3ADCA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
246
Chain Sequence
HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 87
structure length 246
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3adcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adcA01
4I1SA 4CDGA 3SYKA 1E2MA 2VSOA 4LY6A 1IJFA 4KXFB 4HEJA 2Q9BA 1MABB 5HPYB 3KXLA 3NBFA 3SJAA 1VYUA 4Q4JA 4BPBA 4OHYA 5E3HA 1A2KC 4M9QA 1N6HA 3W3ZB 1JEEA 2IW3A 4B32A 3V00A 4WZAE 1Z0DA 2A9KA 3SHFA 4OQMA 2IYXA 2WWHA 4M1OA 4WW0A 1WA5A 1G16A 1TL7C 3C4JA 4HZIA 3VHXA 4OQXA 3SQXA 2RGNC 1OB5A 3T15A 2F55A 5G41A 3VMFA 3U7GA 2P2LA 1S3GA 4KVAA 4PO9A 1KSFX 3DEFA 4JJZA 3I92A 2ZAOA 4ZDKA 3LQRA 5KPJA 1II9A 4DSUA 1XD2B 3DOFA 1PV4A 4L15A 4BASA 4AG5A 3UWKA 2BEKA 4RKFA 4JLVA 5FPYA 2XTMA 1DG3A 3QUSA 4JLNA 2C9YA 4OL0A 4JSTA 2AWOA 4ACAA 4UNRA 2FJUA 2VSFA 2GA8A 1TQ2A 2ZXUA 1XMVA 4I1OA 3M1IA 4HATA 4N1AA 3BIFA 1OJLA 3FHOA 3GPLA 2H7VA 4ESHA 2YWGA 2IYUA 2C98A 3OIVA 1QVAA 4BFSA 1NSFA 2FFQA 2GF9A 4RSGA 5FUWA 5EQTA 3EZ6A 2VHJA 1OW3B 4O0MA 4F4IA 3U44A 3ADDA 4D4LA 1K5DA 2E9SA 2W0MA 3AB3A 3FKSA 3W5IA 1AM4D 3Q8XB 2XSZA 2H8KA 2ZYUX 5FTNA 4JVSB 5CJ2A 3J81k 1SXJB 5FI1B 4BFVA 3OF5A 2HT6A 3IQXA 4Q4HA 2ZJZA 4U7DA 5DYGA 2J59A 2B7BA 3QEOA 3QIAA 2B8TA 3U3RA 1JXMA 2CLDX 1EWQA 3ZVMA 2GXAA 3RABA 2ZETA 2C77A 2IXFA 2EU8A 1VECA 1W0KA 3SS8A 1T4GA 1U0HC 1P6XA 3TR0A 4Q1BA 1RYHA 2HXYA 2IS4A 1F5NA 1Z6AA 3D7MA 5FL7D 1VDZA 3QPWA 1COWA 4A15A 3AVWA 1JEDA 4P0TA 3Q3JB 1ZNYA 2IK8A 2OCAA 2PX0A 3CRRA 4B34A 4DWJA 1E79D 4WXPA 1NF3A 1ZD9A 2D2EA 2ZVQX 2ZRPA 3I73A 1AZTA 1HQCA 4NYMR 4AC9A 3LLUA 4U5XA 4EQ6A 2XZOA 1Q1BA 3MCAA 2CMKA 3U61B 2IWHA 4G01B 1L7VC 3M0EA 4A6XA 3WNCA 1Z8FA 3EPJA 1FP6A 5G3YA 2F1HA 1DAGA 1G8PA 2DHRA 2A5FA 2GXSA 4CIDA 2GCOA 1FNNA 1XZQA 4Q1EA 4Q18A 1Q1EA 3ZD6A 3FTQA 2H16A 5FBQB 4CVNA 4DLVA 5FH9A 1CJKC 2QT0A 3RS2A 2JLWA 2VRWA 1U2RA 1OKKD 5DO9A 2XGJA 1D6JA 2ZRAA 2PMKA 3GEEA 3NBYC 4MA4A 4BRUA 1M2OB 4UXJA 1NLFA 5D3QA 4O3MA 5EZ5A 1GSIA 1TU4A 3RSLA 5EE0A 5JEDA 4MGYR 4IXMA 3ZDQA 2WTUA 1HV8A 2WJVA 2PLFA 2ZI9A 1KI8A 3R8CA 2ZSFA 5BYKA 3U3JA 1WCV1 1FNMA 1ZM9A 2ZROA 2FNAA 3WY9A 4MDEA 2SHKA 2Q9AA 1NY6A 1TUEA 3A1VA 2ZRHA 3N2EA 3R9XA 3TVDA 4A9AA 5KHOC 3PEVA 2GK7A 1FX0B 3H2YA 3K9GA 4GPTA 2PZGA 4PAQA 4PSVA 5DI9A 5J4KA 1CTQA 1OFTA 3WYAA 3X1WA 2JDID 1NMYA 4KSBA 2AK2A 4W9MC 1N5LA 2CVHA 2XOKD 4KAXA 4O25A 4TT3D 2WV9A 3UATA 3Q85A 1E9RA 1A7JA 1ZU4A 3KTAB 4YMWA 2XNDD 1CEEA 3MJHA 2X2FA 3QJYA 4NHOA 1HEIA 2GXUA 3Q72A 3OAAA 1NVVQ 3SYLA 3C14C 3HPQA 1W5SA 2NTYC 2NO7A 4UXHA 1DADA 1KSJA 1X1RA 2KBFA 1H8EA 3TUJC 1E9CA 1WRBA 3U4QA 1KTVA 2PBRA 2PT7A 1U99A 1IN7A 2C9OA 2WOOA 2WJYA 3ASZA 4WVFA 3R20A 2X77A 2UVQA 1S4QA 4UJ3A 1B23P 1V43A 5TXGA 3REFA 4RD0A 4QHTA 1N3BA 3MWJA 1Z06A 1LTQA 3F3YA 1MO4A 2Q3MA 1XP8A 4HUQB 3V9PA 1KMHA 3THWA 3FMFA 4B3CA 1TX4B 1OFIA 2XJ4A 4QHYA 3HU2A 3BRWD 3CB4A 3Q7PA 3K0SA 4ZPXA 5DI3A 2ZREA 2FSIA 2ZRJA 1IQPA 2BCGY 2ORWA 2OEPA 4LHXA 4URXR 3RS4A 1XF9A 2HJGA 3DZDA 5DNYB 1HA3A 1M6NA 1VG9B 4A82A 2ZJBA 1GL7A 3FDIA 3X1XA 3E5HA 5EE3A 4ACBA 5KNBA 3PEUA 2IA5A 2QAJA 1UKVY 2QZ4A 4TMZA 1GILA 4JVMA 4PTLA 2PJRA 2W2TA 3HDTA 5EE5B 2YWEA 4YQFA 2IYQA 1HH4A 3B78A 1Z0FA 1P73A 2GVDC 4TYNA 2B8WA 1OF1A 3K0CA 4MITA 1N0WA 1L2TA 3BE4A 2QN6A 1RPZA 2J0QA 5A0FA 2H17A 4JLBA 2F9MA 4B6FA 3QKUA 1MT0A 5DHAA 2ZM5A 5FOTA 2PEZA 4LHVA 2BBOA 1XCGB 4KYIB 3O8BA 2PX3A 3ETLA 2XAUA 3UG7A 2VHTA 1G7SA 3OIUA 1KK0A 1VG8A 2AFIE 2ZI5A 4RVCA 3A8TA 1LF0A 3IBYA 2QMHA 4XVUA 4URYR 1CIPA 1D9ZA 2IF2A 4CRWB 2BMJA 1P7CA 3FPAA 2O8EB 2F6RA 3KJIA 3EPLA 4XH9B 1G291 2N42A 2REBA 5BWMA 2AD1A 4DC9A 3OIWA 3M4YA 3OEHD 4A8JB 3GLFA 2AWNA 2AKYA 4US2R 3D3QA 1AS0A 2QP9X 5CJPA 1W7AA 1T8UA 2VQSA 1N25A 1G7RA 3D8BA 4PXAA 3DMNA 3CF6R 1E2PA 3QKTA 3KUDA 4B76A 2NMVA 2QI9C 3HU3A 2DFLA 2W0SA 4LK2A 1RC8A 4D6PA 4HDCA 1WBDA 1KJZA 3KB2A 1OH6A 1P5ZB 1GOTA 1E9SA 1VYTA 5EXPA 2R6AA 1ANKA 4HZUB 121PA 1W36B 3CF0A 4Y0AA 1QF9A 2ZRGA 3TNFA 1P61B 5CDFA 1DBSA 2Q3FA 5D3MA 2HT1A 2RGCA 4DCSA 1F48A 1BYUA 4AWXA 1E4YA 5FUYA 1KI4A 2O8CB 2W2XA 1P9RA 1KI1A 4JLJA 3SNHA 2QPAA 1XJCA 4L8GA 4EFLA 4OBEA 2QROA 3NTUA 4MQBA 3PEYA 4LSGA 4OQLA 2ATVA 3AKEA 1NVUQ 3F0TA 3ADBA 2N1BA 4PC1A 4JJKA 3I61A 4JYCA 4ZI2A 3SU8A 2IYWA 2DFNA 3NEJA 5K8IA 2OT3B 1UDWA 4HAVA 5K8TA 4CT5A 4HB4A 3THYA 2XXAB 3CWQA 4OJQA 1ZYUA 4WXRA 2NZJA 2D7DA 4LJ5A 2FF7A 1QG2A 1T5LA 4RD3A 2IXGA 3W90A 1KSGA 4R2HA 3GJ7A 2CBZA 2KWIA 3O8RA 1KY2A 1VHTA 3DMDA 5FUVA 3B1ZA 5LD2B 2R6GA 2C96A 2VF7A 2ZPTX 1UDXA 2QRZA 3OZXA 4DUGD 3C41J 1YR8A 4FMDB 3FOZA 1NN0A 2OV2A 2AX4A 3EIHA 5DYIA 4F93B 1QHHB 1W4RA 2YJTD 4II7A 2XITA 1P2TA 3DM9B 3MRSA 4LBWA 4TTPA 4DLWA 2WJJA 3WXMA 4JLMA 2DY1A 1Z22A 2Z43A 3TIFA 3NH9A 4LUCA 5EP3A 3L82B 2HJVA 1GKIA 1QBKC 2PL3A 4NCJA 3GLFE 5DLQC 3ZLJA 4Z1MD 2ZI7A 2GBLA 1OIXA 4IXNA 1GKYA 1SVWA 4M9ZA 4XWOA 2FZLA 4U00A 3CF2A 2HLDA 3CX6A 2IWRA 2ZQ5A 1NN5A 2FV8A 3T34A 1E96A 5KSOA 2NIPA 1C4OA 2OE2A 3AF4A 2F7SA 5AUQA 4YMVA 5JHGB 1NG1A 4ZO4A 4HB0A 4EPRA 2MMGA 2C5LA 2J0UB 2OBLA 4KVGA 4Q9JA 4KBGA 1XCMA 1XFAA 4UNPA 5DN6A 3S1AA 3PENA 4JLDA 2V1XA 5CDFE 5JLJA 1BMFD 3K0AB 1YZGA 1XEWY 4TL8A 3VTKA 2H5EA 1S0UA 1OV4A 2GCPA 3IQWA 2I3BA 1RRGA 2GAOA 3GJ3A 1EX7A 2BC9A 2CLCX 4IOKA 4M1TA 3SHWA 4AKHA 2PJZA 4KODA 4OK3A 1CKEA 1KAOA 2WSMA 2WPDD 3AF0A 2YINC 3CZPA 4B2PA 2MMCA 3I5YA 2G1JA 1XU4A 2WZQA 4MKHA 5HE9A 3CPEA 3TW4A 1ZMXA 2ZAMA 3CIOA 3K9HA 4ZKEA 2Q3HA 4MH0R 3OIYA 2A5DA 2RGGA 2JJ1D 4PANA 3RVBA 2W6IA 3ZQ6A 3FWYA 3G82C 4LYHA 4F4JA 1CXZA 1IAQA 1X3SA 5KNCA 1KI3A 1OFUX 1HYQA 2QAGC 4M1KA 2J41A 4NPHA 1E9BA 3D31A 3WRXC 2D3WA 2IBMA 1IXRC 4NYMQ 4LC0A 3QG1A 1MABA 2V55B 4EUNA 5JCPA 2BKEA 2WAYA 4N0DA 1NIPA 3RS7A 4LJ8A 2W00A 3FYHA 3HYTA 3LLMA 2BBWA 3UMFA 4J0QA 2ZI4A 1Q1QA 4H9GA 4KLNA 2QGNA 4MUBA 1Z0AA 1UM8A 2IS1A 1GRNA 2R8RA 3R8FA 4Q1CA 3GEHA 3ZZTA 5JS7A 2JJ2D 1U9IC 4G0NA 1RVDA 2QMOA 5CK4A 3SQWA 1CR4A 3T1TA 1GL9B 2EFEB 4LX0A 2BKUA 2VP0A 4YLGA 1N5KA 4AG6A 2XB2A 1R10A 1SKQA 2G0NA 5JJLA 1XD2A 1DAEA 1FQJA 2AN9A 2ZJAA 3QEJA 4LRWA 4A2WA 4ZV4A 1R0YA 2P6NA 4PHFA 4QXAA 3CH5A 2HF9A 4BWYA 2ZRNA 4D0NA 2XEXA 1U0JA 4HDQB 3AP1A 1N6OA 2EFCB 2QORA 5CK5A 3LXRA 3OEEA 4FCTA 1AQYA 2ZUDA 1AKYA 1ZP6A 1YRAA 1YR9A 4L4UA 3IDQA 2ODEA 4ZDJA 2BBSA 1LNZA 1X1SA 2RB4A 2YOFA 4QBHA 1KO8A 4R71A 1GAJA 3RLFA 1V5WA 3CR7A 3EXAA 2WBLC 2WKQA 3EZ9A 3K70D 4C7OB 2QPTA 4TYYA 1KDTA 1NBME 3A1UA 3SJCA 4DB4A 4ZIRB 2ZE5A 4OI2A 4TYWA 1NL3A 3K0EA 2OM2A 1KSHA 1EFUA 1YKSA 2FG5A 1CRPA 2QM8A 1ZNZA 4L9WA 1SXJA 2I1QA 3BH7A 4AYTA 1W4CA 2FSGA 2OZEA 2EQBA 1IN4A 1G3QA 4Q5IA 3U7FB 3B82A 4GP7A 2IUUA 1W1WA 1W49A 2JCSA 3AVOA 2ORIA 4GOKA 3RRNA 3QQ5A 1SVIA 3KKQA 1DO0A 4IVQA 1TTTA 4TLAA 2CCGA 4B75A 2WWYA 5KTYA 3BJIC 4QBGB 1Z5ZA 1NN3A 3B5JA 3VHLB 1NP6A 3MFYA 4MYTA 2BJVA 4F91B 1GKUB 5KNDA 3KZ1E 1NMZA 3EA5A 4WZ6A 4EPYA 1I4TD 1MR3F 4Q4AB 1W0KD 1G1MA 1E0JA 1I4DD 1TEXA 4F7WA 1HTWA 4DLTA 1COWD 2CEAA 2V6JA 1XD8A 1N5JA 1YVDA 2GESA 2O0KA 2VF8A 2YYZA 2OLKA 4A92A 2CHQA 2AK3A 2ZEJA 4IW3B 5KDLA 4XD7D 4POAA 5FPTA 1E1RD 4IFBA 4Q00A 4TLBA 2WIBA 2DPXA 3NH6A 2QL6A 4KJZA 4KITB 4D0LB 3ZQJA 1TF5A 2ZE8A 1N6PA 3AKDA 4K8OA 4M1MA 4BFTA 2DBYA 4P4UA 4RD6A 5M04A 3GP8A 1XCPA 1CR2A 3GLIB 2WSSD 4M53A 4KO8A 2FSHA 2UZIR 1XTJA 1IJEA 1N5IA 4IHQA 3AF3A 3SFVA 4H1UA 1KYIA 1L8QA 2W6JD 2HYDA 5J5CA 1RE0A 4YMUA 4D80A 1G7CA 1XXHB 3IO5A 1P62B 1NIJA 2J7KA 1DTSA 1FQKA 1Q21A 3TSOA 5AWFC 4KFSA 2VHUA 4HB2A 3BB3A 1FX0A 2GHIA 3SBDA 1SXJE 5FBRB 3UANA 1CLUA 2MSEB 3OE7A 3TQFA 2WKPA 3RYTC 2RHMA 2YC2C 1JR3A 4RZ3A 1R0WA 1SULA 3MWYW 5SZHB 3H86A 4RFSB 3U6BA 4M21A 2RHDA 1P2SA 3PCRB 3TK1A 4DEYA 2HV8A 3KTAA 2JIZA 4MKGA 3ECCA 5TVKA 2VP6A 1W36C 4ILEA 4S35A 1P60A 3EPKA 3P20A 3DM5A 1W0JA 1MO3A 1NN1A 2GTPA 4QM6A 1OT3A 1KJYA 5TB5A 5B58C 4B2LA 3B1VA 3TUZC 4LJAA 1KNXA 2XTZA 3JZAA 1E4VA 2QP4A 2QTHA 2EYUA 3IGFA 4JBXA 4HUQA 2VPPA 4Q4LA 3WMFA 1H8ED 2E1RA 2ODBA 4F92B 2HF8A 3PFIA 4MRPA 1EFCA 2NGRA 1KNQA 4TL9A 5GJBA 3RS5A 5BXQC 1E98A 1FUUA 2A5GA 3E1SA 1GP2A 3FMIA 3A4MA 4URWR 4QNMA 6Q21A 3LBHA 2O8BB 3I3SR 2ZRLA 2OAQ1 2QQEA 4V0NA 3B8HA 4U02A 3BBPA 4YXWA 4CYMA 1E6CA 1N6NA 1OXUA 4FWTA 3ZS8A 4DDUA 3TAHA 5KPDA 2REOA 2F3RA 1ZNXA 2Z6VA 2ZYTX 3ZZ0A 5JI3E 3GJ5A 1E2EA 1SKYB 5CB8A 4DRZA 1XJQA 5JZVA 3MAAC 2JAQA 3W5JA 4B43A 4D81A 1JR6A 3CBQA 2QBYB 2WHXA 1ESMA 2F3TA 2OSBA 3CNOA 4KLZA 5FUXA 3MMPA 5JMTA 4QJ4A 4KFRA 3ZYCA 2IC5A 3KL4A 3LVRE 1GIAA 1LVGA 1M7BA 1YZLA 4IDOA 1Q1ZA 5JEEA 4IRUB 1S2MA 2P5SA 4URZR 1JR3E 2BMDA 1L4YA 2ZSAA 4BFZA 3L0SA 1KDOA 4GNKA 2O8EA 2ZITA 1VCMA 1CR0A 3QVUA 4PC2A 3VAAA 4AIIA 1BS1A 3GLHB 1VTKA 3TMKA 4NYJR 1T91A 1G6HA 3VQTA 4A8JA 3RRMA 3MLEA 3QXHA 5EP4A 3KFXA 4A4DA 4Q9IA 1RJ9B 3THXB 4NKRA 5LPNA 1KZGB 5E7JA 2F1IA 2ZANA 1P9NA 2JA1A 4JLPA 3SZRA 3B2EA 4QGHA 3ASYA 2CL0X 1GNQA 1KAGA 2V3CC 2ANCA 3L8YA 2YOGA 1T3SA 4URVR 2YC4C 3AEZA 2OLJA 1OH7A 3FE2A 4HZUA 2G1KA 2IUTA 1WP9A 5FBLB 1NKSA 1ZIPA 2NG1A 1CBUA 1AGPA 2CL7X 2IYZA 2WWXA 4LI0A 1KDRA 4BFYA 5BW8A 1FP7A 4TMKA 3LO5A 4AKGA 2O8CA 4RD4A 4JT2A 4M0LA 1AN0A 1CRQA 5KDOA 2BBTA 4K81B 3WMEA 3AVPA 2F9LA 3DPUA 3LBIA 2QUZA 1TQDA 4ASUD 2IYRA 1ZM3A 3IIJA 3I1FA 3K0CC 3CH4B 5EP1A 4YMSA 2ERXA 1QVRA 4X8MA 1SHZA 2XXAA 2PCJA 3BD9A 4ABYA 2R62A 2OBMA 2D7CA 1RZ3A 3BWDD 4M9SA 2X8AA 1QHGA 4CEHB 4Q7KA 1OLOA 4QRHA 5ELXA 1VG1A 2DWOA 2R9VA 4Q7JB 3C15C 4L9SA 1KMQA 2XB4A 3NHAA 1TPZA 2CJWB 3T1OA 5DH9A 1VPLA 1MRNA 1OHHA 1QHHA 5J4VA 2AXPA 2QM7A 2GDJA 5HTKA 2WAXA 4C4PA 5FTKA 3RANA 1OH5A 1ZCAA 2P65A 1B0UA 3IPYA 1E2DA 3ZH9B 1GNPA 2NPFA 3Q9LA 2VA8A 4CEIB 3A36A 4L5BA 2HDNB 1T3HA 2ZVPX 4R98A 5J4HA 4EPWA 3AV0B 1JPJA 5AK0A 1R4AA 1KI7A 2V8OA 1Z0KA 4N0EA 4RD2A 3SYNA 3DDCA 2BJWA 3LVQE 1WDTA 5B57C 5LB4A 2QE7A 3QG5A 2CK3D 4NCKA 3PJRA 2J9RA 4F4CA 1E1QD 1W48A 3A58B 2WOJA 4TYPA 1H8HA 3L0OA 2CNWA 4HSEA 1Z2AA 3B7GA 2LKCA 2J0UA 5JFGA 1IN8A 3WYFA 1CF4A 4JZKA 2ODWA 3AKCA 2RGBA 3WNDA 1EG7A 1WF3A 3K0AA 821PA 1AS2A 2G83A 5FPHA 4JVNA 4V0LA 3NC1C 3IKJA 2O8FB 4D4KA 2LWIA 4LC1A 2B6HA 2R6DA 4G5SA 3AVXA 4PSKA 3LDAA 1CS4C 1FTNA 2ERYA 2ZI3A 4NZYA 5LB2A 5IF9A 1EFRD 1I2MA 3BAFA 4GZMA 2AFHE 3BB1A 4HLQB 2RKOA 3T1QA 1GVNB 1NNEA 4RFVA 2HCBA 4P3YA 3G0HA 2D62A 4QBIA 2DWPA 3RRYA 1NBMD 1U81A 1CULC 4QC2A 2H1LA 4FCVA 2CVFA 3FHCB 4XSGA 4LDJA 2Q0HA 4XWAA 4IEIA 3NKVA 3EX7C 2NQ2C 2A78A 4BE7B 1BO6A 2JLVA 2OESA 3V4FA 1OH8A 3LNCA 4M1YA 2YOHA 2PLRA 1DAIA 2IT1A 2GK6A 4OKSA 3QE0A 1ZC3A 3AQ4A 5B2ZA 3WHLA 3FHTA 1G64A 3KKOA 3I8XA 1QHSA 1II8B 1IXSB 1X86B 2ZI6A 4EPVA 2C78A 2C03A 3MUFA 3AVYA 2ZRIA 2IL1A 1TNDA 3MSXA 3UG6A 2V4ZA 1F6BA 2J45A 1XEXB 4LGMA 4TQAA 4DIEA 4FI3C 4TMWA 1MKYA 4C0JA 4JL6A 1DAHA 5C46F 5FL3A 5G53C 1HE1C 2QEQA 1AQUA 1OSNA 1T0JB 2IEZA 4AK9A 5HKKD 2GBLC 1EFHA 3AUYA 1W5TA 1TQ4A 2KBEA 4K46A 3GFPA 1J2JA 1NJFA 1VMAA 3VKGA 1E2FA 3KXKA 1ZU5A 3TE6A 1F60A 3DO6A 2IHYA 2BM1A 3LXXA 4KU4A 3ICEA 3SEAA 3UK6A 5KSPA 2QPOA 4B48A 1J90A 3K70B 4YMTA 4YDSA 2G0TA 1G9XA 2A2ZA 4HDOB 3P32A 3WHKA 4DDWA 4Q48A 1EESA 3EAQA 4C9BA 2A30A 3ZGXA 3NBZC 4KFUA 5J4LA 3EARA 4TL7A 1E0KA 2VTKA 3I4LA 4EJSB 3QXJA 1NI3A 4JBYA 1U0LA 3FMOB 4C7OA 3AVQA 5FOVA 4ZIRA 5CM9C 1YZQA 1DG1G 3KKNA 1EK0A 5L3QB 1XMSA 3PUYA 3WRYC 1CU1A 3W6PA 4A2QA 3MJRA 1JPNA 1KOFA 4PAOA 621PA 1AJEA 3FB4A 2I4IA 4LHWA 5FR2A 4EDHA 3A1WA 1IY1A 4IOMA 3H4MA 2IHBA 3TGPA 1CR1A 2GJKA 2DFTA 2ZYWX 1UAAA 3X1YA 4GL2A 1TEVA 2W58A 2ZJ8A 4I1UA 1R0ZA 5JSZB 1XX6A 3EZ2A 4Z54A 4HAYA 2HEIA 2ZJ2A 1E79A 4LBVA 4PQRA 5L3RA 3GJXC 4DDVA 2BEJA 1DO2A 2FMXA 1HT1E 4UQOA 3BFVA 2FPLA 1D2MA 3P4XA 1DEKA 4DVGA 2IYYA 2BCJQ 4NL4H 1I4LD 1O3YA 1AIPA 4Q4AA 3MGCA 3FGNA 5KO2A 4MKFA 1GWNA 2Q21A 4TLCA 4IVRA 4C0HA 3B13B 1PLKA 2HCJB 1G5TA 4IDQA 1OKKA 1X8KA 5H1YA 4A0GA 5FPKA 721PA 5AUNB 1PZNA 2YV5A 4DCTA 1R2QA 2ZSBA 1ONBA 3AGPA 3RSOA 1E3MA 3EC1A 4RCYA 1AS3A 5JI2E 4IVPA 3PVSA 1R5BA 1KO4A 1YU9A 1U98A 4B71A 1N6IA 1NSTA 5J47A 3GLIA 1IM2A 1W4BA 4OHXA 1P2VA 2B21A 1Z28A 5CLQA 3ZIAD 4A36A 1ZRHA 2EW1A 3BORA 2BMFA 1JQJC 5CIQA 3VKWA 2VEDA 2GVZC 2FFAA 2WIAA 3IILA 4DHEA 1Z3IX 2QU8A 3ZVRA 4OQFA 1XXHA 2O52A 3DOEA 3ZVNA 4AI6A 1Z6GA 2XOKA 3T61A 4TT3A 1XTIA 3LQQA 3T35A 521PA 2OXRA 3AP3A 2BV3A 3TH5A 4A1FA 4DZZA 1AKEA 1SXJC 2XNDA 4N3NA 4OK6A 1ETUA 1Q3HA 3HPRA 3QVVA 5SZIA 4NYJQ 2YZ2A 4DLUA 1R0XA 4CEJB 1VCIA 4RFSA 3IEVA 3FFBA 4TSFA 2HXSA 5J4YA 3RWOA 1KY3A 1OIWA 4LBZA 4PSAA 1AA9A 2FEMA 4GI7A 2QTVB 2FE4A 3K53A 2VP2A 4IFEA 3ICQB 4PZLA 1F2TB 3KQHA 2JIZD 2EFDB 3EPHA 4CT4B 4FMCF 4PHHA 1D2EA 2CLSA 1KK1A 2E87A 5CITA 3RC3A 3P27A 2JLRA 3PG5A 4S2EA 1W0JD 3KQLA 2ASEA 1OIVA 3PXGA 2NO0A 3AVVA 3HR8A 3I5XA 1E2QA 4DBLC 4BLRA 2KI5A 2YKGA 4DEXA 4MRRA 1S9DA 1P2UA 3CKLA 4JLAA 4RY2A 1G3UA 5JWOA 2ZRCA 4LPKA 4FINA 3IPXA 2A7QA 3QNUA 2O8BA 1EWRA 3MWLA 4MRVA 4D2IA 5G3ZA 2VL7A 2ANBA 4TLDA 2UKDA 4DT1B 4ZDIA 5KOYA 4G5GA 2O8DB 5FFMA 2J0SA 1OB2A 1SHKA 3I8SA 3SFZA 5H70A 2JLXA 2QMUA 2C99A 2OFOA 3CM0A 1XJ0A 2ECKA 4KCGA 5C1BA 2FFBA 3NXSA 5A4JA 1WQ1R 1YRBA 4TWZA 1FPMA 4OI0A 4NCIA 1RKBA 2HYIC 4DIDA 1EXMA 4Z8XA 2EVWX 2ZRDA 2X1VA 4UNNA 4G3XA 1E0SA 1GDDA 5CYPA 1XXHE 5F9HA 3CWZA 4W5JA 2QBYA 3RNLA 4E22A 2IEYA 4M9XA 4MYHA 4C2TA 3NDBB 2BM0A 3OHMA 4QM7A 5HZKA 4YDHB 4BRWA 1N6RA 2J87A 3LY5A 3IO3A 1TU3A 4E07A 5CLLA 2OCBA 1G8HA 1LY1A 3QKRB 3OEHA 4I1VA 4X8HA 2HUPA 1Y63A 3BXZA 5JS8A 4GT1A 4P4SB 4HAZA 3RHFA 3UMRA 5HCIA 1G5RA 1ZD1A 3JVUA 3B85A 1FW6A 3GLHA 5BN4A 3QF4B 2AKAB 1RRPA 2R65A 2FOLA 2IX3A 4EFNA 4EPXA 4ZCMA 2NO6A 2PZEA 4IEEA 1RJ9A 2F43B 2P67A 3THXA 4CZ2A 4QOSA 2IXEA 4RCZA 2ZR7A 4MGZR 1Z0JA 2GJ9A 1YR7A 1KI9A 4G5RA 2ZU0C 4XIGS 4PZZA 2WWFA 3EIQA 3FKSD 1L4UA 2EWVA 2IYLD 2ODNA 2XSZD 2JLSA 1YZNA 2GNOA 2VHQA 2RH5A 1OYYA 2H18A 3R9WA 1R7RA 2CE7A 2FPKA 4OHWA 3U6KA 3K09A 2WWWA 3LRPA 3NIBA 4TN1A 1C9KA 2P0EA 4PX9A 1E2JA 2Z0MA 2GZAA 2NZ8A 2EFGA 3VR3A 2VIIA 4LPSA 4DLSA 1JECA 1U8ZA 3VX3A 2P6UA 1W36D 1ZW6A 2YWFA 1UKZA 1G6OA 2VO1A 3DKVA 3OFNA 1XMIA 1DAKA 1G3MA 1XRJA 1G7TA 4LV5B 4P4TA 3EA0A 1J70A 1VG0B 2FU5C 4XVRA 1HUQA 3TKLA 4B6EA 5IT5A 4X8OA 3UWOA 1WBBA 4NCNA 2ZJYA 3BH0A 1Z6YA 4JLOA 3O47A 1SKYE 5DHFA 4UXIA 4Q9LA 1Q57A 2BWJA 5GVSA 3GLGB 1E2IA 3CX7A 4DUGA 5EXXA 1MO5A 2C04A 2J7PA 3MD0A 3AH8A 3SI7A 1OE0A 1Q3TA 3T06B 2B7CA 2W2VA 4CEHA 2JLUA 2AL7A 2QENA 2JASA 1MO6A 1XD9A 2VBCA 5P21A 4M1WA 2R6FA 3DZ8A 3U7HB 4MRNA 1E2HA 1ZM4A 4ESVA 1M34E 1DS6A 3VNVA 3I72A 2Q6TA 4CF7A 2CJWA 3CPJB 3B9QA 2Q9CA 3QF7A 4LV8B 1LFDB 2ZYVX 1S8FA 3RWMB 4B47A 4Z1MA 1G19A 1DAFA 1ZC4A 2ZE7A 4HLDA 4DLYA 3GLHE 1AZSC 3IIMA 5JJIA 2FA9A 1XPUA 2ZSEA 4CEIA 4A8JC 1LS1A 3F5FA 1NVXQ 1E94E 3UPUA 2D74A 1K5GA 3FMPB 4Z8YA 3TVTA 2FGKA 4HAUA 3RAPR 2VHCA 1XDBA 3GMTA 2FDCA 2WJHA 4B3GA 4US1R 1ZD8A 1BMFA 2BIFA 8OHMA 3U7EB 4UNSA 4PPGA 4GRAA 3NBXX 2FZ4A 3H84A 4F38A 2QTFA 3AVTA 1SVSA 4HLCA 4O2RA 3QXXA 1FMLA 2OFWA 1JBKA 4RKEA 4URUR 3BERA 4HLUA 2L0XA 4RZUA 3HP1A 1R6BX 2WPDA 3C5CA 4WIAA 3P26A 4IDHA 4QBFA 5UKDA 3VX4A 4AKIA 2O8FA 3ONWA 1H8HD 4PFSA 3TSWA 4TZ0A 2CNWD 4JL8A 4MGKR 3OAAD 2VLIA 5EUQB 4YONB 2JJ1A 4OHVA 4QGFA 4TMVA 4GZLA 2QY9A 1IHUA 4LCBA 3U3KA 2OFXA 1J7KA 2CXXA 1P4SA 2C8VA 2ZS7A 2QG6A 1W4AA 1F2UB 4QL3A 5FOUA 2WMOB 2JLZA 1IOZA 5IK2A 1KO5A 3LW8A 1IXZA 4ZCIA 1QDEA 3RRZA 1G4UR 1P9WA 3CLVA 1G8YA 3LX8A 4D26A 2IS2A 1JI0A 4Q47A 1VCOA 3X1ZA 5TV2A 4AD8A 3TAUA 5AJXA 4WAUA 4WOPA 1QHXA 3VU9B 1R8SA 2RGEA 3HYRA 3IEUA 5LD2C 1G5PA 2ZR0A 3SR0A 4DKXA 5IHPA 3ZD7A 1II8A 3CZQA 3ZJYA 1OXSC 2QP3A 2JLQA 5KDDA 2JJ2A 3UKDA 4GSYA 4LBYA 4OI4A 5IRCD 4C0QC 1XEXA 2FEOA 4YC7A 4DCUA 2C2HA 3F8TA 1XTSA 1Z07A 2GETA 1XTKA 4JT4A 4R7ZA 5H68A 2BMEA 4JIMA 3BGWA 2A5YB 4V0MA 4JS0A 3QKSB 3K0FB 1XPRA 5BQ5A 1H65A 1DAMA 1JAHA 3LV8A 1Z47A 2EFHB 3AF1A 2PCLA 3SDZA 5E95A 4ARZB 1Q20A 5JWHA 1X8LA 2KSQA 1YZKA 2OXCA 4CW7A 1XTQA 4LHYA 1GM5A 1Q0UA 2F1JA 1UBCA 1W47A 4HAXA 1FUKA 5CIWA 3AUXA 2JATA 4TTQA 4FD2A 1FFHA 4BLOA 4JBWA 5FBWB 1KDPA 3AKYA 1KI6B 1J8YF 2NOAA 3WYGA 2A3RA 4JKYA 2AR7A 1GNRA 4G5OA 4H1VA 2PT5A 4I99A 4FCWA 3LH5A 1Z83A 1G41A 2DCUA 3B1WA 1BKDR 1QG4A 4EJSA 3U5ZB 5DGXA 2QQ0A 4BZQA 2ZS8A 3CUEF 3KQUA 1MV5A 2ZU6A 1RW4A 3EWSA 4PR0A 3WBKA 1RRCA 4QNRA 3QPUA 3R7WB 2GAAA 2QGZA 4C30A 5L3QA 4QJ3A 3L8ZA 1CJMA 1ZBDA 2R2AA 4W7SA 3LBNA 1OFHA 2ZUCA 3GFTA 3UMSA 5L3SB 1DELA 1OPXA 4E5UA 4OK5A 1II0A 3VR1A 1US8B 1JJ7A 3BFXA 4JLKA 4XWKA 1T9HA 4GOJA 2UZ3A 5JSZA 2CHGA 4Q03A 2VSXA 3PEWA 1E0AA 5FTMA 1EGAA 3BH6A 3GFOA 4NU0A 5IDVA 1U94A 2D4HA 2WKRA 1KO7A 5JBQA 2R44A 3Q5EA 4E09A 1OXXK 2GILA 1W2GA 4R2IA 1IBRA 1P3JA 2G3YA 2EWWA 2ZRFA 1N0UA 2OCPA 3E70C 1WMSA 2REXB 1S96A 3KXIA 4DSNA 1ZM7A 2GF0A 1T3LA 4V0OA 3NEYA 3SN6A 3RDPA 1KI2A 1MH1A 4XD7A 5CM8B 4DCNA 2AXNA 4XSHA 1E1RA 3EG5A 4JVLA 5TARA 1FL9A 3IBGA 3PUWA 1IN5A 1E9EA 1OYWA 3BS4A 2G88A 2O5VA 4NBSA 4B3FX 4M8NE 2QAGB 4BLPA 4I4LA 3THOA 2V6IA 4JSYA 1XWIA 4V0ME 2ZRBA 4I81A 3LW7A 2ZE6A 4KHZA 1J8MF 2BHRA 4WZBE 4JYBA 4QKQA 4FN5A 2WSSA 4XTRA 3W8RA 2OAP1 3KQNA 2W83A 1NLYA 4HB3A 3PQCA 3T5DA 5KSYA 1GRRA 2GRJA 1Z08A 2PH1A 1ZINA 2WM9B 2YWHA 2GJ8A 2W6JA 3AM1A 3BC1A 1P72A 3K8YA 5LDDC 4GP6A 3GCGA 1SVKA 4NYIR 4C2UA 3TBKA 3QBVA 2JLYA 2GJSA 2RGNA 4GFDA 4NE2A 1Z6XA 2V7QA 1A2BA 1C1YA 3W6OA 3Q7QA 4P32A 1UEIA 3GQBA 3CRQA 2IS6A 3C5HA 1MRSA 1NY5A 3K9NA 3LWNA 4LYFA 4BEBA 4ERNA 3M6AA 4TTRA 4NONA 2X19A 2G6BA 2VH5R 2B92A 2VP4A 3A4LA 3GD7A 1Q22A 2PMDA 1P75A 1UKYA 5LBIA 3WBJA 4XTCS 1LV7A 4EKDA 3VR5A 3VKHA 3KQKA 2G77B 4IDPA 2HLDD 1FOEB 4BLTA 4ON9A 5EE1A 1A82A 4JKIA 4PPQA 3L43A 1M7GA 4CEJA 2GEDA 2AD5A 2IYVA 5DSZA 4ZCLA 3A1SA 5BYJA 3EC2A 1XNJA 2DR3A 1G8GA 4ZI3A 1YE8A 5DN6D 1IN6A 2NPIA 5JECA 4Q7LA 4KV9A 1LB1B 4BECA 3GJ4A 4OQNA 5HE8A 3CONA 5KUTA 1W2HA 4OI1A 4QFMA 1DVRA 3SBEA 5FOXA 3DL0A 4D0GA 2ZRKA 4PZYA 5C18A 1JB1A 3IHLA 1D5CA 1F2TA 2G9NA 2V9PA 2FGJA 1E9DA 1KKLA 4QGGA 1JAIA 4TSFD 4FW9A 2IYTA 1KHTA 3EW9A 2J5XA 3HWSA 1CJUC 421PA 3PUZA 3QSYA 1VYVA 1KK2A 1RIFA 2RCNA 3VR6A 3UIEA 3I62A 2W6ID 2O0HA 1G20E 1SVMA 1X8JA 2ZUBA 5SZJA 3W6NA 5FOSA 4Q4JB 1E2KA 4C0AC 3QBTA 4KFTA 2DB3A 4RD1A 3N5CA 3EIEA 1ZCBA 5AUOB 5SZKB 4TZ6A 4DT1A 1ZJ6A 1HY3A 2O8DA 1UJ2A 3Q5DA 4DLZA 2IYSA 3NG1A 1OXTA 2GCNA 5F98A 1GTVA 2OBNA 3EZ7A 3EZFA 1JJVA 5KU1A 1PLJA 1VCNA 3IHWA 3IIKA 3ND8A 4CGZA 1GUAA 1TF2A 1JALA 1VIYA 3B6EA 2KE5A 5FTJA 4C0KA 4PC3A 2RGAA 2ATXA 4EAQA 4QHSA 4PC6A 4BFXA 1R5NA 2YNMA 1UF9A 2A5JA 1UEJA 1O87A 1Z6TA 3GEIA 4GOXA 1SVOA 4BZXA 4HAWA 3CNLA 4Q1AA 2C95A 1VKJA 3B1YA 3T5GA 4NMMA 1IY2A 3LA6A 2OG2A 1EFTA 2DWQA 4LJYA 4PO1A 3KX2A 3QKRA 2KJQA 2NO9A 5JRZA 2GEUA 4B33A 4P4SA 4LWZA 4MKIA 2TMKA 2BOVA 2VP5A 2O0JA 2QSZA 1E2LA 3OEED 1S3SA 3NC0C 3QF4A 4DLXA 1XPOA 4LJ7A 1QHIA 4EIWA 3BFKA 3CRW1 4W5HA 2WICA 1LF5A 3U44B 2FPMA 1N6KA 4BFUA 3HU1A 3MWKA 1ZUIA 4PHTA 3GJ0A 4G5QA 2F43A 1G18A 4BGDA 3SOPA 1E99A 3T1VA 3TW8B 2X2EA 5ANRB 5FL7A 1ESNA 2QT1A 4V03A 3BK7A 4Q4HB 3GJ8A 2IUSA 3AGQA 1UBFA 1Z29A 3A37A 3H0KA 3KJHA 5AJWA 1SXJD 3KJEA 5EZ6B 1NG9A 3W3AA 1Z63A 4IKEA 4BQSA 5F9FA 1GG2A 5AR1A 1VHLA 1D8TA 2GJAA 1M74A 3TR5A 1E69A 4BEJA 3V4RA 4DB2A 5E4FA 3CW2A 5CYOA 4DLRA 5DISB 4QGAA 2FFHA 2FH5B 4ASUA 5AUPB 3QI2A 5B64A 4C0BA 2ONKA 4B35A 1J99A 3W34A 4EQ6B 1U8YA 3KJGA 4NH0A 4M2LA 4B3DA 1XEFA 5C4GB 4PHGA 4P33A 2Z4RA 3ZVLA 2QRNA 1MOZA 1HURA 2FSFA 1WE2A 2GCOB 1F3OA 2LCFA 3CRMA 4IJMA 3PITA 1CP2A 4UNQA 3OFND 4HUTA 3CO5A 3ZS9A 3ZZUA 3GLGA 5H8WA 1A4RA 4A0RA 1QHNA 4RZ2A 5K8LA 1LW7A 3CPHA 4KYUA 4BLQA 3N2IA 3CRVA 5EP2A 4KBFA 2EYQA 4M22A 2ZTSA 2ZRMA 1XMJA 2CE2X 4IDNA 3EWAA 4JMPA 2YVUA 1YZTA 4KSCA 1YR6A 2GWHA 2NO1A 2OCYC 2OHFA 3KUCA 4FMDF 4X8LA 3TQCA 1SGWA 5C4MA 1D2NA 2VP9A 2DFKB 3RS0A 3AF2A 2J7PD 3B1XA 2P3SA 3C8UA 1N2CE 1UADA 1E2NA 1LS6A 2XTNA 1E2GA 3LFUA 3VR4A 4B2IA 1QZXA 1NKTA 5L3VA 1YHNA 4OHZA 4Z51A 1PUIA 2CCKA 3RS3A 2JDIA 3P4YA 1QRAA 1VIAA 2JEOA 2QSYA 3D6TB 3TSZA 3WNBA 5FTLA 3AVUA 5EXTA 1FZQA 2WWGA 2CK3A 3PUVA 2Z4SA 1E1QA 2J46A 1Y3AA 3E2IA 3G5UA 4OYHA 4UJ5A 3A4NA 1A5TA 1ZUHA 4PPFA 4B73A 3GJ6A 4BFWA 1KZ7B 4DXAA 1SZPA 5B30A 2XJ9A 4LV6A 1SQ5A 4DJTA 5A5GA 221PA 3NVAA 4V02A 4MGIR 5TDHA 4C0SA 4TQUS 3CX8A 3LX5A 3PIRA 4LYAA 4C3ZA 2P6RA 3OE7D 4NTZA 1CJTC 3K09C 1D9XA 4BLSA 4GDFA 3QENA 1I2DA 1JR3D 1EFRA 1WXQA 3UXMA 2F1RA 2YHSA 1G3RA 3NWJA 3NHBA 4LZZA 1T8TA 2RAPA 2WMNB 3U4QB 1W44A 1S1CA 3ADKA 3PV0A 3IUYA 4FMBB 4FMCB 1U90A 4RJLA 1NBMA 5HZHA 4Q7MB 5BN3A 1KO1A 4Y0VA 4AYXA 1TADA 5E7MA 2IF0A 4PO8A 4WBSA 3I32A 3QXSA 4LJ9A 1M7HA 4W5WA 1F2UA 4PPNA 1KMHB 3THWB 1NVWQ 5FI0B 3B60A 3X2SA 4LJ4A 1A1VA 5AJVB 2ZR9A 4L16A 5DI3B 5GJVC 2FWRA 4TQ9A 3K9LA 1ZM2A 4PQYA 4LJ6A 3GLGE 1PLLA 1X6VA 5J40A 3U2QA 1HE8B 3KDSE 4A0FA 2KB0A 1HQYE 3C16C 3L0IB 1N0VC 4B74A 4A0HA 4G1UC 2ZJ5A 4M1SA 3U3OA 1N6LA 3WP1B 2RMKA 4FXPA 5IK2D 1GZSA 1JXOA 3VU9A 4A2PA 3GLIE 1HT2E 1NRJB 4MRSA 2V1UA 1FMJA 4M4SA 5JJKA 4D82A 2AHOA 1IY0A 5TY0A 1JNYA 1SVLA 4YXWD 1NJGA 4Q21A 3R9IA 3ADCA 5HKKA 1JQLB 1S9HA 2WWIA 4DCVA 1WB9A 5JHHB 2MSDB 1T5IA 3A1TA 2H57A 3LD9A 4JL5A 4Q9KA 1G8FA 4GBMA 4FIDA 1UBGA 1OXVA 1RRFA 2DYKA 3MG9A 5AJYA 3WMGA 1T6NA 2FN4A 2V54A 4US0R 3QPVA 3SE0A 1PVOA 1ODFA 3RC8A 3QKSA 3K0FA 4AURA 1ZVQA 5KYKA 1Q44A 4NYIQ 1XBTA 4ARZA 1KGDA 1IONA 1CJVC 2PEYA 4B3BA 1KJWA 3L0PA 1RYFA 3U3MA 3VNUA 4QG7A 1BIFA 3P1JA 1UKEA 2QMEA 5GJCA 5JWRA 4QJ5A 3TJZA 2GXQA 2JJ8A 1GRQA 1GL6A 1ZAKA 4XOIA 1KI6A 3K1JA 4HLUC 1U8AA 1GFIA 3HJNA 5E7IA 4Q02A 3GLFB 4C0LA 2J3EA 4MUAA 1RFLA 2OUKA 2XX3A 1R5OA 3C7KA 4D25A 2WJIA 3PUXA 5F3WB 4KI0A 2OILA 3ND9A 2D2FA 2ORVA 3QY0A 1NVVR 3N70A 1M1YE 3R7WA 2Y8EA 5DE3A 2ZIAA 1TUIA 2RGDA 5EE9A 1PUJA 3JVVA 4AKEA 1XTRA 3L2OB 5L3SA 5GADl 4TLEA 5JRJA 4DSTA 5BN5A 1Z0IA 3CR8A 3QOFA 2CHVA 5D3MB 1US8A 4FWIB 3X1DA 3TUIC 5AJZA 1E32A 2QNRA 4BUJA 2XZLA 1TMKA 1Z2CA 2ZSDA 2ZJOA 5EJEA 1G4AE 1KIMA 1BYIA 5L8VA 1PJRA 1K8RA 3H1TA 3DHWC 1FTSA 2XZPA 1QHYA 4WA7A 5FOWA 1BH2A 5HCNA 3AP2A 1DE0A 2CDNA 2P5TB 1R8QA 2PZFA 2QA5A 3FVQA 4GMXA 4BZPA 2C9CA 3KKMA 3WP0A 5JCZA 1YJ5A 1XEWX 4TMXA 2R6CA 3O8CA 5CB6A 2JGNA 2J1LA 2N46A 1ELOA 2VYFA 3B9PA 3LAWA 4ITRC 3PR1A 4A6PA 5G40A 1DPFA 3THYB 2ONJA 1G17A 3REGA 2WVJA 5C2JB 4PQFA 2QAGA 5F2EA 2CCJA 3VFDA 4LYJA 4AY2A 3QXCA 1ZNWA 4HYYA 1UBEA 4LOAA 1ZUNB 3O8DA 4XJXA 2D06A 4GMDA 5FPSA 4HI0E 3TRFA 1W46A 2MSCB 3DVLA 4AYWA 4EPTA 3CNNA 3KB1A 4D4JA 4R9UC 4XVQA 3ZIAA 1ZIOA 1KKMA 2BVNA 4Q9HA 4UKDA 1YQTA 4B44A 1AGRA 4Q66C 3VR2A 3FKQA 2H92A 2XNSA 4OJKA 4PC7A 4TYQA 4TL6A 3K70C 1UPTA 4IOLA 1DARA 1DOAA 3BOSA 1TF7A 1OHHD 1U9IA 4MYUA 4D4MA 5EXSA 5HR5A 3TLXA 4Q1DA 1GITA 3EASA 1NMXA 4EJSC 1G21E 4NDZA 2Z5FA 1G3IA 1M8PA 2GKSA 3DKPA 3SC3A 4B3XA 1NLZA 4ZKDA 2GZHA 3HR7A 3NDPA 3JZMA 3A6PC 1Q12A 2I1VB 2V7QD 3BB4A 3W9YA 2ZS9A 2J0VA 2OO7A 1TAGA 4Q19A 5FR1A 2RGXA 2WJGA 3SJBA 3SJZA 3U60B 5TMPA 1TQ6A 2K5UA 2QE7D 3S1AB 3KKPA 2FX3A 4O2LA 5DIFA 4MYCA 1BOFA 5GJWC 4EFMA 1XZPA 4ZDWA 5EUMA 5FBVB 2Z83A 5GVRA 4NCHA 4TMTA 4RZXA 2BDTA 3T12A 1E9AA 4IOJA 1E9FA 1XB2A 3KFVA 3FFAA 4Q1FA 3W8NA 4DSOA 4P31A 1S1MA 5K8UA 1EX6A 2GEVA 4V0KA 4Q01A 1YZUA 4PAMA 3OESA 4E03A 1UFQA 2GZDA 1AK2A 2CL6X 5KSZA 1K6MA 4NP6A 1T0HB 4MDFA 4LHZA 1KK3A 4DDTA 2LKDA
chains in the Genus database with same CATH superfamily
3VM6A 3EF3A 1OA0A 2IPNA 1E2MA 4LY6A 3DUWA 1B8UA 1MABB 2IIBA 4V0RA 2QVGA 1PZMA 3I4FA 3KXLA 2HW8A 1Y3FE 2JAUA 5E3HA 4M9QA 5TR9A 1GPYA 2HTEA 3R75A 4H1WA 2IW3A 1MIOB 3K35A 1RBMA 1VA4A 3G85A 2XWJI 4Z4FA 5DNCA 2IYXA 1Q0RA 3W05A 2FQQA 3QWAA 5H0IA 2VQ6A 1ZXLA 2YIDA 4WW0A 5AHWA 4GQBA 1TL7C 3TNDA 3NTOA 3P19A 3CJQA 2XT0A 4CPDA 4NWIA 3EQ7A 4EB6A 1OB5A 1A9ZA 1VA5A 1WCXA 1EE1A 1QK4A 4WPGA 3OQ1A 3I0ZA 3T15A 3U0VA 4LDAA 1AZWA 2P2LA 3LK6A 5JAQA 3DEJA 4PO9A 4RTQA 2PKQP 3I92A 2ISCA 4K3VA 1J5XA 3DL2A 4O4JF 5TEWA 4OEHA 2ZJ0A 2G5TA 4DSUA 4BASA 3UPTA 4F3RA 1DSSG 1VE7A 1XRSB 4GMGA 3H2GA 3R7AA 5LQJA 3HP4A 1B15A 3N8DA 3ELBA 3U17A 2MTBA 2IV2X 1RRKA 5HMLA 2X7XA 4JSTA 4OMUA 4OL0A 3V42A 1NQUA 2VDOB 1PZXA 1XNHA 2FJUA 3GA0A 3PWZA 4XEUA 1T2FA 1TQ2A 2JL1A 2VZEA 1XLTA 1KQOA 2X9LA 1XMVA 4GPEA 5EQFA 3ZZ1A 4I1OA 4UHCA 1P5FA 5I8PA 4N1AA 2XEDA 2Q1TA 2V7GA 4UARA 3SQLA 2HRBA 2HAEA 2PJUA 2X5NA 1QKKA 2IYUA 2FCAA 3CIFA 2Y77A 2GF9A 1UXHA 2A6PA 1KPHA 2FFQA 1WV1A 2GFIA 4M76B 2UYGA 3TI9A 1LI7A 1PJCA 3IXMA 5ERXA 4O0MA 1Y7TA 3DKRA 2YHIB 1W5AA 1X0XA 4X93A 4C2AA 2BRUC 1UZLA 3U44A 1NTOA 2O8VA 2E9SA 3BA6A 3FUTA 3GZNB 5B53A 4O59O 1AM4D 2CHUA 4NOLA 5FO0A 2H8KA 5LXTA 3RSGA 3L06A 5DRTA 3FSEA 3RVOA 4YT4A 1REQA 1SXJB 2NT4A 2VRBA 3LGSA 5F51A 3Q8KA 5FI1B 1OV6A 2EF1A 3OF5A 4FUQA 5BVHB 4JC5A 1WD7A 5CXSA 3VPSA 4U7DA 3QEOA 3QIAA 4DMKA 4Y1RA 3SZ3A 2B8TA 1EWQA 1HFWA 2QXYA 3ZVMA 2R1VA 4Q3CA 2IQIA 2XHZA 4E5VA 2GN9A 2ZETA 5K99A 2BTQA 2C77A 3E23A 5JXGA 3NNNA 1FSSA 1FFXA 2QZPA 3ROQA 3BJEA 5CB4B 1DC8A 3OM0A 1BDIA 3MHTA 2ID9A 4ARVA 4WCDA 1XCBA 5CEJA 3WL8A 1COWA 3ETEA 4ZOLA 4CMIA 1VSQA 3IHKA 2CVZA 1E4EA 3N2GB 1N9GA 1PR2A 1RYMA 1ZN9A 1ZNYA 2IK8A 2PBPA 3IVGA 3KAQA 2EHDA 3QU5A 3EWNA 4B34A 4RLQA 2BP7B 3HJBA 3M7IA 1RVV1 3GWGA 4XPIA 2ZRPA 3I73A 1Z82A 1HQCA 3LLUA 3QUAA 5HDQA 3I8OA 3T4UA 4Y6QA 4YNBA 4E5YA 1JG7A 2RC5A 5JR3A 2WJAA 1A8QA 3UMMA 1L7VC 3NW9A 4A6XA 1KFKB 4K9QA 4QBKA 4AJJA 4MUYA 2WP0A 3EGXA 5CVJA 4O02B 1J9ZA 3FNHA 2F1HA 4FFPA 4R1PA 4UE3S 2A5FA 5G3YA 4B4WA 5C8ZA 1FS5A 2SKCA 5TRTA 5JO0A 4Q1EA 4QNNA 5T3UA 5KYXA 2H16A 4EG8A 4DLVA 2F8TA 1R3DA 3ZV7A 2DH5A 1HDIA 2P6PA 2QT0A 3PFBA 3KVYA 4DR1B 1X7WA 1O1YA 3IVAA 1PSDA 1ZLXA 2JFNA 4ZI5A 4DG8A 5I48A 2YDXA 1D6JA 4YJ2F 5EJAA 5KI6A 2H29A 3IBTA 3ETJA 3LPMA 4KIFA 3ZHOA 3TXYA 3SC2B 4L0DA 3BZWA 5AJTA 4MEAA 4JUCA 2NP7A 1DBVO 2MYNA 5JEDA 2FOIA 3BWCA 1XDSA 2AMVA 3O93A 3ACDA 3EWIA 2MR5A 1LLCA 2F17A 5JBWA 2CD7A 2ZI9A 5D7BA 5J2TF 1SPXA 3EZXA 1XE3A 5CHYA 3U3JA 1ZM9A 1FNMA 3O4GA 1DIRA 4RAOA 5F3DA 4ZVSA 3WY9A 4BNVA 4MR8A 4MDEA 2YL2A 2SHKA 4R16A 3BMOA 3A1VA 1LBHA 3HXKA 3BAZA 3TVDA 2ZBGA 4F5YA 4PYJA 1NMQA 2AIRA 5KHOC 2BAGA 3AI7A 4CM9A 3TRIA 4PZDA 2E55A 3VR4D 5LIRA 1H2BA 1CTQA 1V45E 2CV1A 3WYAA 2WFLA 2JDID 4WESA 1EWYA 1CVLA 3HN2A 2CVHA 1UOOA 2XOKD 2VAPA 3H7AA 4TT3D 3UGTA 4DJ5X 2FN7A 2XGMA 1R0KA 1ZU4A 2DQ4A 1CEEA 4NHOA 5BSWA 3BD7A 1KEZA 3KD3A 3GRUA 3N7UA 5JQGB 1U02A 3OAAA 1NVVQ 4UHEA 3SYLA 4M46A 5BOVA 3HPQA 4UULA 4BUZA 1W5SA 3FPCA 4MNTA 2NTYC 2NO7A 4O2BB 5D5QA 4M8LA 3S27A 3ULKA 4CUZA 2KBFA 1C0PA 4MJ3A 3RH0A 4I3HA 1H8EA 2QTTA 4BRZA 1QO0A 4QYSA 1KTVA 2PBRA 2PT7A 4D8YA 2LIPA 3RJTA 3VAYA 9ABPA 1J42A 1CQIA 2C5AA 4I2VA 3R20A 1IUKA 4MHTA 1B23P 3N6RA 4QYIB 4ZYXA 1KVQA 2JCYA 2Y3IA 2P3OA 1L7QA 4WJZA 4FVTA 2DBQA 1M0EA 4INZA 1G42A 3EVGA 3NBUA 2RGRA 3JD3A 4GQAA 2ZTMA 3NV7A 3THWA 1Q74A 3QA9A 3HU2A 3BRWD 2V98A 4FZ3A 1PEYA 1YVUA 4GLLA 4UDNA 4C78A 2TSYB 5JUWA 2FSIA 1Y98A 1TVCA 2ZRJA 3B2NA 3DZGA 5KCMA 3UT5B 3ZKAA 1Q0SA 4CV3A 1XQ9A 1P7ZA 3DZDA 1EB8A 1PV1A 4OA8A 1HA3A 2CF6A 1M6NA 1VG9B 2PLWA 3EODA 3IEPA 3CE9A 3IDOA 1GL7A 3OLXA 5B58T 3WK9A 3ZK9A 2LDBA 1YVRA 1JA1A 2Y0BA 2BSAA 1APBA 1QGZA 4JI2B 2QAJA 2PVPA 1H3EA 4TMZA 2PJRA 3FDUA 5SY4A 5K45A 2W2TA 1FZTA 3NOOA 1UJ4A 5EE5B 1B73A 2GAIA 2YWEA 3BILA 4F2PA 4I1RA 2P8JA 4YQFA 1HH4A 2HPVA 4CMAA 1Z0FA 2GVDC 3RU3A 2GN8A 4TYNA 1GYRA 3WLJA 1ZRSA 2WUGA 1N0WA 3K7EA 4LRXA 3BE4A 2QN6A 4GYKA 4NENB 1J8DA 3DUFA 2J0QA 1U0EA 2H17A 4LGCA 4GYJA 4QPNA 4E7OA 2PGAA 2I4LA 3U4HA 1R9MA 5IVKA 4C06A 5DHAA 3MRTA 3HGQA 3EIWA 2HK9A 1W75A 2X0RA 4X54A 4EG7A 3K5HA 4ISCA 1YV9A 1YWGO 2QS9A 4NS1A 4PSUA 4P08A 4Z7QB 1KK0A 4U39A 4LF6B 3O7MA 2PKCA 2AFIE 2WYVA 3GRZA 4OQPA 1OBVA 4CIWA 3IBYA 6PFKA 2P9CA 4UM8B 4URYR 3RKSA 1D9ZA 1O97C 2IF2A 4CRWB 3FPAA 3ZWNA 1S2OA 4FQ8A 2O8EB 1E5LA 3L01A 3ZVKA 3KFLA 4HS4A 3KJNA 1G291 1KDYA 1Z7BA 4J1QA 5LCXA 5TX7A 3DE0X 2B37A 3HG7A 2AD1A 3QU9A 4DMMA 3TQQA 5F76A 4BMOB 1SD2A 1TK9A 2FE1A 1XJ5A 3CXRA 3M4YA 2AWNA 2QNIA 3E7FA 4FR0A 4HQLA 5FP0A 5COQA 2R6HA 3TPCA 4ZHQF 5ICSA 3IAAA 4F6RB 1R4ZA 1T8UA 4IQGA 4CR6A 1N25A 1G7RA 1YHZA 3D8BA 2D1YA 4GSKA 3DMNA 3D0OA 4RQAA 1N36B 1C7FA 2X1MA 3GJQA 4RA6B 2W0SA 4LK2A 5BR1A 4D6PA 1XZGA 1WBDA 4GHWA 4TKUB 2O7RA 1FFSA 2P2NA 2XVXA 1ZKMA 6ADHA 1XCLA 4X92A 4LWQA 3ABZA 5FO1A 4RJTA 1ANKA 4HZUB 121PA 1YT5A 2F3UA 4JB0A 5DP2A 3TOZA 2ZRGA 3TNFA 1P61B 1D4ZA 2Q99A 5JS1A 4GLFA 1HSOA 4UDXX 3S44A 4DCSA 4JUFA 2KLBA 1FU4A 4AWXA 1TVKB 4U8GA 5L3SA 1WQ4A 1PNRA 2W6MA 2NW6A 5DLPA 5FUYA 1N0IA 4MO2A 4H60A 1DKNA 1P9RA 2P68A 1WLSA 3FFTA 4JLJA 2D6FA 1CQPA 2GQ0A 1YCHA 3C70A 2BE9A 3NTUA 4A27A 2YIMA 3INYA 3TZEA 5CEEA 4M0PA 2JFQA 3AKEA 4OBXA 4DWVA 1CEXA 5KWJA 1NI4A 3Q7EA 3I61A 1GLGA 4MV6A 4ZI2A 2IYWA 4H7PA 1BX1A 2XQKA 4ZVQA 2Q3JA 5K8IA 3DYBA 2OT3B 1YDFA 4P7FA 3TCXB 4EX7A 4H7FA 4HB4A 2WUWE 4EG5A 3D3WA 2HHCA 3URKA 4OJQA 4PBRA 4IZBA 3M4JA 2XCSB 4E70A 4IQ0A 1I0LA 3W90A 1T5LA 4O4LF 4RD3A 1KSGA 4R2HA 4AS2A 1IG0A 2ADMA 2BGWA 4IMPA 3MT7A 5U4QA 2CFSA 3L9XA 3SLLA 4YRLA 2H31A 4U2GA 1JBEA 2VF7A 1ZUNA 2V5AA 3SEZA 5HGXA 4P9NA 3C41J 1G2IA 2PX2A 3IBSA 3DSRA 4FMDB 5AMXA 4TWAA 1NN0A 2OV2A 2AX4A 3DTVB 3EXG2 5DYIA 1DBPA 1W4RA 4DMHA 2YJTD 3U49A 4RFLA 3IUSA 4IYRA 3CLRC 4REOA 3WXMA 1BNCA 2JGJA 5A7HA 1XZNA 2X9QA 2F90A 3N7TA 4ER3A 3C6KA 2ZUVA 5FLYA 4PICA 4DMLA 3W1WA 1LI4A 3L82B 3KE9A 3OQIA 1YS7A 3V1KA 3QLUC 4MWOA 1QBKC 2P9BA 3KB8A 4TKLA 2JJQA 4OHRA 4KDFA 2P69A 1GNTA 3P0RA 1NPTO 5IM4F 3EUAA 3ZCSA 2HV9A 1NURA 2RHWA 1XMPA 3BDIA 3TLGA 1XTBA 3KXPA 4QYWA 4XWOA 4U00A 1BC5A 2HMTA 4XRGA 2HO5A 2HLDA 3MINB 2FV8A 1NW9B 2HRQA 3MELA 4JB8A 5KSOA 4MA0A 1BXGB 3AF4A 2F7SA 3LWBA 3FHTA 1WDMA 4FUTA 1L4BA 1U1EA 4LN1A 2ACWA 2JIDA 1U3TA 4MYDA 4N49A 4RANA 4ZO4A 5FT9A 4GRIA 2C5LA 4RVNA 1M73E 4Q9JA 3V7FA 1F1BA 4B9AA 2DVMA 2G9UA 3F5QA 2I7VA 3WK4A 3PENA 2CUTA 1P1HA 4BEWA 2ODQA 3L8GA 4BP1A 3I2HA 1NUAA 1OV4A 2VHYA 3TECE 1EIWA 3GJ3A 4M1TA 1XTPA 3QFTA 4NJEB 4HT3B 1SK9A 5IJAA 2XUDA 3AEQB 3HR4A 3LRXA 3WQQA 2WPDD 2UZAA 4B2PA 3Q2KA 3QVJA 5DV9A 3TB4A 1CZNA 1V8FA 3WRYA 3HA2A 4UTRA 3TW4A 1WCIA 4MUJA 2QT9A 1L9XA 4E2YA 4HVLA 2KQUA 3GI1A 4L85A 4NK5A 4YVFA 4HV4A 3FDZB 4MH0R 4J8PA 3LDGA 4S1PA 2OKCA 3BEOA 1EJBA 1VMEA 2JJ1D 3PSHA 4DV4B 2JRCA 4AVYA 4HNHA 1TM1E 1XYVA 1HEYA 2AF3C 3ASUA 3MSCA 2RGWA 4I4ZA 4RVDA 4PYLA 1WIWA 1X3SA 2I67A 4F5DA 5F5NA 4ELSA 1HYQA 4WBNB 1PEAA 2J41A 4WK4B 4HGRA 1E9BA 4AJ4A 5BXYA 3PFHA 4KRYA 1P2BA 4IV8A 3U40A 2C5SA 2IBMA 4WY2A 1IXRC 3HVKA 3MJCA 4KQIA 4LC0A 2YZMA 3BJMA 3NHUA 2V55B 4EUNA 4Y1EA 2BKEA 1CLEA 5JCPA 3MJ4A 5JZ9A 3RAFC 5JXIA 5CX1B 1TKBA 2WZCA 3A05A 4RKWA 4UDOA 2W2QA 1JIVA 1XA3A 2J4FA 2OXEA 5AESA 4YP0A 4XGRA 4YDRA 4H9GA 3DE7X 4MUBA 4C87A 4LE1A 2Q4DA 1BXRB 3WJ1A 1MJGM 3W9UA 3GEDA 4ND3A 4BIMA 2W93A 3KM0A 1QHEA 2OOKA 2QLJA 3KQQA 2J85A 4HWTA 4G0NA 2WU0A 3W6UA 3STXA 2QMOA 5HUJA 1L5YA 4Z4IA 2RHCA 3A6GA 1GL9B 1NNI1 2EFEB 1L1FA 4F06A 2VP0A 4YLGA 1VPTA 2ZYDA 4EWLA 3NIWA 2G0NA 3PKZA 3QEJA 1DAEA 1FQJA 1WPQA 1F0NA 1VFNA 4TM7A 4YUAA 4ZV4A 2NX2A 3NI2A 4L8YA 1ZQ1A 1SEPA 4W9NA 3OY2A 3Q40A 5KTRA 3CVUA 1YO6A 3JQAD 4BWYA 4QULA 3NWBA 4ZTBA 3MMNA 5KVVA 4ICIA 4TQGA 2H1RA 2FWNA 1U0JA 3PE6A 3AP1A 3VYTB 5CK5A 5C8YF 3LXRA 3LWZA 3NR2A 2BI7A 2Z1DA 4E2FA 4ZPJA 1A4IA 2V7XA 2ZUDA 1ZP6A 1YRAA 4L4UA 1OZFA 2JGFA 2RB4A 3INNA 1H2HA 3FYTA 4R71A 2PSFA 1V5WA 4U1AA 1JB9A 3CR7A 3EXAA 2QPTA 2E3JA 3A1UA 2AG1A 3AR3A 1EGQA 1OU0A 2ZE5A 1PQ4A 4KX3A 4YRRA 3AMVA 2VAMA 4U6QA 2OM2A 1KSHA 3F4KA 3AESB 1G2QA 3MM4A 1YKSA 4EJ6A 1ZQ9A 1PDOA 1CRPA 2ID8A 2M98A 1PNQA 2PSSA 1F8FA 3LPCA 4GXQA 4ZI7F 4DABA 3LA8A 2DRIA 1OBCA 3ZE6A 5LOVB 1FDUA 2EQBA 3KYCB 4AJ9A 3HFRA 4PZPA 1DRKA 4D9EA 1RJWA 4Q5IA 2IUUA 1OILA 3OJXA 3ROTA 3U0BA 4B0OA 1V7PC 2D1FA 3SFTA 1YB2A 4JA2A 1YD7A 4GOKA 3QQ5A 4JLWA 5FNVA 1TTTA 4TLAA 2QUHA 1BMTA 3GA7A 2CCGA 4B75A 1WU7A 2WWYA 2JBAA 2VT3A 4QBGB 3AUJB 3QFCA 2IEGA 3VI4B 3AERB 3VHLB 1WPXA 1T1RA 2CFRA 2QJWA 4OCZA 4WLVA 3U3DA 4C05A 2G4CA 1PQWA 2AI2A 2MSNA 1GKUB 4R68A 5KNDA 1ZZEA 1SCDA 1VE3A 3KZ1E 3E82A 4LQCA 4WZ6A 5F21A 4EPYA 2HMWA 2JLAA 2GGSA 3NHSA 3PQDA 1A2OA 1QP0A 3I39X 2WSIA 2HK6A 2Q0QA 1MRZA 2WT4A 3S81A 2VUHB 5KTTA 5D84A 3QNWA 4R4JA 3T5MA 4Q9NA 4NBLA 3DQPA 4OBBA 1Z16A 5KYUA 2O0KA 1N5JA 3BCSA 3NYQA 2JFWA 1P0PA 2PIDA 5FPPA 2ZEJA 1O4VA 4YAIA 5KB3A 1B8VA 3H8JA 4TS1A 3C3CA 4G5XA 2EZ8A 4UM5A 5DPMA 4XD7D 1Z25A 4POAA 4R0MA 4DNFA 5C1OA 1E1RD 1WOYA 4LDPA 4CDNA 4D9JA 5J58A 3RTDA 2DPXA 4PLCA 4WN3A 2QL6A 4KJZA 4C4RA 1QQBA 5AK6A 1X9GA 3OPYI 4AMGA 3AR4A 5M04A 4P4UA 4RD6A 3ACBA 4WHMA 4F84A 2FK7A 1XXLA 1TKCA 3GP8A 4U8HA 1QP4A 3R5XA 4ARSA 2ZUEA 3PA8A 3IS3A 5EOVA 5H5JA 5ALVA 5ISMA 1RYEA 4OLBA 2JD0A 3GLIB 1XLTC 4M53A 1OAKA 4KPGA 2PKRA 4RM3A 3GYBA 3IT1A 3F7NA 3IUQA 2QLLA 1X7YA 5GQSA 4QOGA 1P6QA 3AC0A 1IULA 3DT6A 1EFDN 1YXMA 3AF3A 3JZDA 3SFVA 5A03A 4MWBA 3DBRA 1JPUA 4P38A 2P8SA 4ISBA 4AO8A 4DFDA 2J07A 5ITZA 1W30A 4HDKA 2DM6A 1P62B 2HK8A 4Y8VA 4AKTA 3W3AH 3KKLA 2H52A 3OVMA 5TMDA 3TSOA 2FHSA 5KQMA 1AKTA 2P40A 3HKCB 4FDAA 4HVAA 1FX0A 3PC2A 3SBDA 5JOQA 5ALYA 5EKXA 2J3IA 5KDLA 2RGYA 3A9TA 1SXJE 5FBRB 5IM5A 2PZJA 2E89A 2ZTUA 3RSCA 5KX5B 5MN6A 3LQ2A 5DYNA 4C22A 4M0UA 1JR3A 2O6HA 5TJHA 1R0WA 3SXJA 3TIIA 3U6BA 4L02A 4TSKA 4M21A 1BJRE 4DEYA 1HLPA 3NATA 3KTAA 2JIZA 1F6WA 1XRRA 4HNUA 2BYTA 3D5QA 3B7WA 2PGLA 2VZLA 4LNUB 3GOHA 3P20A 1K92A 5KQSA 5AYVA 3CMMA 3IODA 4QM6A 2GTPA 4FZJA 1MHTA 4E21A 5B58C 4TGLA 2XT6A 3AY0A 4FC7A 4GYWA 3CPSA 2B61A 2RBGA 1FMCA 4KO3S 3FCCA 2YFYA 4HCJA 1PS9A 1RE1A 3BDVA 5HUQA 1S7CA 4JJEA 3IGFA 2JIMA 2Z2XA 3MILA 4NXMB 1CT9A 5BUCA 4CQJA 4B3TB 5DRYA 2HF8A 1SD1A 1HE3A 3BGVA 3PFIA 3SDBA 1ZGZA 4YRSA 1KNQA 1PNVA 2XMCA 2ADOA 3GGDA 2DEUA 4LMRA 2AXQA 4FJWD 1D1TA 3GRCA 4G1FA 1Y7HA 3CG4A 1J49A 3A4MA 1ZCJA 3FCYA 2VPYA 3FMIA 3KEMA 4P2BA 3TM4A 4F56A 1UK6A 3AINA 3I3SR 5C3UA 4DGSA 1NQXA 3SHVA 4Q3KA 2P79A 3B8HA 4U02A 4HQFA 5K3FA 4FWTA 4UHJA 3EBOA 5F3RA 3I9V1 5E4YA 3GNQA 3GBPA 4IZIA 1TD1A 3TQTA 5KPDA 2CHEA 2F3RA 3DXYA 1ZN2A 3NIGB 1KEKA 1RCTE 2ZJ1A 2R79A 1VE6A 3O21A 4INOA 5HKLA 3ZZ0A 1J2TA 2PPYA 3ESBA 3GJ5A 4XOUA 1L5KA 1JIJA 4QO8A 5A6SB 1NDHA 5CB8A 1ECGA 5FJJA 1DQZA 1GTMA 1VXRA 1YR2A 2MU1A 2JAQA 3BXPA 4DANA 2FZ5A 4C6TA 5BSUA 3PL1A 3IA7A 4MHSA 4KMMA 3W5JA 3QOYA 3LOUA 1UZAA 2Z6QA 2WHXA 1ESMA 2J5QA 2XV1A 4KLZA 5DM0A 1L1QA 4UBMA 5FUXA 2FLWA 1OJ7A 1L7XA 2Y27A 3MMPA 5JMTA 1KVRA 5HWSA 4LRQA 2O2HA 1XOIA 3LVRE 2F9FA 5CP8A 4BVEA 4WJKB 1XVLA 1C29B 5JEEA 3DEKA 3ZI7A 4W1QA 2P5SA 1DRVA 4N7BA 4BVKA 3T5CA 1DT3A 2A1UB 1L4YA 2ZSAA 2P77A 5A3JA 2AN1A 1AQIA 4EJFA 2ZITA 3B1JA 2Y6UA 1W1IA 3PD7A 3ZE0B 4PC2A 3VAAA 4DXDA 4AIIA 3H9UA 2D13A 1IUOA 3EQ9A 4GE3A 4NR0A 3OPYB 2AG6A 2JIPA 5JLAA 1TIPA 1L6IA 3MLEA 4YV1A 3Q7SA 4Y2UA 4G25A 2OD9A 2Z3VA 1VLZA 1LPBB 4NE9A 4ENUA 2X13A 3QOXA 1NW8A 3UKJA 4U4AA 2FJPA 1YE5A 1XQYA 1E6KA 1P9NA 3G2IA 3ZQ4A 1KEEB 5JNRA 2V6BA 3ASYA 1GNQA 5KWSA 3V2HA 2YOGA 1T3SA 2BFBB 4BAZA 1A69A 3BL5A 2YC4C 3AEZA 4DUGD 3FE2A 4ZCSA 1J00A 1G60A 1WY5A 2Q6LA 3W9BA 5KTOA 5BQ3A 1ENPA 2IFTA 1DLJA 4RVFA 1HK7A 3R3WA 1VIDA 1NKSA 2QUKA 4K6CA 1DKLA 2CL7X 2WWXA 3QJGA 1VZ2A 4KQ1A 2V9ZA 1EFVB 2Y68A 3NHJA 3BIWA 3JALA 3WB1A 4JJGA 3LO5A 1X13A 4K9OA 1LDBA 2C4NA 2FEKA 1Y9AA 4RKRA 4AKGA 5A4MS 2Q28A 2OZLA 1KL7A 2PKEA 2W98A 3A2LA 3B53X 4RD4A 2A1TR 4G56A 4M0LA 1TUGA 3W7BA 1J24A 2BBTA 2O8NA 3BD8A 4K81B 4LXIA 5DVZA 5ALJA 1T25A 3AVPA 3JYOA 4YUYA 2AFHA 2GBIA 3HEMA 3PNSA 3IEIA 2F48A 1E3SA 1G55A 1P29A 2PNFA 2PGOA 3A9UA 3ER6A 4FFBB 4JU9A 4LVUA 4QWMA 2IIPA 1VGQA 4C7MA 2OCGA 4LHEA 2ILVA 1JNXX 2I71A 5GONA 2VJYA 3WK6A 3OJFA 5KINB 3I2FA 3OP4A 4PLPA 2QRGA 2PBLA 2PCJA 2YS6A 3MGKA 5E6RA 4ABYA 4AJLA 4CKZA 1G5HA 2R62A 4HN2A 4WL0A 3R3HA 1RZ3A 1WUIS 3HRXA 3UXHA 1LJLA 1AF4A 1QHGA 4FJ0A 3W2IA 4CEHB 2IOFA 1OLOA 4QRHA 5ELXA 1VMKA 3E9MA 3WGMA 3T8YA 1Y3BE 3I2GA 3F46A 4GMHA 5SYMA 6ABPA 5ILGA 2HSZA 1C8VB 4L9SA 3I1YA 4YT2A 2FUG1 2YWRA 1KMQA 2FETA 1EZ4A 1ODSA 1TPZA 3AW9A 3LLCA 1D0IA 1KYVA 5C1IA 1R18A 2O3SA 1BSVA 3KJZA 5J4VA 3ANYB 5C9ZA 3FTPA 1B93A 3UJPA 1PVOA 5IULC 3DFZA 3GUVA 1NHWA 3I2KA 3IL2A 1O57A 1U04A 4BNTA 1UJMA 3ZNNA 4MTLA 1U0OC 1YL7A 5DM1A 2VA8A 1TKRA 1NQ5A 3TPFA 3H8VA 3R7SA 2IRWA 3EXIA 5CA1B 5CYGA 4MJLA 1T3HA 3ONVA 1O77A 2KW5A 4ZTZB 1KI7A 3B2QA 1JXAA 4N0EA 3SYNA 2WKWA 2OWEA 5EZSA 4BNLA 4X3CA 4WTOA 3EOBI 1EWKA 2GN4A 4Y6RA 2HL6A 1QC5A 1HFJA 3VH3A 1USVA 2J9RA 2MIIA 5KHLB 3PI7A 5M2QA 3RIEA 3AHJA 5FUBA 1H8HA 2GEBA 3KSUA 3KVVA 2JLCA 2CNDA 4YV7A 4FDVA 3Q9SA 3V4PB 2B4QA 3CKKA 1AUPA 1PR5A 1Z4LA 3HV2A 3O38A 2RGBA 4CHTA 4PX2A 1B6GA 1N7HA 1I7PA 3W2FA 5CA0A 1AS2A 5FPHA 2NVUA 2VDPB 2XWSA 4DIOA 1GGHA 4Z49A 3TOSA 2WQ6A 4LFAB 4BP8A 2GYVA 4ZQBA 1EDEA 4J0IA 4MQEB 3GZJA 4M8KA 4OGKA 4D4KA 2XB2A 2B6HA 2H2GA 1LBSA 3TG8A 4HH4A 3CEAA 2DH6A 1FTNA 3LDAA 2ERYA 4PSKA 5EIAA 4BBJA 4IV0A 1U9ZA 4M37A 4UM9B 1EFRD 4V1CA 3LUDA 1MORA 5JH7F 1I2MA 2HSEA 3N8NA 4GZMA 4MIKA 2RKOA 4LK3A 1INLA 1Q1NA 3K0KA 4K9RA 3S29A 1QCYA 2NACA 3RO7A 4P3YA 2OBYA 3CLSC 3I6BA 4WXHA 1NBMD 4QC2A 4MDYA 3RGGA 4A8TA 2JAOA 2X40A 3DCJA 1SC3A 1TK3A 2XMGA 1B8NA 4AWAA 2QTAA 4WLOA 2OGZA 4EOGA 4XWAA 4ENPA 7ABPA 1FNSA 4BMZA 4ZVMA 3EX7C 1J20A 4C7VA 1BO6A 1LWOA 3PFCA 2JLVA 1HPLA 4Y3UA 1TGYA 1U3DA 5EMJA 3V4FA 4EF5A 4EECA 2FJ0A 1OH8A 2R48A 2PLRA 3NONA 3KYJB 4K88A 3DBLB 5B2ZA 2SCUA 1ZC3A 3QE0A 4KK4A 3WHLA 1OGYA 1E62A 3OZSA 4H3SA 3KKOA 1II8B 2BZSA 1IXSB 5DOVA 1X86B 7MHTA 4GLOA 2ZI6A 1KTIA 4LVOA 4KE7A 4BATA 2C03A 3WNQA 1XMQB 4L3WA 1TNDA 1M8GA 3BD6A 1F8UA 1VJDA 2J5KA 1F6BA 5EYPB 4TQAA 1AU9A 3OCZA 1A9PA 3VU1A 1JIXA 4Y9SA 3DV9A 2J6BA 1A9XA 4FI3C 4R2JA 3TZHA 3RAJA 4JL6A 2GARA 3OJEA 1JFSA 4YMGA 3D6AA 5CXUA 2G36A 2QQGA 1YRLA 5G53C 4RETA 3DB2A 1OSNA 4IKOA 3H8SA 3RVPA 3MRXA 4CMCA 1TQ4A 4BGIA 2KBEA 4Z9XA 4DCGA 4G4JA 1XU7A 3ZWXA 3SP1A 1O8CA 4O33A 1N77A 5C8DA 1AH2A 1SQ6A 3DCIA 1F60A 3DO6A 3TE6A 2IHYA 3BQMB 4R7GA 4EVQA 1C1XB 1CUCA 2WWRA 3QFRA 3KCQA 4UHBA 3AX6A 1CFJA 2ZIEA 3H19A 3DAFA 4EYOA 4B48A 3K70B 3R6DA 3JAWA 4XYEA 4YMTA 3FYDA 5KVSA 1ACLA 4HDOB 3P32A 4DDWA 4RSHA 5DYTA 1GV0A 3EAQA 4C9BA 3ZGXA 4QARA 3K1AB 4KFUA 2AN4A 1F4VA 1ETHA 1O95D 4O3FA 5M34A 2H2HA 4TL7A 2VTKA 4EJSB 5CD9A 1JHAA 1U0LA 3FMOB 4MZXA 1ORWA 2JEZA 3K8ZA 5A9TA 5AVUA 4FGLA 3DULA 3LUBA 3L1VA 4AMYA 1YZQA 5I4KA 1EK0A 1AXRA 3TQSA 1KOLA 3WRYC 4BV9A 3D59A 2GPAA 1CU1A 2O9JA 4MROA 5LXTF 1AOXA 1L5MA 3QEMA 1P1IA 3W6PA 2BKXA 3GXOA 1SOVA 3FB4A 3HDQA 3G2KA 4G4SP 2I4IA 4LHWA 2NZVG 1IWPB 3F9IA 4UCQA 4W99A 1IY1A 4KIUA 5T4FA 3TQOA 2HU8A 3H4MA 2Z08A 1MJFA 1Z4QA 4IOMA 3UC5A 1SCBA 3VPDA 1WDLA 3RHTA 2ZYWX 5JD3A 3L7CA 4BO0A 5FWYA 4FC6A 2CY0A 1UAAA 2BFMA 2ZKLA 3X1YA 1PFGA 2W58A 5JSZB 3PPIA 4FN4A 4JBGA 4AUKA 2AC2A 3EF1A 4HAYA 4MR9A 4CM3A 4Z54A 4PQRA 4XVHA 4E2ZA 4DDVA 3CMCO 4M88A 3IT0A 1DO2A 1HT1E 2PV7A 2PFSA 1D2MA 4WK0B 1DEKA 4DVGA 5EZYF 4M1QA 4YUXA 2BCJQ 4DIFA 4CTOA 4YASA 2WIJA 3M6FA 4Y2JA 5FHRA 4OP2A 3ISTA 2JFHA 1U9CA 2WTXA 3H3XA 1CETA 4WOKA 4RHTA 1AA6A 4JYZA 1WKVA 2V5UA 1WMEA 1SPBS 3WLRA 1GWNA 1RACA 2XGSA 1PE0A 3I3OA 5A4AA 1AUVA 4FFDA 1P18A 2G6TA 4IDQA 2BMAA 2X9VA 4DBVO 1M8FA 1GXSB 3DXXA 1X8KA 2IJGX 4EUEA 1GFZA 3AJEA 1PZNA 2BONA 3R0OA 5GZ3A 4R5HA 4DCTA 1VSUA 4BJ5A 1ONBA 1KGSA 2BFFA 3AGPA 1YACA 3HSKA 4JFRA 3EVBA 3GDFA 2WFAA 5LQRA 4W9NC 4B81A 2AH5A 2ZUSA 3ROZA 1SU4A 1KO4A 1MJNA 5AVYA 1ZD3A 1U98A 5E9QA 1LLFA 1XC7A 4AJ1A 3KT0A 5SYNA 3WFZA 5J47A 1MAHA 2R47A 1RC0A 1USIA 1E66A 2AJBA 5ARBA 4LVCA 3OKPA 1P2VA 2GZ2A 1N3YA 1GZDA 5CLQA 5E6SA 2E48A 3D9QX 1ADFA 3KL2A 3PFGA 4KPUB 2A9RA 3RRBA 4YEDA 1UAYA 2HZBA 2HKIA 4OF4A 1JA9A 2WD8A 3SS9X 3VKWA 4DM3A 3IILA 2FFAA 2YMMA 4EELA 3R0QA 3I5AA 5K51A 2QU8A 1QV6A 4IXWA 4L4SA 3NM4A 1Y9EA 1T9GS 4PZ0A 3VYRB 4YBZA 1BD4A 1M5UA 3ZVNA 1Z3CA 1HG1A 1Z6GA 2PUJA 2QRLA 2XOKA 4TT3A 1XTIA 1ZOLA 2OXRA 4KQ2A 4FCCA 3TH5A 4A1FA 1XCJA 4QGBA 3G5AA 4CKWA 4N7JA 1SA0A 3OKFA 3BTOA 2CWWA 1P44A 2MSKA 3HPRA 2PSJA 2QRJA 4PQGA 4UTPA 3L04A 4GLJA 1D2RA 4HGNA 3AUFA 1X14A 3BHMA 5E1DA 5JALA 4FBMA 5HF6A 2I6QA 2DECA 1SC6A 1JQBA 4RFSA 5K0LA 1EB9A 1N8SA 4C3OB 2RKBA 2WFZA 3QVTA 1BG6A 4WI1A 1KEWA 3FFBA 4ZYZA 4JIGA 2VJAA 3MUOA 5ALFA 3U1VA 2HXSA 2VEOA 3E1KA 1B76A 1OIWA 2QVYX 1IATA 3I52A 4PSAA 5IZCA 4B40A 5BQPA 4ECEA 2QTVB 2FE4A 4RGBA 4D4HA 5JY6A 5JC8A 1VE1A 2VP2A 4L1KA 4PZLA 4TUYB 4C1BA 4CT4B 1TFRA 1EFAA 1R8JA 3SR4A 3W5SA 3QHPA 5HCUA 1EGMB 1KK1A 2CLSA 2E87A 3DA8A 5D8DA 1PG2A 4AM8A 2WA1A 5BT9A 1PO7A 2JH9A 4ZK6A 5IWCA 2YVLA 1M1ZA 3G0BA 4C01A 2RK3A 1VLQA 4QAQA 1B42A 3W2EA 1OIVA 3FSJX 3PXGA 1Y9DA 3U9SA 1XYGA 1T2VA 3HR8A 1NE2A 1Y5MA 4AMUA 4BLRA 4YCNA 3UHJA 5DK4A 4CR8A 4MRRA 3L8IA 1C9EA 3AXTA 3IUBA 4RY2A 3SDSA 1G3UA 2ZRQA 3BGIA 3OG9A 3IPXA 1Z75A 1SUEA 4A5OA 3QNUA 1UR5A 2G07A 4MI9A 3MWLA 4QQ8A 2VYQA 3O2QB 1JJBA 4CXMA 2F8SA 4RLHA 5IKEA 4D2IA 4FM9A 3QE2A 2JGIA 1KEPA 4EUFA 4NEQA 4DT1B 5KQRA 3I04M 2C3UA 3G79A 5IJ0B 1B74A 3ZIDA 2QMQA 4XFJA 5F5LA 4X5OA 3SFZA 5D87A 2Q2QA 2AA3A 1IHPA 3WO0A 1Q92A 2JKVA 4QXPA 4D3FA 3P97A 2VRNA 2CYCA 3M4NA 1EEXB 2C83A 2FW6A 1FPMA 1F0KA 4UTOA 7MDHA 4MJ7A 4CF4A 1WXHA 3P5SA 2FW9A 2NZ2A 5ES4B 4QSHA 1EXMA 3LPNA 1OTXA 4XYLA 2EVWX 1SCAA 4XB6B 3LCCA 1E0SA 2BF4A 1TA0A 2H00A 3PQ7A 1O03A 1ODJA 4W5JA 5CYPA 3UJ6A 4FYMA 2BI4A 3EY9A 4I55F 3I47A 3MJFA 4FFNA 4CKYA 2HNAA 1RYNA 2FRVA 2PE5A 2NZWA 1ONSA 2J87A 1GTL1 1RXYA 4KQJA 1TU3A 4MLDA 4QTZA 4YO7A 3GBSA 4E07A 3PC6A 4LRYA 3ZWWA 2OCBA 4CN9A 1SIBE 4ZVLA 3SVZA 5B3KA 4EUKA 4HAZA 3Q0TA 4G84A 1S7GA 1A5AB 1G5RA 1U7OA 2INGX 2NTEA 3GFQA