF2A 4E5DA 2R97A 2EFGA 5GVSA 4RORA 5DYGA 4BZZA 4JT4A 1Z5NA 1IXSB 1Y4ZA 2F3UA 3N5CA 4TWAA 4D5EA 2VYND 2W0MA 5A04A 5LWQA 2CK3A 3JVUA 4RCYA 1PT5A 2Q3JA 3OF3A 3WNVA 1I3KA 3A27A 1IQUA 3L07A 4JVSB 3CG4A 1KA9H 1WD5A 2P90A 4D3YA 2BOVA 1EJBA 1CR4A 2WF6A 3L92A 2RJ3A 4PFQA 1N5JA 4TTIA 4XASA 1MO6A 4EW2A 3P9ZA 3NHUA 3QJYA 1G6KA 2VJMB 3AF2A 4AWAA 4K1LA 2I4TA 1T8PA 3E35A 3WNZA 4J90A 2CLFB 3TGLA 4A5OA 2C2OA 4KK3A 1D7AA 1W5EA 2XITA 1G2QA 3UENA 4I7EA 5BR4A 2F43B 2O4CA 1VYVA 4FOOA 4JJZA 3SJZA 3QJGA 5AI5A 3PXDA 3NBMA 2EIXA 2X14A 3IXQA 4BLUA 5B30A 2QP4A 3RSGA 5KWEA 2JATA 3TJZA 5LXTA 1KSHA 3DHEA 3O6VA 3W3AA 3WBKA 3DL7A 1E6MA 2JFNA 2GJ8A 3THWA 5DF1A 3ZLUA 3C3KA 2XBUA 4XOIA 2PZLA 3DWFA 1VPTA 1PK7A 5HZKA 1R4AA 4N8DA 1YF3A 1BJKA 5B7PA 1II8B 1KOFA 1XTPA 1TYDE 3UMJA 3AF0A 3PPWA 4J0FA 1AN9A 2OY0A 1JWLA 3I2IA 4PX9A 3LUFA 1A7UA 3IV6A 4NJOA 5A1TA 4E32A 3DFZA 4YRZA 2N1MA 1GG5A 2ORIA 2PLNA 1C81A 1BXKA 3JQ6A 3UMRA 2ZYVX 1CUAA 3U48A 4B3HA 4F4DA 2IU3A 3EH1A 4EMTA 3NTOA 4FHGA 3LQ2A 4X8LA 3WLOA 3O8CA 2LDBA 3DMTC 3G8CA 1SVNA 2VEOA 3W34A 1EXNA 2EBWA 3CZAA 3HZOA 1Q77A 3L8HA 1QB7A 2FPXA 1GNQA 2BZSA 2JK1A 2RI1A 1TC1A 3AV0B 3MWLA 4U18A 1AGNA 1KC1A 4JJIA 2GN0A 3I6BA 3NHSA 5ERYA 4TL8A 2QN1A 5AKJA 3TI9A 4BFYA 1DTSA 1YBFA 3CN9A 4FYXA 4L8YA 5HZHA 3WYNA 1Y8CA 1QV9A 4U3JB 1SZJG 4WKPA 5IFKA 2BSQA 1SQFA 1BG6A 3K5PA 4MO9A 4BGIA 3NVKI 5KDLA 1WM1A 5HXAA 4DR2B 2Q1YA 4C29A 2FSVC 3UFXB 1VB5A 4UHDA 1TOAA 3T7EA 2FKNA 3T7CA 4ARIA 1MABB 2WJ4A 1E9FA 4O6VA 4E6PA 1U5AA 3MQ4A 2R7AA 4ND8B 3K6SA 4S1NA 1CUFA 4H3SA 1VKZA 3OEYA 3LMKA 1QDEA 3RT9A 2R4QA 4F6RA 3LXRA 4RDCA 3VDRA 2QG4A 2C82A 1TLTA 3FWKA 3M9LA 3M6LA 3PD0A 4IJ5A 1QHHA 3O8QA 4R7TA 5AK6A 1V11B 2JFBA 3M5PA 3ECSA 1P80A 4IFBA 3CZCA 1I9CA 3A3PA 5ALZA 3UHFA 5JXGA 2A78A 3STXA 4NBKA 4MUFA 3CO0S 4IS3A 2XBMA 4E5VA 3HTXA 3BN3A 3WXMA 1RAEA 3HH8A 4MR8B 1J5XA 4UMFA 1H0SA 4HS9A 3V4OA 4UFOA 2DQZA 1REQB 2B35A 2QM8A 3K2QA 4S1VA 1C5KA 4L8LA 4D26A 1NF9A 4S0XA 1RYFA 5CLIA 2HTFA 3PQ8A 1PK8A 2JLZA 3IAEA 2AIRA 1E5XA 2ZSHA 1DCKA 2Z8XA 3CGGA 1YR9A 1ZM2A 3ITNA 5DN6A 5C8XA 3EDRA 1V39A 5FDFA 4FB5A 3QU4A 3AR4A 4FZ5A 2PV7A 4Y8VA 2O50A 3A4TA 4ZARA 2LKDA 1UWVA 3RQEA 1WJGA 3ZWAA 3MLBA 4GWKA 3UJ3X 1G17A 5BN5B 3AIIA 1OLOA 2ERXA 1ID1A 2ZWIA 5AJUA 1V3UA 1WDKA 1JXOA 2H5EA 1NBMA 1QH0A 4MW7A 5EL0A 3FYTA 4P8RA 5ALNA 2FDRA 4W5OA 1LBTA 5BSVA 4Z99A 2JHFA 2IHUA 3V1LA 1ORRA 5AI4A 1NULA 4OLQA 1XXLA 2DLNA 1LVUA 2Q9AA 2VC2B 3R77A 1CY2A 1P3DA 2EP7A 2JLYA 4EY6A 3SMQA 4QIIA 1XALA 4EI9A 1PZNA 4RJIA 1CZUA 5EY5B 3T0FA 3WKBA 3WKEA 5FOTA 4RK0A 4CQMD 5I4KA 1A71A 2ODTX 5U9CA 1CT9A 1EFPA 1KK1A 4DSTA 2C7PA 1EBUA 3U40A 1WXWA 2XCLA 1NIJA 4QDXA 1KIFA 2CMDA 1OAOA 2QOEA 4FMCB 2OD2A 4YJHB 4ITUA 2YZMA 4GOKA 3U44A 1IBSA 3D31A 5GINE 1Z16A 3TOVA 3NYQA 4IEFB 3I62A 2I55A 3D9QX 3AHDA 1YJ8A 1AVTA 1GR0A 5GAJA 1T35A 3CHYA 3O8BA 3BA6A 2Y9PB 3VOTA 2IHTA 4XQEA 2OXIA 3NQ41 4BGUA 3IAAA 1O96B 1DC5A 3KELA 2GJKA 4TRMA 5FPHA 4YXWD 3LQ4A 4YV7A 2RMKA 2YWDA 3P4XA 1P2DA 1THGA 1P1RA 1PS8A 2HA3A 2J31A 3AJAA 3IVXA 3Q7IA 3QE2A 4AS2A 4C21A 3CM0A 3MB5A 1I3CA 4D3ZA 5DB4A 2X8AA 2FR0A 2OMKA 3G85A 4ZYVA 4M98A 1VIAA 3UGTA 4OBXA 1R0SA 2Q5JA 1RBYA 3A1EA 3C8DA 2VO1A 2DPYA 4Q4AA 3TQTA 1DEHA 1ZOLA 4RJKA 4RFVA 3PYMA 4QL3A 1U0BB 1TMOA 3IKLA 2HYIC 2YW2A 3O2QB 2RK3A 1W9HA 2AHOA 1RR6A 4X6YA 1XPUA 4K9LA 2Z2XA 4P0TA 1I2AA 3FKQA 4DCMA 1UPBA 4O59O 4XM1A 5G02A 3G5AA 1C0PA 2ORYA 2WABA 3ZZNA 1LW6E 2X4DA 4FDMA 4UUOA 3AVUA 3BORA 5EERA 4JXXA 1QFSA 3WQBA 2KLHA 3C85A 3KZMA 2D1SA 1HG1A 5E9WA 2I1LA 2VXYA 1J24A 2PWAA 1G4AE 1DG9A 1XZBA 2ZQYA 2ZRNA 3NALA 4AKHA 1YOBA 2C7GA 4MX8A 1C1XA 3G13A 5LQSA 4A26A 4D6XA 5JEEA 1F8YA 1VHQA 3AC0A 3PICA 4BOYA 5A6SB 1WU8A 2I7XA 2BY4A 2PX6A 3QJ5A 2R84A 2VWPA 3A6EA 3M9WA 4BLVA 1WBBA 3AVVA 1P0CA 4HKTA 4OMUA 1CSEE 4LZPA 1U0EA 1DQZA 1KI2A 3GAAA 1LH0A 2RGAA 2BFEB 3DONA 1CUDA 1UOQA 2Y2VA 2BFOA 3ECCA 1I1HA 4EQ6B 4EVIA 2IV7A 4FKMA 2GDJA 4JSTA 4WHMA 1XIVA 3O2JA 2CJYA 3DEJA 5IAJA 3DUFB 3HB9A 2OBFA 3N59A 1YDEA 4TKUA 4FIDA 3SWXA 1PHPA 1L7QA 4MMZB 2BKXA 3IEKA 1PGOA 5H81A 4DMHA 5FFNA 2HQOA 4DC9A 1QM5A 3FX2A 2F1HA 2J48A 3KWLA 5AMXA 2ICAA 5K6AC 4L1KA 5LA6A 3PEWA 2ZIGA 4JVMA 5GJVC 3S2SA 3CRW1 2NO5A 5IJAA 1ICIA 1NFRA 2B8EA 2NGRA 4DV6B 1Z0DA 2GRJA 2IYFA 2O54A 3VNVA 1WP4A 2QSUA 3DA8A 4UZEA 1KS9A 2PUBA 1TM4E 4DYHA 2YBEA 2Z0MA 2AYYA 3OJ0A 3P5BA 1A2KC 3HO6A 4XDZA 4K6MA 3ICEA 4TTQA 2RARA 1DRWA 1EBFA 2XTNA 3KKZA 1G0OA 2YNMD 1C14A 1TT7A 5J23A 1YZKA 4KDEA 5IBRA 2IGBA 2XKAA 4YA6A 3VDQA 1FRVA 2A8YA 2DGDA 1JVNA 4X62B 4P08A 1VYTA 1IRXA 1GO2A 4ZQCB 1BW9A 3SCZA 4OX9B 4LI3X 5EP1A 1J1UA 2WV7A 3AR3A 4AZTA 5LYJB 1LF5A 1PO7A 1DIHA 3C24A 1R9GA 2GTPA 3P0JA 4YAUA 2AG1A 1ODLA 1OI2A 3MPOA 5CGQB 1NOJA 3RJTA 4Q3BA 1SIBE 2PBPA 1UMDA 2H5LA 4I1UA 4CCWA 3BZBA 2QJOA 2WWRA 2IZ1A 4GEGA 1KR5A 5ILQA 3OKAA 2HLDA 3TNFA 1FCJA 2I29A 2JI7A 2ONJA 1XVIA 3OZ7A 2D0PB 1QH1B 1E62A 1TEXA 1YMVA 5MF6A 1MX9A 1RQLA 1YQ9A 5AIBA 4JJ4A 1PGNA 3TVTA 2ZSKA 2ZKIA 3L84A 4N65A 4L4SA 2C58A 5IBPA 5A5FA 1NG9A 2BGGA 3ICVA 5H5JA 2W71A 4DA4A 1XZEA 2B1RA 3QXXA 4CIWA 2VDJA 2W93A 4KNWA 1IMJA 1NGSA 2BFBA 4BVHA 3DFKA 4TS9A 4UZSA 2AVNA 4E2FA 4IZDA 1EGVB 1P0IA 4WN3A 2DWQA 3G8YA 1X19A 4QDZA 2RI0A 4EW1A 3FYCA 1R0KA 5IAOA 3F49S 2FBMA 5FAKA 2NO1A 4ZOAA 1VMKA 1NW9B 1EEHA 4FNGA 1QV6A 3OP1A 2AG0A 4I9NA 4YUVA 3EBOA 3ZH9B 4DPMA 2VNHA 2XY4A 2VT2A 5LZ9A 2WVGA 2EQAA 4F5ZA 1LPAB 3F5SA 1CR1A 1SOUA 4TZ6A 3Q3HA 5KHAA 1DCIA 3CUEF 3HA3A 4ZI7F 2QAGB 3K96A 1Q20A 2QUBA 1LS6A 3OF5A 4BMSA 3V7YA 5JFTA 5IAKA 2CJXA 1SQ0A 4TQ9A 4CMEA 5KX5B 2ZW9A 2W2KB 4RJLA 4OL0A 1IAQA 2OO5A 2WSBA 3PE6A 3WDMA 1H1LB 2BM8A 1HXHA 3R0XA 3AF4A 5A9RA 4BCBA 3L0OA 3A3KA 1BIFA 4I1YA 2JLVA 1F14A 1MDFA 3BF7A 4IGKA 3BRCA 2IYUA 2ID7A 3FOAA 1N0IA 1E96A 4FD2A 2XMPA 1IFXA 1CEYA 3H4TA 1QU2A 1Z5GA 1KEPA 2GPNA 1GZUA 2XCQA 2ZVJA 2Q50A 4EZEA 3FE2A 1YV9A 4DJ5X 2WB4A 1FFYA 2XZLA 5IJ0B 4TLMB 2YJ4A 4EVRA 3GLRA 2ZS8A 3D8HA 2RAVA 4KO8A 3EA4A 3IEIA 3TLBA 2ZITA 5J59A 5E38A 5EMJA 2O8BB 4L3OA 4DAOA 4DV7B 3OMLA 4FFDA 4LOKA 3SBXA 2DULA 4IKEA 5CW1A 4TXJA 4I0WB 3L7CA 1FDTA 4LMBA 3UH1A 2WTAA 1RQ7A 1SQSA 2CDCA 2HA0A 1NY6A 4L9WA 1Y5NA 5HG0A 4LKOA 5C1IA 2RH9B 3GLSA 1BROA 1FRZA 2FUKA 2FWJA 3QEMA 5IVIA 4EO4A 5JYDA 4UOEA 3E9QA 4WXMA 1CLEA 1M83A 3FVTA 4BFZA 3HWWA 5FUVA 4GSYA 1DOAA 5CPBA 3TOZA 3DDOA 1GG9A 4G1UC 1TCAA 1AXEA 1RWMA 1SKBA 4PZAA 1DKOA 4MRMB 4DAEA 1EQUA 4YWJA 3V7NA 2EKLA 3BGOS 2P77A 1D4OA 2Q62A 4FJ1A 4Q66C 2QKYA 3CBGA 5D85A 3AHHA 3RF6A 1MPTA 3C39A 1DBQA 3RDPA 1U2QA 3GR6A 1JFTA 2OD9A 2ZQ5A 1E2UA 1RE1A 2W4QA 5B2FA 4EHLA 3RM3A 2R44A 1Z3CA 4MRPA 2GXSA 1XA3A 3CONA 5K0FA 5BUZA 4YBZA 2X4LA 2X5JO 4CNBA 4AX8A 4MRAA 1W85A 4KHZA 5EXXA 4KGXA 1U7OA 3WGZA 1LFDB 5C8DA 4MYHA 5I48A 1KYYA 3TAHA 3IDOA 5GGYA 3KU4A 2C4KA 1AKNA 2FLVA 5K8IA 1KNXA 2QMOA 2XYPA 3FUCA 3EGWA 3R9TA 2QPOA 5JI2E 1H8HA 1HE2A 1G8HA 3O4VA 1E63A 2X5NA 2OV3A 3C3BA 3IPAA 3O9VA 2AQ8A 3RJ5A 1HE1C 1TVEA 2EG9A 5D7NA 5CIQA 2WYIA 2ZIAA 4BLSA 1GTRA 3O3MB 2GD1O 1EAYA 1YU9A 2NSYA 2QGFA 2NO9A 5FCDA 2PWZA 2O05A 3CA8A 3U17A 1GNVA 2IOYA 2Q0XA 2ATIA 2QTLA 2H7XA 3AM4A 5TY0A 3JXEA 3WL6A 2OBYA 2F67A 4HLCA 1H5QA 1E0JA 4PYKA 1CDEA 4BEWA 5M7EA 4XYGA 1N5OX 3E05A 3B3JA 2Z43A 1ZIDA 2Y27A 5B7NA 3GAFA 2EZTA 1CVLA 4D92A 1DAIA 3NT2A 2O7SA 4INZA 3OOJA 2XTZA 4IDCA 2ZJ6A 3GG2A 2VAMA 4RHYA 2X0JA 4DMCA 2N0SA 1NFQA 1SELA 5IASA 1ONNA 3DL2A 3ONDA 3JAWA 4BJ6A 2QGZA 1UINA 1E9VA 1QYRA 4LGVA 4N3NA 4ND7A 1WQ3A 3ZHUA 4CDGA 5K0BA 1BWPA 1QQ5A 3DKKA 4JEMA 1EFLA 2JFQA 4EUSA 3W9SA 1BFUA 3QV1A 1B6GA 4HNUA 4QSMA 3X2SA 2DZDA 2PKCA 1NLZA 1GAWA 2AFRA 3AIKA 1JPVA 4QJIA 5DP1A 1L1FA 2FFJA 1T1SA 3Q87B 1QIHA 1T34A 3C3MA 4JI6B 2Y2UA 4AQ7A 3SOPA 2G9UA 1URPA 1NU6A 1OTHA 2VR1A 3ADPA 3E3MA 3KOMA 3DLTA 3JSXA 4Q03A 3V1TC 1PQWA 1NRJB 2A58A 4EBBA 1XYGA 5BXQC 4P0PB 4ZAVA 3HZZA 3SZRA 5JDIA 2PT6A 2FUNB 4AF6A 2D1QA 4K46A 4GGMX 1NX9A 3SOZA 1JLMA 1XJWA 5C51B 3W7VA 4Z53A 4HAXA 3A4IA 4PEVA 1OBHA 3EYWA 3W2HA 5E8JA 4WOKA 3T3GA 2EZ8A 3AR8A 3HPQA 2BKVA 2ZYTX 1GU1A 4MW6A 3WQHA 1QHXA 3PITA 1NW8A 1WUIS 2HRCA 1XRRA 1EB8A 1BOOA 4QYIA 3NKFA 3CVVA 1QKKA 4JB0A 4BBJA 4RKQA 3BULA 2P68A 3D7RA 4DRXA 3T3NA 3TPZA 5TE9A 1Y5MA 4PXYA 1Z2AA 1APBA 1BE6A 4QHYA 3T06B 2R87A 3MJEA 2VQSA 1E5LA 2YV4A 1JDZA 3PR1A 1WTCA 3QY9A 4MRRA 5DCLA 5J1TB 2W70A 3HSKA 1N78A 5KQRA 1JX6A 2E4XA 3GMIA 4B31A 3DZFA 1DDGA 3LS2A 3S28A 2NYUA 3NKVA 4EENA 1ZXLA 1SCUB 1F3LA 4R9SA 2QD3A 4V03A 3RU3A 4BNZA 3WI7A 3ZE2B 5KVVA 1JPJA 1YQTA 5LMCA 1QJCA 3UICA 3MWGA 2DF8A 1ZIYA 1V2HE 5C18A 4QFMA 1UXKA 3RK0A 2B0JA 3F9IA 3L04A 5K0EA 4S24A 3SPXA 2CMKA 1Q21A 3CWQA 3D81A 1G8MA 3JATA 2QJFA 4C5AA 3PCRB 1PR0A 4M1TA 2FWNA 2ZROA 1ZK3A 2ZSUA 1CUIA 3IUMA 5CM9C 5EWMB 3RJMA 4RVNA 2PKYX 4LKRA 2P65A 1DBIA 2ZTLA 3O5AA 2XDWA 2D5LA 3BGWA 2X9VA 4OI4A 2VTBB 3W5AA 2C1XA 2Q4DA 1JZTA 2C31A 1DPFA 1EA5A 1P74A 4ZAZA 5FAXA 2POCA 4D80A 5CFQA 5KBYA 2ACKA 1UADA 3FBTA 3NIFB 1E5TA 4Q93A 1SFRA 2VIIA 4XYMA 3W7BA 3T5AA 1WOYA 1YBMA 5FA8A 3K1AA 3OOHA 1W46A 3E15A 3ZH2A 1NC3A 1P1CA 2XNJA 4LYEA 1YS4A 3HUDA 3L7BA 3PE4A 4W6QA 3TCKA 2Q29A 3P9QA 3GLFA 3O31A 5HM6A 4KPFC 3X0DA 1KARA 5JCOC 2EFHB 3BXEA 2F6QA 3GJ3A 1JQLB 8MHTA 2M9MA 3DAHA 2Z5FA 3D0QA 3V3TA 5EP2A 2EXXA 1T3TA 1PUJA 4RH3A 2PZFA 4M1YA 4IOLA 5DNCA 3EIUA 3I01A 4B2LA 1ULBA 4XDGA 2DQ4A 3V4PB 1GKYA 1I24A 4KGVA 4MLCA 4C04A 5DYTA 1LU9A 3ZWXA 4DJTA 7MDHA 3KR1A 3UYLA 2O2GA 1VM6A 3CUKA 4EHIA 1WCIA 2ZCJA 1TMYA 1G5FA 3JVVA 4FX2A 3MWYW 1OB2A 5BMVA 3TOXA 1JIXA 3JQ8B 4TLDA 4X20A 3A6HA 4IDFA 1SVUA 1NLYA 5DK4A 4JA0A 5F5NA 3ZLTA 4D43A 3STUA 3NHYA 1WLYA 3WJ7A 4FJWD 5EZSA 5E4JA 1S8OA 2ETVA 3S2IA 4QM6A 2C92A 2P4QA 3ON5A 2FP4A 4N3CA 2W6ID 3HKEA 1JQKA 4GI2A 4WA8A 3UMVA 4EPTA 1NPDA 4QICA 5JQGA 3CEAA 2CXPA 1OWPA 5DWQA 5IUNC 2DR2A 4OL9A 2P6MA 1N2JA 3IMGA 1TYBE 4J75A 3BICA 4P5DA 4EGQA 4Q19A 4MV7A 4X1IA 4Q3CA 2J3LA 2JZCA 3E82A 5DI9A 3M7IA 3QKUA 5HK8A 3OCJA 5SZHB 8AT1A 1HE8B 3FKSA 4RGQA 1PEYA 4J1TA 5FPYA 4LF7B 2CXUA 3RC2A 1DXOA 3RRYA 1GFWA 4G5RA 3T1HB 1XDSA 2PPLA 1JRLA 5KNLA 1EBBA 1PDOA 3ETJA 1U7PA 1A9XA 4Y9RA 4WKBA 2EBUA 3IAM6 1CHNA 4HUQB 3FGZA 4U7FA 2UZ0A 1E2QA 2WTNA 4G9BA 4AF8A 5JTUA 4R16A 3LP6A 4ZVMA 3QG5A 1DUSA 1V1JA 2IT1