The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
87
|
sequence length |
250
|
structure length |
246
|
Chain Sequence |
b'HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb |
molecule keywords |
L-seryl-tRNA(Sec) kinase
|
source organism |
Methanocaldococcus jannaschii
|
molecule tags |
Transferase/rna
|
total genus |
87
|
structure length |
246
|
sequence length |
250
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase. |
pdb deposition date | 2010-01-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08433 | KTI12 | Chromatin associated protein KTI12 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |