3ADCA

Crystal structure of o-phosphoseryl-trna kinase complexed with selenocysteine trna and amppnp (crystal type 2)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
246
Chain Sequence
HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 87
structure length 246
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3adcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3adcA01
2MMCA 1JJ7A 4A2WA 5BYKA 1E9BA 2VP0A 3OFND 2N46A 2IF0A 1S8FA 3NBYC 2REOA 1TNDA 5KNDA 4ON9A 3UG6A 4OI4A 1RRFA 1GP2A 4FINA 4IDHA 5L3SA 2QGZA 5IRCD 1ONBA 4DZZA 2FG5A 1K5GA 5EUMA 3SZRA 3C5CA 2IYXA 1KSJA 3DM5A 1QRAA 4D80A 1ZU5A 4B74A 5KOYA 1V43A 3HPQA 1J90A 3ONWA 3UMRA 4MDEA 1Z06A 1JR3A 2C04A 1OYWA 2KBFA 1OV4A 4QHTA 1DE0A 1O3YA 1OXTA 4FMCF 2EFHB 3VMFA 3HR7A 2WWXA 1SXJE 2WVJA 2ZRIA 1WE2A 4TLCA 1PUIA 4QJ5A 3PCRB 4D4MA 4BWYA 5L3QB 3CUEF 2ZRCA 4Q47A 2BWJA 4EFLA 1N6RA 4DXAA 2BKUA 3G82C 3WXMA 4XOIA 1G5TA 1OJLA 1E0AA 1S0UA 2NO9A 1BH2A 4I1VA 2IS6A 3I5YA 1EFRD 1G5RA 4AG6A 4QJ3A 1GIAA 1CR0A 5DI9A 2HT1A 3AVWA 1MO5A 4TTRA 2W6JD 1TQ6A 3KB2A 3QY0A 3M6AA 1U0JA 2J7PD 3RABA 4HB2A 2AFHE 4PHHA 4BEBA 3U7FB 2IYYA 4CT5A 4I1OA 2WIBA 4U00A 1QHXA 4M22A 1QHSA 1NLYA 2ZSAA 4PPQA 4EAQA 4HATA 3K0CA 3LFUA 4EUNA 4MA4A 3B13B 1NIJA 1P2VA 2RHMA 3EX7C 3CWZA 3V4FA 2ZJOA 4JLOA 4JLAA 2G0NA 1F6BA 4D4JA 5F2EA 2G6BA 1GUAA 3L8YA 4C2UA 2QRZA 1Z29A 4M9XA 2ZRPA 3O8BA 1Z47A 4JLVA 2QNRA 1Z0FA 2HLDD 5L3VA 1ZIPA 3ASYA 1MT0A 4U5XA 1N3BA 4B47A 2R65A 1FUUA 3U3OA 3BWDD 1S4QA 2H18A 5EXXA 3LXRA 1C9KA 2P67A 3ZS8A 4HZIA 1R2QA 4PXAA 2AHOA 2QE7A 1DAEA 4TYYA 4P32A 1IN7A 4Q1EA 1F3OA 1WF3A 2Z0MA 3PUWA 2VHUA 2A5DA 1FP7A 1ZCBA 4M9QA 1E4VA 4OJQA 1UBFA 4OHXA 5C4MA 2JLRA 1TL7C 2QP3A 3CRQA 4MGZR 1IM2A 4ZV4A 4PX9A 2QAGC 2LKCA 1Q3TA 5ANRB 2C95A 1S9DA 3WHKA 3QG1A 1XB2A 2AR7A 3KUCA 1OXSC 5KDLA 3UMFA 2F3TA 1ZD9A 3K9LA 2GBLC 3LD9A 3K09C 4BFSA 4WBSA 1E99A 1CTQA 3PJRA 4ARZB 3P27A 4W5HA 5CB8A 4UXJA 1LTQA 3B1XA 3F8TA 5AWFC 4B32A 4ZCIA 4EJSC 1T8UA 3L0IB 1G3RA 3MMPA 2AKYA 1XRJA 1VMAA 4HLCA 2J7KA 5CDFA 4QRHA 3Q5DA 4LYAA 5J4LA 1XJ0A 4QFMA 2O0HA 2QEQA 1Q44A 2YHSA 3LWNA 2QMHA 3DPUA 3R9XA 1HA3A 3LW7A 1GFIA 2ZVQX 1WB9A 5LB4A 5TARA 3WHLA 3K53A 3P1JA 4X8MA 5F3WB 1OE0A 3EC2A 1KNQA 1TQ2A 1N5IA 1KMHB 3CF6R 3KTAB 2V1UA 1NN1A 3TE6A 4KLZA 2IHBA 1XTIA 1S9HA 1P6XA 1FW6A 2QQEA 5H1YA 4RSGA 4JBWA 2XB2A 3UK6A 1NJGA 1MO4A 3T5GA 2OV2A 3VU9A 1KDRA 4TQAA 2FSFA 2A78A 4RFVA 1KDPA 3D31A 4O25A 5FTNA 3BS4A 3LBNA 2GEUA 4LRWA 1ZM7A 4BFZA 5K8TA 2JCSA 1W2HA 3QXJA 1U8YA 2GCOA 3I72A 1PVOA 1HURA 2ZJ2A 3I62A 1ZUNB 3GCGA 1GNRA 4C0KA 4DDUA 1UBGA 3IHWA 1HH4A 2PJRA 4IVQA 1E1RD 4JVMA 3NH6A 5IK2D 5E3HA 2WWFA 1VYVA 3VR1A 5DGXA 2DB3A 5TMPA 4HLDA 1FFHA 2HEIA 3EIQA 2GEDA 1OHHA 3HDTA 3PUXA 4IKEA 1M74A 2GBLA 4KYUA 2W6ID 521PA 1P73A 5IK2A 1ZJ6A 4EPTA 2PEYA 3HU2A 1XMIA 2R6GA 3P4YA 4RD1A 2IYZA 1Z22A 4M9SA 3HU3A 2R6DA 2P5SA 2XOKD 2H5EA 4OL0A 4ZI3A 2EFCB 3OIYA 2ZYWX 3N2EA 4RY2A 5DH9A 4HI0E 3K0FA 3OEED 3WBJA 3GLIA 1ZINA 4B3CA 1KI1A 5M04A 4DT1B 1OYYA 4Q01A 3LXXA 3IILA 1DOAA 2V6JA 2CMKA 1DAKA 2XX3A 3Q9LA 1E9DA 3VQTA 3B9PA 4LZZA 3C7KA 2QP9X 3DKPA 3QG5A 4Q9HA 4YMVA 3BB4A 2CCKA 3CPJB 1XXHB 2ZS8A 3SJZA 3LDAA 1XBTA 1NP6A 5HKKA 3QPVA 1G4AE 3GJ5A 5FUVA 4S2EA 3QPUA 1L8QA 5JFGA 2YWEA 2F1JA 2VHCA 1KO7A 4ZO4A 1GKYA 4E22A 4BEJA 1SQ5A 1R8SA 1R5OA 2ZE5A 2IS2A 1G1MA 4D4LA 1ZM4A 3V9PA 4URXR 4TYNA 2P3SA 1RJ9A 2FGKA 1XU4A 1IXRC 4ESVA 3LW8A 1UDXA 4UNPA 1NBMA 1FNNA 1N5JA 4CYMA 4QM7A 5C4GB 3OIVA 5L8VA 4AKEA 1YR6A 3FHTA 4GNKA 1E2LA 1G7RA 3U44B 1CIPA 2W83A 5HR5A 3SS8A 2EFDB 2WWGA 3WBKA 1AJEA 1NJFA 3CF0A 1F48A 4EPVA 3BORA 1RFLA 4YXWD 3ICQB 4DSOA 1B23P 2A30A 1W5TA 4M8NE 3UANA 1D9XA 4F4IA 1XCGB 1VYUA 4ITRC 4O3MA 3L82B 3CBQA 4Q4AB 2VA8A 3DM9B 5JWOA 2GVZC 1XP8A 4FCVA 3TW8B 2CVFA 2I3BA 1KIMA 2VQSA 2ZS9A 2YINC 1T0JB 1JBKA 4HDCA 1GNQA 3PVSA 4XTRA 1GILA 2C9YA 1S3GA 4IEIA 4RD0A 4DIDA 4CW7A 2GJ9A 4IEEA 1DAHA 3K8YA 4MQBA 3KL4A 1U0HC 4PC7A 4QHSA 4TLBA 5TXGA 4C7OB 4Q48A 2DWQA 1S1MA 3CH5A 4RD2A 5JZVA 1QHHB 1AA9A 1L2TA 4YDSA 2ODNA 4MRSA 5JRJA 1VG0B 2OLJA 1M2OB 2Z83A 1P62B 2PCLA 2HCBA 3Q5EA 1ELOA 4FCTA 3DO6A 4NCKA 1N6NA 1DARA 5E7MA 3JZMA 4AYWA 1G7TA 3TGPA 3QKRA 3GLIE 1NNEA 2AKAB 2G0TA 1GZSA 3R9IA 5JI2E 4QNRA 5DE3A 4PO8A 2XB4A 4HUQA 4PZLA 3AF1A 5FTJA 2XZOA 4Q7JB 2FNAA 2GDJA 1IAQA 2WWWA 3OAAA 2A5JA 3QQ5A 5JJIA 3QVUA 4HLUA 5FOVA 821PA 3NHBA 1OLOA 1E2IA 1G17A 2OCBA 1VG8A 2GAAA 5F98A 2W2TA 1CR1A 2IT1A 3FKSA 1NVWQ 1W4BA 2EYQA 4Q66C 4B43A 3A1VA 2O8EA 2J0SA 1CS4C 2ZPTX 4QHYA 4DCNA 3GLFB 5SZKB 3O47A 4LYFA 1ZUHA 4MDFA 4PPFA 2E9SA 1XTQA 3L2OB 4E5UA 4EJSA 2BMDA 1XCPA 1SVMA 2ZRKA 2REBA 3QBVA 2PJZA 1AKEA 1UJ2A 4PHFA 2IYLD 2R8RA 2ZAMA 3DOFA 4BFVA 5KU1A 3RS0A 3THWB 1TUIA 1IN4A 4TL7A 5GVRA 3B7GA 2ZI4A 4RKFA 2JLVA 2D06A 2RGGA 2PCJA 1KAOA 2ZVPX 4NL4H 5EXPA 2GESA 1XTKA 3X2SA 2ZI3A 1N2CE 5A0FA 1UBEA 5JHHB 1BS1A 3BB1A 5SZIA 2GXSA 2SHKA 3AVOA 2JJ1D 4XVUA 4KO8A 3T35A 2H16A 3K0FB 1KYIA 1W0KD 2BIFA 1ZD1A 2YOFA 3WMGA 2HF8A 4DT1A 1E79D 3EIEA 1MOZA 4ASUA 1E2GA 1TX4B 1OW3B 1VPLA 5EE0A 4PSVA 4XWOA 1OFIA 1LNZA 2GJ8A 4HAVA 1COWD 3AUYA 1E3MA 1Z0JA 4A9AA 1KJZA 4BFYA 4EDHA 5J4VA 3ADDA 2HYIC 3CNNA 1II9A 2ODWA 4PQRA 5AK0A 4GBMA 1L4YA 1VCIA 3LY5A 1YRBA 4P0TA 3A1SA 4M0LA 2FX3A 2QPAA 3UMSA 2PLFA 1IHUA 2VIIA 2VSFA 2FU5C 3AVQA 4TL9A 2CCGA 4TTPA 4RFSB 4UJ5A 5FR2A 4IRUB 1YR8A 1G8GA 1ZM9A 3CLVA 3MAAC 4K46A 3FKQA 3QENA 2FEMA 2IK8A 1Z28A 3EWAA 3CPEA 3K0SA 5C2JB 4ERNA 2QT1A 3OFNA 1OFUX 2OM2A 4LC0A 5CIQA 5FBRB 4NH0A 2WOJA 2MSEB 4LUCA 4OQLA 2ZRLA 4JJKA 4XIGS 4MRPA 4MYUA 3NC0C 2NO6A 5FUXA 5DI3A 5D3MB 4DRZA 4BECA 4UKDA 3ZZUA 1EESA 2YVUA 1X8LA 1E9AA 4XJXA 5K8LA 2BEJA 5JWRA 3ZZ0A 3THXA 2WKQA 2H17A 2QZ4A 1AS0A 3UXMA 1XFAA 3TRFA 4TLEA 4PSKA 4CRWB 1XTSA 3BOSA 4OI0A 1J99A 4NCHA 4JYBA 1KNXA 2GJKA 3SEAA 3KTAA 4I99A 4PAQA 5C18A 3AF3A 3QKUA 5J47A 3VNUA 5FBLB 2GXQA 5KSZA 3SJBA 1GG2A 1DAFA 1KKLA 3U7GA 4JIMA 1HT2E 1SXJA 4GZMA 1XPRA 5HCIA 1E69A 2EWVA 5AR1A 4Z54A 4FN5A 5FBQB 3E70C 3KKPA 2OCPA 3A58B 4C0LA 4ZDIA 1EWQA 3HJNA 4BE7B 4OHVA 2ZJYA 1KSFX 4NBSA 4DCSA 1TU4A 1A2BA 2GCOB 1ZIOA 3U6KA 1YZGA 3TW4A 3AF4A 1SZPA 2NMVA 2IS1A 4ZKDA 3EZ6A 3HU1A 1UBCA 2WMOB 2VLIA 3SYKA 5JSZA 1Q1ZA 3NEJA 3SQWA 1KGDA 4DLTA 3A1TA 2PBRA 4WZAE 3IKJA 5KSPA 1R0XA 1T3HA 4AKIA 5GJWC 3RWMB 4KV9A 1KK2A 3WMFA 1PZNA 4UXHA 2BM1A 4FD2A 4L8GA 4BFTA 2ZAOA 4BFWA 4TLAA 2C5LA 4JSTA 2D7DA 2QPOA 4TSFA 2ZE7A 4JLDA 3TLXA 3RSLA 2CCJA 2F6RA 2UZIR 5FL7D 2CHGA 3IO3A 3QXCA 3ZD7A 3D3QA 2AK2A 3K0EA 3RC3A 4H1UA 4C0QC 3OZXA 1OXUA 1Z8FA 5BW8A 2IF2A 5FL7A 1IQPA 1LS6A 2DCUA 3GJ4A 3GLIB 3CWQA 4YMSA 4B71A 1G3IA 1I4LD 1NN0A 3PENA 5C1BA 2ZR0A 1XEWX 2OCAA 1NKSA 3WYAA 4IDPA 5AUQA 2QTFA 4HYYA 4NMMA 3A6PC 4DIEA 2ZR9A 4G5GA 5C46F 4Q7KA 2Q0HA 4DSUA 2QBYA 2C8VA 2H57A 1R7RA 2A2ZA 1KJYA 3C8UA 1MO3A 3BH0A 1Y3AA 2ZE6A 3CZQA 5CJ2A 1XZQA 1G6HA 3MGCA 1I4TD 5TY0A 2IS4A 1VIAA 5GJBA 1ZVQA 1M7HA 2R44A 3GLFE 1E1QA 3WYGA 5ELXA 3A37A 1UKVY 1JEDA 2NO0A 3TQFA 2G88A 4QKQA 1N0VC 3AP1A 3GFPA 1G291 3DOEA 4Q1DA 4XSGA 1QF9A 3RSOA 5J4YA 3EZ2A 3R7WB 4PZYA 1T5IA 2KSQA 1Q20A 3NBXX 4HAWA 1Z6GA 4M1MA 4JT2A 3H1TA 2AK3A 4Q7LA 4GMDA 1ZM2A 4CIDA 3H4MA 5CB6A 1VCNA 2FA9A 4HAUA 3PEUA 1NMZA 2BOVA 1UKZA 2D2FA 5BN5A 2FN4A 4Q4AA 3SQXA 3LBHA 1AS3A 4G3XA 3T1TA 2WAYA 2V4ZA 2C9OA 4PSAA 1Z0IA 2R9VA 5BYJA 2ERYA 4P4SA 2X19A 1S2MA 1XDBA 5CM8B 3LVQE 2VEDA 4IXMA 4B48A 4DLRA 2P2LA 4R9UC 2VO1A 5P21A 1F2TA 2PZEA 5EXTA 4O2LA 3GLHA 1M7GA 1Z6TA 2N42A 4DLSA 4C0SA 1VG9B 3OF5A 2ODEA 1CJVC 4DHEA 4TQUS 3ZGXA 1CXZA 2QSYA 3OESA 1I2MA 2JATA 2FSGA 2QQ0A 1T3LA 1RE0A 4JVLA 3QUSA 3KXKA 2OSBA 1TQDA 2ATXA 2G83A 1VCMA 1ZBDA 2GJSA 4BZPA 3ZDQA 1P9WA 1GL6A 4B75A 4JBYA 2ZQ5A 3E5HA 2QA5A 4UJ3A 4FW9A 1W36D 2NPFA 4F4CA 3K0AB 4Q4LA 1CRPA 2QMUA 2RGEA 3ZQ6A 5K8UA 2V9PA 2WJGA 3EPHA 2L0XA 1KO5A 2QUZA 2FMXA 2UVQA 3SFZA 3JVVA 1R5BA 1ZCAA 4OQNA 4A15A 3IPXA 5FUYA 2J7PA 4C0JA 3C4JA 3GLFA 1YVDA 2J0UB 1NMXA 5SZJA 1P60A 2ECKA 4YMWA 2DFKB 4P4SB 3B82A 1KOFA 3K70B 2EWWA 3H2YA 3REGA 1DO0A 3MG9A 5AJYA 1BKDR 4G5RA 4Q18A 1GVNB 1T5LA 3U6BA 1WP9A 4K81B 4H1VA 3RC8A 4A4DA 2VF7A 4ZIRA 3LLMA 2OAQ1 2NZ8A 4G1UC 4IW3B 4RCYA 4TMTA 1I2DA 1WBBA 1FPMA 1OH8A 1A1VA 1E2QA 3VFDA 2XGJA 2IXGA 2ZI9A 3TSOA 4DEYA 4R2HA 1X86B 4JJZA 1X3SA 2J45A 4WW0A 4CT4B 1P75A 1T6NA 5LPNA 4HAYA 5EZ5A 3U2QA 3KXIA 4TLDA 4B34A 2HYDA 3VX4A 3PV0A 1PLKA 3RLFA 1DO2A 4URZR 4NP6A 5EQTA 4YC7A 2ZXUA 2F1HA 3NWJA 3EPKA 1IY0A 2QAGA 4QNMA 2W0SA 1JALA 3P4XA 4QGHA 5AUPB 2QU8A 5CITA 1M8PA 4PANA 2AWOA 3K9HA 4LHWA 4V0NA 2QG6A 4IFBA 2LKDA 4RD3A 5FBVB 4N0DA 4OKSA 1E2NA 3W5IA 4NHOA 2W58A 4XTCS 1NKTA 2C9CA 1ANKA 4M21A 4RFSA 4KFUA 3ZQJA 1U9IC 3MRSA 421PA 1EWRA 4Q1FA 2GXUA 4GOKA 4F93B 4V0ME 2OILA 2YOGA 1N0WA 3DHWC 2K5UA 1N6OA 2IUSA 1KO4A 4KFRA 1SKQA 1XF9A 2A5GA 3W6OA 2C78A 2ZRNA 3CF2A 2OG2A 4LJ6A 2P6RA 3ZLJA 2YC4C 4Z8YA 1AGPA 2GTPA 3MSXA 3B1WA 5FOXA 3TIFA 1YQTA 3I32A 4Q21A 1S1CA 3HYRA 4ZCLA 4ZIRB 2FZ4A 3OE7A 2OHFA 4HUTA 1A5TA 3VNVA 1DADA 3VR5A 1QHYA 1N6KA 1U94A 3CX6A 1KSGA 2N1BA 2JDID 1YU9A 4NCNA 1YJ5A 4RJLA 2GHIA 3HR8A 2ORVA 1RRGA 4GOXA 4PPGA 2ZRFA 3I1FA 4N1AA 3GJ7A 1FUKA 3F3YA 2O5VA 1JR3E 2A5YB 621PA 1COWA 2BDTA 4GOJA 3KKQA 2ONKA 4NONA 4Q1BA 1RC8A 1F2TB 1JAIA 2R6AA 4LV6A 1P61B 4ZPXA 2HF9A 4PFSA 1G18A 4EQ6B 4LK2A 1W36B 2QY9A 3BC1A 3ADKA 1NLFA 3ADBA 3IDQA 5G53C 2OEPA 4OYHA 2QAJA 4L5BA 4CEJA 1PLJA 3LX5A 1OIXA 2O0KA 2EW1A 3FVQA 1K8RA 1II8B 2AL7A 1DS6A 3AEZA 5EE9A 2X2FA 1OKKD 2EU8A 2NG1A 3DZ8A 1W4RA 3LLUA 4KITB 3KZ1E 4ACBA 3ZH9B 1OB5A 5E7IA 1ZU4A 1QHIA 1TEXA 1RIFA 4LBZA 1GITA 1CR2A 1T8TA 2FV8A 1TAGA 3EWSA 3F0TA 2Z4SA 1NVVR 2Q3MA 1SULA 1UF9A 4XD7A 4DEXA 2D7CA 2O8DB 4PHTA 2CK3D 1GM5A 5BN3A 4N0EA 4M1TA 4DLXA 4TMVA 4HZUA 2V7QA 3KKMA 2ATVA 1Z6AA 5KNBA 3BH7A 1EX7A 1YKSA 1IJEA 4D4KA 3DDCA 5CLQA 2IEZA 5DISB 1TQ4A 2VYFA 5EP2A 4C4PA 2P65A 1LB1B 4MGYR 2JIZD 1M6NA 1O87A 4LBWA 1G8FA 5GJCA 3NVAA 1IN8A 2XXAB 2J46A 4MRNA 4OK5A 3WNCA 1J2JA 4CEIB 3MUFA 3LQRA 4EIWA 1KK1A 1VIYA 1MRSA 1E2HA 4GFDA 3MLEA 2PZFA 4C30A 1SXJD 5KDOA 3AP2A 3IGFA 3SU8A 1LY1A 2GWHA 2GA8A 4PC3A 4EFMA 4AKGA 2FE4A 4LC1A 2IYVA 4HEJA 3AGQA 3NBZC 3OHMA 1E2JA 4FCWA 1Z08A 4Q5IA 1SKYE 2AD5A 1ZYUA 4B73A 3ND9A 4YDHB 5J4KA 1LVGA 4Z1MD 221PA 2GILA 2B21A 2ZRDA 3Q7QA 4LJ7A 2CNWD 5E7JA 2BM0A 4DLZA 1XXHE 2OBNA 3AVYA 2CLCX 2XJ4A 4B2PA 3X1WA 1HE8B 4KLNA 1YZUA 2F1RA 2RGNA 5JI3E 3B9QA 3VAAA 1R10A 2CDNA 5FFMA 4AKHA 1E2MA 3PITA 4D0LB 2H1LA 4BLPA 4XWAA 4KAXA 4E09A 1Z63A 1XD2B 3L0OA 1XJCA 2QAGB 3CPHA 5JJLA 4IOJA 1OT3A 1JJVA 2ZRAA 4MKIA 2ZR7A 3PIRA 2O8DA 1UM8A 2VL7A 2OXRA 1FL9A 1ZM3A 4RVCA 5FPHA 1G3MA 1EK0A 5SZHB 3RAPR 3I5XA 2HV8A 1N25A 3X1YA 4A6XA 3VR2A 1IJFA 2RMKA 5FTLA 1OH7A 4LJ8A 4MITA 4M1WA 3THXB 2C2HA 1WA5A 1T4GA 2CK3A 2FEOA 2YYZA 1XD8A 1UAAA 1SVWA 5FI0B 2ZSEA 2BJVA 2WKRA 3U7EB 1OB2A 1XMJA 2Q3HA 1D9ZA 4JKYA 4KODA 4EJSB 4MYHA 2JLZA 2OESA 3X1DA 2AD1A 1KJWA 2WJVA 3QF4A 2D74A 4G5QA 3K0CC 2YZ2A 4F7WA 3GLGA 2B7BA 2RH5A 1CKEA 4IHQA 1MKYA 4L16A 5KDDA 4NZYA 5UKDA 3O8DA 5DHFA 3SC3A 5H70A 4DJTA 3VKWA 3IEVA 1E1RA 4A36A 1ESMA 1DELA 2YKGA 5FTMA 5TV2A 4TMKA 2CL7X 5HTKA 2PX3A 1VCOA 1IN5A 3AVUA 2W6IA 3CO5A 2F7SA 2JLQA 1E4YA 5EXSA 2O52A 1S3SA 3PR1A 3EAQA 1L7VC 4LYHA 1MABA 3SBDA 1E0SA 3OEHA 3FHOA 2WTUA 4DVGA 4QBFA 4ZDKA 4QBHA 2G3YA 4L9SA 4URWR 5IT5A 4EQ6A 1MH1A 1EX6A 1XWIA 3KUDA 1CR4A 2KB0A 3W3AA 1ZNYA 3OEEA 2RGNC 3I61A 2D2EA 3LQQA 4ESHA 3LNCA 2P6NA 2O8FB 3NG1A 1U9IA 4KBFA 2YWHA 1G7SA 3EG5A 1SHZA 4BLOA 1W5SA 1BIFA 3AGPA 3AKDA 2XZPA 1QG4A 1RJ9B 3TVDA 2J0UA 3FMFA 1OFHA 3D8BA 5K8IA 1F60A 1GDDA 4PC1A 2ZRMA 4F38A 2HLDA 3U3RA 1QVRA 5EUQB 5J5CA 1MV5A 3REFA 3FMOB 2WJYA 2YJTD 2JEOA 3QF4B 3U44A 1E6CA 2DHRA 3EIHA 3BH6A 3O8RA 1AM4D 1Q21A 3CIOA 4C7OA 2O8CA 2W2XA 6Q21A 2QBYB 3MWKA 5AUNB 4BPBA 1OPXA 1QHHA 1UEIA 4KI0A 3SNHA 4D0NA 2J5XA 1P2SA 4DLWA 1N6PA 1FTSA 2IBMA 3TBKA 3I73A 2HDNB 4OK6A 5DNYB 3KXLA 1ZC4A 4UNQA 3B5JA 4JS0A 1W1WA 3AM1A 1FQJA 3N5CA 1XX6A 4YQFA 2BCJQ 3GEEA 4UNNA 1JPJA 2BBOA 2W0MA 3QSYA 4LPKA 3A4LA 4BLRA 2FOLA 3GLHE 1W7AA 3I3SR 1HV8A 5LB2A 4F4JA 1LF0A 2JGNA 4ILEA 3CONA 4D25A 2ZJBA 1EG7A 1DAIA 3L0PA 3GFOA 2GCPA 1DAGA 3RRZA 2VTKA 5D3QA 4DKXA 2O8FA 4DB2A 1D6JA 4KYIB 4NYMQ 3ZS9A 3DVLA 2ZYVX 3CR7A 4V0KA 1JI0A 2QP4A 2IYQA 2H8KA 3QXHA 1G7CA 3QKRB 4PO9A 2IW3A 3T34A 5FBWB 5EE1A 4BZXA 3V4RA 2BVNA 1N5LA 4YLGA 1CLUA 1U81A 4JMPA 1PJRA 2HT6A 3IHLA 4UNSA 3RS3A 1HT1E 5FI1B 1P2TA 1JR6A 1LF5A 1AN0A 5B58C 3D7MA 2PT7A 4G0NA 1CJMA 1X8JA 3ADCA 1G8HA 4V0LA 4IOMA 3PEYA 3B60A 5B30A 2YWGA 4WZBE 4BUJA 1DVRA 2IA5A 5LBIA 4MKHA 3DEFA 1Z6XA 2VRWA 2F3RA 3NC1C 1Z07A 4QJ4A 4ZDWA 1EFCA 2FSHA 1GAJA 2BMEA 2RGCA 2GJAA 5FPTA 3R20A 4QGGA 4S35A 4Q4HB 3FMIA 1F2UB 1T91A 1OXVA 2C77A 3LX8A 1W0JD 2AXPA 2OXCA 3T12A 3ASZA 4HAZA 1NIPA 1KI6B 3SYLA 1TPZA 3TMKA 2ZRBA 1SVIA 2IYUA 2ONJA 5TDHA 1EFHA 2J59A 4TT3D 1GSIA 4RZUA 4N3NA 5FOSA 5DHAA 3M1IA 4QM6A 2CE2X 1AIPA 2NQ2C 2WKPA 3AKEA 1MR3F 2A3RA 4JL5A 3K09A 2BJWA 3Q72A 4JYCA 5KSOA 4A0FA 2Z43A 4M53A 2WSSD 3CRVA 4LBVA 4CEJB 3W5JA 1GTVA 1YE8A 1KI9A 1PLLA 3PEVA 4US0R 4NYJR 5CLLA 1OFTA 4QBGB 1AQYA 2HXSA 4PR0A 1N6HA 2F1IA 3BFVA 3LH5A 2JLUA 2VSXA 3QNUA 3MWJA 2ZS7A 4AK9A 2J41A 2AXNA 1XZPA 5FPYA 3MWLA 1X8KA 3JZAA 1W47A 4OBEA 3CX8A 3R9WA 1E9FA 4II7A 4RZXA 1XTJA 4QBIA 5DLQC 2DWPA 5FPSA 1W36C 4JSYA 4H9GA 1TF5A 4NYJQ 3ZYCA 1OXXK 4DCUA 2ZITA 2RGAA 5DN6D 2D3WA 2WJJA 5FPKA 3EZ7A 2XSZD 2GF9A 2IEYA 1G41A 4X8HA 3C14C 1KHTA 5FL3A 1JXOA 2QSZA 3THOA 2QRNA 4B3XA 4EKDA 1YR9A 4QGFA 1YZNA 2GZHA 2KI5A 2ZYUX 1E96A 3NKVA 3EZ9A 4US1R 3KQHA 1QHNA 1SVKA 1Z0KA 3TSWA 3Q85A 1W46A 3SN6A 4D82A 1FZQA 3AKCA 3IO5A 4M1SA 2MSCB 4MKGA 1IY2A 1SXJB 1W49A 3E1SA 4BQSA 1L4UA 2VH5R 4KFSA 1E0JA 5EE5B 1XXHA 1EGAA 4TWZA 1EFTA 1RRCA 5A5GA 3IIKA 2HUPA 1KO8A 1RZ3A 2NOAA 3FOZA 1NRJB 2FZLA 3K9GA 5GVSA 2D4HA 3FTQA 3EASA 2V55B 4B6FA 3IEUA 3THYB 4PHGA 3SI7A 4IFEA 4LV5B 3BGWA 3TQCA 1G6OA 5H8WA 2XITA 2I1VB 5JSZB 1VYTA 1NI3A 2VBCA 3EXAA 2PH1A 2VPPA 3HYTA 3QKSA 2J9RA 3FGNA 4V0MA 3BJIC 3A8TA 1E2PA 1E94E 2FGJA 1HUQA 1KI3A 1E98A 1U99A 3N70A 4OJKA 3NDBB 3FDIA 3CRMA 1D2NA 1D5CA 5JCPA 5DYGA 5CDFE 3NXSA 3GD7A 5KNCA 1E32A 4HSEA 2GEVA 2OBLA 5J40A 2H92A 1UADA 4Y0AA 1YHNA 1YR7A 1DAMA 2QMEA 3BE4A 3MWYW 1ZW6A 1ZRHA 1XD9A 3A4MA 2CJWB 2OFXA 2RKOA 4MH0R 4NYMR 4BFUA 2O8BB 2WWHA 4GI7A 4P33A 4R7ZA 4XSHA 3JVUA 4B3BA 3SFVA 3E2IA 1E79A 1W4AA 1W44A 1Z2AA 4IOKA 2VP9A 3W8NA 3GLGB 3AVTA 2ZI7A 2WM9B 4ASUD 4DC9A 4DB4A 5CJPA 2ZIAA 4OI1A 4FIDA 1Q22A 2V1XA 2QPTA 2BEKA 4I4LA 4YONB 4V03A 1SVSA 3QE0A 4MKFA 2W00A 3A36A 3AB3A 4LWZA 4MYCA 2BC9A 3QPWA 4BRWA 3ZD6A 1F2UA 3BERA 1IN6A 3SE0A 4BGDA 3K70D 3QI2A 4AG5A 1II8A 2IHYA 3SR0A 5DN6A 4B2IA 2RGXA 4IJMA 4AY2A 4WIAA 4X8LA 1IXSB 4P3YA 3J81k 2PZGA 2XSZA 1M34E 2P0EA 3QBTA 2CLSA 2PX0A 1RPZA 4FWTA 1KK0A 4DUGA 1ZAKA 5JEDA 2ZETA 4HLUC 4LJ4A 4HUQB 4P4UA 3QKSB 4DCTA 4M1KA 4GP6A 5KTYA 2IUTA 3FMPB 1RW4A 3Q7PA 3I4LA 4LHZA 3RYTC 3Q3JB 1P3JA 1TTTA 1Q1BA 3LVRE 1BOFA 1VHLA 3EC1A 4Q9JA 2OLKA 1Z0AA 2NO7A 4B6EA 4Z51A 1E0KA 1CF4A 3S1AB 4Q00A 3VTKA 1KI7A 4XD7D 3BRWD 3TH5A 4KCGA 4A0RA 4W5WA 3CNLA 4QL3A 3WP0A 2Z4RA 1W48A 1KZ7B 1G8PA 3TR0A 1GKUB 5JRZA 1TF2A 2QL6A 3OAAD 3RHFA 3RS5A 3R7WA 3SJCA 3T06B 5KYKA 5F9FA 5H68A 2GAOA 1XPOA 5G41A 2WMNB 4ZKEA 3M4YA 4JL8A 3K9NA 5JCZA 4TMZA 3FPAA 3THWA 1N5KA 3H0KA 4KJZA 4OK3A 4TYPA 2P5TB 3U7HB 3U4QA 5A4JA 4FMBB 4ZCMA 2GZDA 3TUJC 1E9SA 1UKYA 4L4UA 4RD4A 4PAMA 3PUYA 4Q9KA 5AJXA 2BMJA 2OAP1 1P72A 4TTQA 4URVR 1GNPA 1P7CA 2ZTSA 5BWMA 4KVGA 5FR1A 3SDZA 1VECA 2HJGA 2R6CA 2G1JA 2XAUA 5DSZA 3GLHB 1XEXB 2XJ9A 5GJVC 3ZIAA 2BBWA 3TSZA 1KI4A 1OKKA 5KHOC 3NTUA 2C98A 3FWYA 3EZFA 2ANBA 1VHTA 2PMDA 3OE7D 2DPXA 3UIEA 1JB1A 5HE8A 2B8WA 2FFHA 4DLUA 2IUUA 4RD6A 3AUXA 1YZTA 5EZ6B 3GFTA 3I8XA 2RAPA 4JLPA 4EPWA 5J4HA 3PG5A 3RRMA 1KSHA 2CHQA 2YOHA 3B2EA 3RRNA 4DUGD 2I1QA 1K5DA 1JECA 3ETLA 3KJEA 4C0AC 1KI2A 4TL6A 1KY2A 4BLSA 3BFXA 3GJ8A 1Y63A 1CU1A 3AQ4A 4KHZA 3NEYA 3KFXA 3C16C 1WCV1 5FH9A 3WMEA 4TMXA 4O0MA 2ZU0C 4IXNA 1U98A 4Y0VA 1QVAA 2PL3A 5AJWA 1H8HD 1U90A 4FMCB 4C9BA 2F9LA 2V6IA 4MYTA 2IWRA 2RGDA 3BD9A 4BASA 3AKYA 2ZROA 2WIAA 3RRYA 2QM7A 3ZZTA 2C99A 3B1YA 3U4QB 4O2RA 4PC2A 3TR5A 3CR8A 1BO6A 2WBLC 4FMDB 4IOLA 1WDTA 3RVBA 4CEIA 1VG1A 2Q3FA 4PZZA 3TUIC 4A1FA 1P9NA 1KI8A 1OIWA 4FWIB 4I1UA 1N6IA 4W7SA 2OO7A 3WP1B 2EQBA 4TYQA 3U3MA 1A4RA 4G5OA 2B7CA 1HTWA 2FFBA 2XNDD 4CZ2A 2EVWX 1XEXA 2VP5A 3QVVA 1GL9B 3NIBA 1XJQA 2Q9BA 4NYIR 2HJVA 2IYTA 3TKLA 2OUKA 2QGNA 2X77A 5BQ5A 4WAUA 2GRJA 3TK1A 1AZSC 4OHZA 3U3KA 4A8JA 4JVNA 1OH5A 2WWYA 1CJUC 2VP2A 2GNOA 1SVOA 3LO5A 3ND8A 4V0OA 3T1OA 1FTNA 3PUVA 4PO1A 4YMTA 1G9XA 3WY9A 1FOEB 4DLYA 4TSFD 1LW7A 2FPMA 2HXYA 1V5WA 5JJKA 1G20E 2IYSA 1Q1EA 2XEXA 3T61A 4DCVA 1SKYB 1U8AA 4AD8A 1IY1A 3KKOA 1P4SA 3BIFA 2CL6X 3BB3A 1Q3HA 2VHQA 3FFAA 4M1YA 4LYJA 4FMDF 1RRPA 2XTNA 3KQUA 3W6PA 3SHWA 1KDTA 5E95A 4TN1A 3VHLB 4LJAA 2WAXA 2YC2C 3S1AA 2X1VA 2GXAA 2NIPA 2W6JA 4HB3A 3IUYA 4TZ0A 4D6PA 5HZKA 2BMFA 4URUR 1K6MA 4TT3A 5FOTA 1G19A 1QDEA 2IXFA 3AP3A 5HZHA 4ARZA 1JR3D 3FKSD 4KVAA 3LAWA 2Q9AA 4NDZA 5KPJA 5KO2A 1XEWY 4JLJA 1G5PA 1US8A 3CX7A 1H8EA 2DFLA 1KZGB 2PLRA 2AX4A 4UNRA 4GRAA 2ZM5A 3X1XA 4C0HA 5G40A 1ZNZA 2H7VA 2WPDD 4YXWA 4CEHB 1AK2A 1CULC 4Q02A 4B35A 5AJVB 2A5FA 3F5FA 1KKMA 1XCMA 3SJAA 3ZJYA 3U5ZB 2AWNA 1OHHD 1RYFA 2IX3A 1NY5A 3A4NA 3UKDA 2BKEA 3TAUA 1X1SA 2DY1A 1BMFD 1T9HA 3W6NA 2Z6VA 1XTRA 4NPHA 2OFOA 4M2LA 3ZVRA 2CXXA 4GMXA 2CBZA 2I4IA 4JLNA 5E4FA 1QHGA 1WBDA 2ZJ8A 4XWKA 5HCNA 3WNDA 3KX2A 4B3GA 1ODFA 2XTMA 5DO9A 4F91B 4ABYA 1A7JA 4V02A 4D26A 5JECA 2VF8A 3KJHA 3ZVNA 1LFDB 1JAHA 1M1YE 2OFWA 3A1UA 3IBGA 4A2QA 5JS8A 3DL0A 1U8ZA 4Q7MB 3UATA 2PEZA 4P31A 2CJWA 4Q19A 2Q21A 2FSIA 3GMTA 1XPUA 2VP6A 1XNJA 3T1VA 1QBKC 3SBEA 5FTKA 1HQCA 3K1JA 1AKYA 2F9MA 4C0BA 1YRAA 2XNSA 4LGMA 2KE5A 2ZSFA 2ZUDA 4LPSA 2YWFA 1FMLA 1XMVA 1JQJC 3B1ZA 4Q9IA 1FX0A 3TNFA 1R0YA 121PA 1PV4A 1ZUIA 2GKSA 4LCBA 1Z0DA 3PEWA 4B3FX 5D3MA 5JS7A 2IWHA 2BHRA 4HDOB 4AWXA 2QI9C 1BYUA 3KFVA 5CYPA 3LRPA 5EE3A 1OF1A 3W3ZB 2ODBA 4LJ9A 4CEHA 4KU4A 2KBEA 2XXAA 4GL2A 3WYFA 4GT1A 4JLKA 3VR6A 4AYTA 5DYIA 1R5NA 2X2EA 4EPXA 4CF7A 3EA0A 1VTKA 3OEHD 4L15A 1UKEA 4W9MC 1JEEA 4OHYA 3PFIA 3MJHA 3EPJA 2BCGY 4DLVA 2J0VA 5AJZA 2WSSA 4Q4JB 1U2RA 2FF7A 3RS4A 1DG3A 1XD2A 2MMGA 1X1RA 3GEHA 4ZDJA 2XTZA 1AQUA 1CJKC 2BBSA 3C5HA 4M9ZA 4Q1AA 3VHXA 4IVRA 2JLWA 4RZ2A 5CK5A 4LHYA 1D8TA 3GP8A 3V00A 1CJTC 2QROA 4A8JB 4HB4A 2JLXA 3NDPA 3SYNA 2BV3A 3NHAA 4D0GA 2JJ1A 5CIWA 5JEEA 3MD0A 2JLYA 1W0KA 1Q0UA 4XVQA 3SOPA 1IOZA 1TU3A 2A7QA 4UXIA 4CDGA 2NPIA 3B78A 3R8FA 3QXSA 3AV0B 4A2PA 4TYWA 1HY3A 3Q8XB 3FFBA 3QKTA 3QJYA 1J7KA 1C1YA 3WNBA 4B3DA 3UPUA 2LCFA 1UFQA 2JA1A 1TEVA 4PC6A 2CE7A 1YZKA 3GJXC 3AF0A 3IIJA 3K70C 4OQMA 1EFRA 3WRXC 1YZLA 1NMYA 3ZVMA 3HPRA 5AUOB 4LI0A 3BFKA 3QXXA 5FOUA 5EP4A 4MGKR 1IBRA 1G21E 1KMQA 4E03A 5DIFA 1X6VA 2ZRGA 3G0HA 2X8AA 3GPLA 2DBYA 3I92A 4I1SA 3RDPA 1ZC3A 4BRUA 1SHKA 2FFQA 4TL8A 1NSTA 5LDDC 2E1RA 1E1QD 2VSOA 4AI6A 4NCJA 1HQYE 2B8TA 5F9HA 1G3QA 1US8B 4MGIR 4U7DA 2FDCA 3IPYA 4GSYA 4HLQB 4Q4JA 2QE7D 4WA7A 2JJ8A 4HDQB 4LJ5A 5HE9A 1NY6A 2F55A 2GK6A 4JZKA 4GDFA 3VU9B 4LBYA 2ZUBA 5BXQC 3D6TB 1GRRA 1W0JA 1PUJA 4BLTA 1IONA 5G3ZA 5IF9A 2ZRHA 4XH9B 2TMKA 1G8YA 4LJYA 4NTZA 4P4TA 2ANCA 3CZPA 4EFNA 2G77B 1JNYA 1E2EA 1NVUQ 2WJIA 3RS2A 5HPYB 2DFNA 2J0QA 4QGAA 1NVVQ 1OSNA 2DFTA 3QF7A 1Z6YA 4C2TA 4DDWA 3TJZA 3TVTA 1G4UR 3DKVA 1JQLB 2FPLA 4GP7A 3NBFA 4WVFA 2VP4A 3RNLA 2FJUA 4I81A 2O8CB 2RGBA 2WJHA 2ZJ5A 1P9RA 1TMKA 2FWRA 4Q9LA 1XMSA 4LOAA 4GPTA 1FQKA 5EP3A 3T5DA 3KJGA 4A8JC 4KXFB 2NO1A 2Q6TA 1Q1QA 4AIIA 2ZYTX 1UPTA 2ZJZA 3B1VA 1VKJA 3PQCA 3ZVLA 4F92B 3T1QA 4R98A 1G64A 3P26A 4PQFA 1QG2A 1ZNWA 1MRNA 4NKRA 3UWKA 1CEEA 3LA6A 5KUTA 5FUWA 1GRNA 1LV7A 1RVDA 2ZSDA 3VR3A 2R6FA 4OQFA 1A2KC 3IIMA 2GVDC 1Z3IX 3KDSE 4OI2A 5IDVA 1TF7A 2Z5FA 4LHVA 5JWHA 4NCIA 3A1WA 3W9YA 1SXJC 3W8RA 5BN4A 3EW9A 2FFAA 3GJ0A 5G3YA 2IC5A 4WOPA 3IQWA 5LD2B 1ZMXA 4B2LA 3AVXA 1UDWA 4BLQA 2O0JA 3BBPA 1R8QA 1NLZA 1E2KA 4DBLC 1KTVA 1GRQA 3AVVA 1EXMA 2GETA 4A6PA 3KKNA 2VHJA 1E9RA 1Z83A 2NZJA 4JKIA 5KSYA 4AC9A 1N6LA 2ZEJA 3IQXA 5EJEA 3THYA 2ZRJA 2CHVA 4CVNA 2REXB 2OCYC 3ECCA 2Y8EA 4NE2A 2W2VA 4K8OA 3MCAA 3GQBA 3PUZA 3RS7A 2GCNA 3ICEA 4MUAA 2D62A 1BYIA 2JIZA 4JLBA 4BZQA 3N2IA 2WV9A 3R8CA 1DPFA 2ZSBA 1G3UA 1II0A 1WRBA 4IVPA 4RKEA 2ASEA 2JJ2A 2WHXA 3X1ZA 2EYUA 3LV8A 3FHCB 4US2R 2ZANA 4PQYA 3H86A 2WWIA 1JPNA 4J0QA 5EP1A 3RWOA 1B0UA 4DSTA 3KQNA 3CH4B 2WSMA 4NYIQ 4URYR 1DBSA 2EFGA 2QENA 1VDZA 2YV5A 2ZI5A 3KB1A 1EFUA 3EA5A 4WXRA 4KBGA 3FYHA 1GL7A 2NTYC 4B44A 2FH5B 4QG7A 1KAGA 4TMWA 4B33A 2IYRA 4POAA 2WOOA 4XVRA 1OH6A 4D2IA 2J3EA 2KJQA 3AVPA 5DI3B 2DR3A 2R62A 5TB5A 2XZLA 2IL1A 3I8SA 3P20A 5JHGB 1KY3A 3OIUA 4Q4HA 3L0SA 4KSBA 1T3SA 2XOKA 4DDVA 1E2DA 3LBIA 1Z5ZA 1E9CA 1J70A 1NN3A 1P2UA 5B57C 3B8HA 2CLDX 3CB4A 5HKKD 1KI6A 3GEIA 1G16A 3G5UA 1S96A 2JDIA 4U02A 1FMJA 2CEAA 3UG7A 1C4OA 1FP6A 3T15A 2J1LA 3H84A 1DTSA 2QORA 2VHTA 3QEOA 2ZI6A 4LSGA 2RCNA 5JBQA 3VKGA 2PT5A 3FB4A 4M4SA 2ERXA 3W90A 4RCZA 2DWOA 3KQKA 3VKHA 4PTLA 2F43B 4R71A 2R2AA 721PA 2V3CC 2V54A 4R2IA 2FPKA 3DZDA 5GADl 1NL3A 2G1KA 4LHXA 1E2FA 1R0ZA 2KWIA 1IXZA 2WICA 1I4DD 1JXMA 2Q9CA 3M0EA 4MUBA 2QM8A 3B6EA 4A0GA 2OBMA 3DMDA 1NBME 1OIVA 2A9KA 2AN9A 1UEJA 1NBMD 2LWIA 4GZLA 1WQ1R 3U3JA 1H8ED 4QOSA 1D2EA 4IDOA 1MO6A 1FX0B 5IHPA 1FNMA 2C96A 4AYXA 3AF2A 2XNDA 1YZQA 4OHWA 2PMKA 2OE2A 3TUZC 4IDNA 1R0WA 2V7QD 1F5NA 2OZEA 2J87A 2YNMA 4DSNA 1N0UA 2C03A 1HYQA 2IYWA 5CYOA 1AS2A 3DMNA 4Q03A 2RB4A 2JASA 3BAFA 4WXPA 1WXQA 4X8OA 3P32A 1KMHA 1LS1A 1ETUA 4JL6A 4D81A 4TZ6A 1MABB 2ZREA 1W2GA 1GOTA 1R6BX 2BBTA 3L8ZA 2ORIA 2QTVB 3GJ3A 4LV8B 4Q1CA 5CK4A 4A82A 2RHDA 2HCJB 2ZJAA 4L9WA 3TAHA 3MFYA 5LD2C 1KO1A 1DG1G 2E87A 1D2MA 4M1OA 4ACAA 3AH8A 5JLJA 2F43A 3C41J 4Z8XA 1TADA 2ZUCA 3C15C 4HB0A 1NG9A 3L43A 2QMOA 5KPDA 4KSCA 4A0HA 2CNWA 1KK3A 1RKBA 4QC2A 2P6UA 2JJ2D 2G9NA 1DEKA 4WZ6A 5CM9C 1XEFA 4E07A 4JLMA 3CNOA 3KQLA 2V8OA 3IBYA 2B92A 4PPNA 3QIAA 1Q57A 4DDTA 3U61B 4ZI2A 4HAXA 3NH9A 2GF0A 3PXGA 5B2ZA 2ZE8A 1J8YF 4HZUB 2B6HA 1P5ZB 1Z2CA 4G01B 4LX0A 2O8EB 1T0HB 1NN5A 2WPDA 3CM0A 3RANA 5JMTA 3HP1A 3VX3A 3U60B 1W4CA 1ZD8A 8OHMA 1KDOA 2ORWA 2UKDA 4JT4A 1TUEA 1HEIA 4UQOA 4Z1MA 1AZTA 4PAOA 3CRRA 3W34A 1RYHA 2O8BA 3B85A 1H8HA 1WMSA 1SVLA 4MRVA 2IXEA 3ZIAD 3GJ6A 4LDJA 4C3ZA 2ZU6A 5L3RA 1NVXQ 2QTHA 2CVHA 2NGRA 4A92A 1R4AA 4YMUA 4DWJA 1CBUA 5L3SB 3BK7A 4FXPA 3CRW1 4BFXA 4AURA 2JLSA 3WRYC 1QZXA 3K0AA 3MJRA 1AGRA 1U0LA 2OT3B 5FOWA 2WZQA 4KFTA 4G5SA 1GWNA 5TVKA 3VR4A 4EPRA 2AFIE 1GKIA 4QXAA 1NG1A 2MSDB 3CKLA 4NU0A 4TQ9A 2UZ3A 1HE1C 1ZP6A 1SGWA 1ESNA 2JAQA 1ZNXA 3OIWA 1NF3A 4OQXA 1H65A 3CW2A 5B64A 3SHFA 2DYKA 2EFEB 5L3QA 3BXZA 3FE2A 3QOFA 3EARA 1M7BA 4RZ3A 1J8MF 1Q12A 4JBXA 3UWOA 2GZAA 3HWSA 2QT0A 1CRQA 1CP2A 1NSFA 4B76A 4EPYA 3GLGE 2CL0X 1BMFA 4IDQA 3O8CA 1E9EA 2GK7A 4FI3C 4CGZA 3QEJA 4JVSB 4MRRA 1A82A 3EPLA 4LY6A 4W5JA 2QN6A 3KJIA
chains in the Genus database with same CATH superfamily
1F0YA 3JQAD 2MMCA 1FFGA 2BF7A 3BCHA 5MF6A 2CYBA 2VP0A 4ZCTA 3PYXA 3OFND 4EI2A 1PW5A 1Y81A 2I9PA 1GV0A 5DBGA 3E18A 4F7DA 4L9RA 3DS8A 3T3HA 3IP7A 1ZWLA 2REOA 4FHEA 3H5TA 3HNOA 3CVVA 4YO8A 2AXEA 4BBZA 3ILVA 4Z2YA 2O1SA 1GP2A 1GCUA 1Z74A 3NIGB 3BEDA 1NOKA 4FINA 4Y6PA 5C8YA 1OYVA 1JLLA 2XT6A 2GZSA 1ONBA 3BWEA 3R5HA 4WJZA 4R3UC 3HCOA 2X42A 3DLPX 3R7NA 3OEYA 4CM5A 4N3GA 1HQDA 1JKFA 1C1XB 4ESEA 3RT9A 4B74A 3VYUB 2HMAA 2BFOA 3MIZA 4LHEA 4A7PA 2QUAA 1TB4A 3HLYA 1QMPA 4F9TA 1Z06A 2PSJA 3TB6A 5KJ6A 5F1OA 4CM8B 4DNOA 2ZB4A 3H5WA 1ZVJA 5IPFA 3VMFA 5IZCA 5EVCA 4QG3A 3HR7A 1UBHS 3IPCA 1WE2A 1E3TA 4QJ5A 4D4MA 3H19A 5L3QB 3AB7A 2ZRCA 3CUEF 5BW4A 4Q47A 5CT8A 4QUKA 5DULA 4WUTA 1W4LA 3KPUA 3R0IA 3G82C 3WXMA 5D7BA 1VMKA 1OJLA 4G8DA 3TKAA 3E9YA 1E0AA 2W98A 2NO9A 3LKDA 4X84A 4YVFA 1L7DA 1NVBA 4PW0A 1G5RA 1OX4A 4IDFA 1CR0A 3OPXA 4L0MA 5IBPA 4TTRA 1LJUA 2I2WA 2WI8A 3S5JA 2WHEA 1GV1A 3FYCA 3SLRA 2NZUG 2OD9A 2VF4X 2W8BB 2P2SA 2EP8A 2X2PA 2H4ZA 4HEA1 5IM5A 2FUNB 4FSXA 5A03A 3RABA 4HB2A 4PHHA 4AX4A 3U7FB 2Y3IA 1K4YA 2IYYA 3C1AA 4CT5A 2W4QA 5TGDA 1Y3CE 1XZDA 2Q1UA 4JGIA 4HNTA 2ISQA 1QHSA 4LDAA 1NLYA 2ZSAA 4ZMSA 5KYNA 4R16A 3BHIA 5E4YA 3HN6A 2RHMA 4YPOA 3LPNA 3V4FA 2GD6A 4JLAA 1PR6A 1ZK3A 5KZMB 4AS1A 4NFLA 2YHIB 3CUTA 3HXPA 2G6BA 3AEYA 5F2EA 3FOAA 4YJ2A 4C2UA 3C98A 2XYHA 2ZRPA 4FBLA 4TT8A 5BWNA 1Z47A 4QDZA 4AJEA 4X20A 1YAJA 4KEAA 1SBYA 2HLDD 1MUUA 2JI9A 2BGLA 2LBPA 2VC2B 4FLEA 4NECA 3TQQA 1ZIPA 3ASYA 3OMXA 4AB1A 2H1CA 1QYDA 4EG6A 1C7QA 4KYTA 3AZOA 2YL2A 1C7FA 1LNQA 4N0PA 3REQA 1XG5A 1S4QA 5EXXA 3LXRA 4Y98A 2AKEA 3T95A 4HZIA 1KDVA 2FW1A 2R47A 3ZS8A 5JH7A 3UFXB 1ZJZA 2ILTA 2PO5A 2QE7A 4M0KA 4BNMA 1DAEA 3NLLA 1Y1SA 2Y67A 4LDNA 3DAYA 2HNBA 3DDUA 2KMLA 4GYWA 1WDKA 3WWDA 1Z16A 4EW1A 1F20A 2I34A 3IQHX 4G0MA 2Y1OA 1VRWA 1S2OA 4CQLA 5AESA 1O6CA 4MV4A 3RVQA 4PY2A 3F97A 4QPPA 2AOUB 2E6KA 2EF1A 1CZHA 2Q4BA 3OF3A 3TX2A 3U7QB 4CKYA 4IX1A 2W6CX 1PJSA 4ZV4A 3ZCRA 3PC4A 3EH2A 3G7NA 2D1RA 2LCIA 2WEKA 4EHAA 1OZGA 3O4FA 4XR9A 5HG0A 5JQGF 1NA5A 5BSEA 4UZFA 4R6WA 1KFKB 1OX4B 3WHKA 3QG1A 5JIBA 3AJMA 4GI3A 4N9WA 4CL8A 1EVQA 5DYNA 2HBYA 3UO8B 2IYAA 3I09A 1ZD9A 2D5AA 3W06A 2OBBA 3BL6A 5NULA 3COPA 3LD9A 4C76A 4BFSA 4JI2B 3VPHA 3L7JA 3ZZ1A 4WBSA 1E99A 1EP2B 1W30A 2DLNA 4E3ZA 1CTQA 1KZ6A 3KCNA 5LR6A 4NATA 4ZEOA 4FX5A 4ZYTA 4UXJA 3F8TA 1WV0A 2NUAB 3ZDZB 4GGPA 5IBCA 5IBRA 3PA6A 2GWRA 3WL4A 1V5FA 4TLMB 4J3NA 3IXLA 5CDFA 4QRHA 5EMNA 2A9RA 4CCYA 2ZW9A 2IY7A 2YVAA 2O0HA 4BQNA 5F35A 3CKYA 3TD9A 1RR6A 4YUVA 4KUEA 1RTTA 4B4DA 1BDJA 2A4KA 3ZWDA 4CPDA 3R9XA 4WKBA 1YBMA 2YICA 3TLCA 3PNYA 5LB4A 3UTCA 3WHLA 3K2BA 2HF2A 4WERA 2VS1A 5F3WB 1OE0A 1BMDA 2VNSA 3G0IA 3KG2A 1N5IA 1YJAA 3GZNB 1C30A 2V1UA 2QD5A 2P1RA 3ZLBA 3LPLA 3TE6A 4KHPB 3ZKWB 5ALRA 1FDUA 1S9HA 3IP8A 1ZUWA 4YWHA 3PL1A 3JR7A 4NZ9A 2QQEA 4ZN6A 4O8ZA 2FZCA 1DBPA 1PZGA 1J21A 5EHGA 1YS1X 2AR9A 4GBJA 2EL7A 1LC0A 2OV2A 3EF0A 3G88A 5EQJB 1USKA 2AN4A 2JFXA 3OX3A 4RFVA 5TPWB 2OWDA 3STWA 4GQIA 1WUKS 4JNKA 1RAAA 4LZNA 4O25A 5AOAA 5C9ZA 4BNTA 3PC8A 1WPQA 2GEUA 2NU7A 1GTRA 5FCDA 5IXYA 2V96A 3CLRD 1P9LA 3SIWA 4BFZA 2EBHX 5DXFA 5K8TA 3DEZA 2QRMA 5GWXA 2WF5A 3KOMA 3BKWA 3GZTB 1NRXA 3I72A 2YJNA 2L69A 4S0ZA 1ISHA 3JQEA 5DK4A 1PCXA 4DIKA 1G63A 3CSUA 1ZUNB 3I62A 3GCGA 1XQ1A 3HRIA 4C0KA 3H99A 3FG9A 2GN2A 3LECA 4QYWA 1SK9A 1UBGA 1E1RD 3CCBA 3WA6A 4QZVA 2XZDA 4M1EA 5DGXA 3V1LA 1XWFA 1MF7A 1YXMA 2HEIA 2IVZA 3EIQA 1ONSA 3OOWA 4L3WA 1N9GB 4NNPA 4ZVVA 4N76A 2GBLA 2VJMB 3IX7A 3AERB 3V5NA 3ULKA 4YRPA 5BSTA 1Y6FA 5I7UA 3B3AA 4RD1A 4U2EA 2IYZA 1MHTA 5K20A 3CZAA 1Y5IA 4YA6A 4FN4A 4WBNA 1U6IA 3HRHA 2HB6A 1I3MA 4J0DA 4E31A 3IBTA 1JSLA 1TZKA 1WMFA 1WY7A 3SSNA 2DG2A 2FHSA 2J09A 3KUUA 3DYVA 3VVCA 4MR8A 5A9SA 3GLIA 1PO7A 3C43A 4O4HF 2YZ7A 4RH1A 3TZLA 4B3CA 1HDCA 3A9SA 4FKBA 5J2TF 5E6RA 3ITEA 3AEUB 3G6KA 4HUJA 2HMWA 3LT5A 2ZATA 3PFCA 3VQTA 5B1IA 4LZZA 3DKPA 2GBCA 4U7FA 1RRVA 4X41A 2CCKA 3P71T 4YJ2B 4AMZA 3QPVA 4KV7A 1U9CA 4L08A 4EL0A 4QFBA 4S2EA 4MRMA 1JR4A 2Z3ZA 2AQ8A 5JFGA 4M7WA 2YWEA 4AMGA 5KTOA 2F1JA 5LLSA 1JHPA 2VDKB 1GKYA 3FBTA 4R3WA 4UTVA 4BEJA 1YZHA 4FFBA 3KJNA 1ZM4A 3RYIB 1RLIA 2EEPA 3WDSA 4D57A 3C3DA 3EYWA 4NJEA 3LW8A 5DKFA 2QUHA 3EULA 1ZHFA 2AOXA 1HG1A 1PQ4A 1QX4A 1SURA 5L8VA 4KQ9A 3SD7A 1E5DA 1MXHA 2WJWA 4GNKA 4BU1A 1R4ZA 1E2LA 3RSHA 3HK2A 4IIDA 3SS7X 1SXIA 1ZR2A 4CF4A 4ITUA 4QRIA 1DQPA 1U0TA 4IPTA 5JD6A 3LTNC 4G0UA 3CF0A 4EPVA 1JHOA 4YXWD 1RFLA 1NBOA 2CXNA 2IYOA 2X7XA 5TRTA 1W5TA 1YIOA 4RLQA 1F0NA 2JLAA 3D8RA 3FAZA 1W0CA 4FDAA 4LSZA 2XWBF 3RIYA 1LSSA 1MB4A 3BMNA 5IG2A 3I34X 3ZU3A 3K0BA 1YUBA 1EA5A 1XP8A 4TTTS 4ZOEA 3ER6A 2CVFA 1EQUA 2CVZA 1UOQA 1GPJA 3B7WA 2DHDA 3H65A 4PF1A 5FWXB 2XODA 1BDIA 1Z6QA 2VXBA 1Z7BA 2ZS9A 4HDCA 4I5EA 3QU9A 1HE3A 2C9YA 4DGQA 4CW7A 2Q4EA 3WK5A 4HWRA 1KEUA 4Q48A 4CGYA 2H52A 1DAHA 5TXGA 3I9MA 4MQBA 3TI7A 2X6RA 3KPVA 4BJ6A 4ALKA 4RD2A 1FIUA 3OQBA 1LJ8A 1L2TA 4YDSA 2ICAA 2NSLA 2ODNA 2NU8B 5JRJA 1AGNA 3P9CA 3ISVA 5DN9A 4UUQA 2OLJA 1U2PA 1I7QB 4YLEA 4TKZA 1P62B 3OCWA 2NXWA 4GXNA 4ZU6X 4IIVA 1YK1A 2C29D 1Y5LA 5E7MA 4ZT3A 3LQYA 1YSCA 3ZX4A 1DRKA 4AYWA 3K3PA 3TGPA 4MVWA 3JZIA 3R5XA 1JLRA 4P9NA 5IYZA 2ZZKA 1U3FA 4O4JB 1BHO1 1C7JA 4XGNA 4XI9A 5JI2E 5DE3A 4JYMA 1QQBA 5FBZA 2XUFA 3AF1A 1VKOA 1ORDA 3S2UA 3IYLW 1GSAA 3W2TA 4HLUA 4YH1A 4KMRA 2BR3A 4KR2A 1GYPA 3NHBA 1ZONA 2W2MA 4II2A 5HDQA 3VPCA 5JNTA 4K87A 6YASA 2IT1A 2EYQA 4WXYB 2O8EA 4D9IA 2J0SA 3RSCA 3UJCA 3SLLA 1NVMB 1R4MA 1TYCA 1OWOA 1K7FB 1RYEA 3LQ1A 1PR5A 3UB2A 5SZKB 4XWTA 3VPFA 4F97A 3VH3A 2E9SA 1UXKA 2HMSA 3G23A 3L2OB 1QORA 4K3WA 3CG0A 4ZCQA 5HDBB 1DTWB 3OD5A 2O7SA 5EGSA 3H13A 3QBVA 1XZEA 2R8RA 2ZAMA 3DOFA 3JARA 4NFHA 2ZB7A 4JYLA 5KU1A 2W2LD 2ZBRA 4BY9E 4QOFA 3MMSA 1TUIA 2A0KA 3GEMA 5CU7A 2FBMA 2A1UA 5T4BA 4EHIA 3PCXA 2H4WA 3B7GA 2ZI4A 4ETNA 2P0YA 4FPXA 3PHBE 2ZVPX 3I53A 3NYQA 1SZJG 3M6FA 4NL4H 5EXPA 3ZK9A 4BX2A 4ZU2A 2HRDA 2OOKA 3BMCB 3X2SA 2DETA 3MUEA 4TKUB 3LKBA 5DU2A 1XLWA 5L3SA 2LP4Y 1BS1A 5SZIA 3EY4A 4IJKA 1FFBA 4KO8A 1W93A 3UTDA 2H16A 2VJQA 5AO9A 4GYKA 3UAZA 1KYIA 5CURA 1B3RA 4FEGA 3WMGA 2WC1A 2MJLA 4Z86A 3QMPA 3PR2B 3BWYA 3KO8A 5HKBA 3HI4A 4OJTA 3FOFC 5EQFA 1LPMA 2Z2KA 3D0RA 1VPLA 3A3KA 5CFPA 1CYDA 3LC7O 2WYWA 3F67A 4YCJA 2IUFA 2GRUA 4BO4A 1SXHA 2QD1A 1AKWA 6REQB 2GASA 3AUYA 5BY2A 5FULA 1JHRA 1KJZA 4BFYA 4EDHA 1UBLS 3ADDA 1TVMA 1XZAA 2ZRQA 3PC7A 1K2WA 2DPMA 4BVJA 1V1JA 4UM7A 5AK0A 5IXSA 1MAAA 3FDXA 3HUFA 2YW9A 4G67A 4LZJA 4Y9UA 4M0LA 4MLDA 1H2ZA 2P9JA 1QH1A 3FYTA 3QPAA 2JH8A 4NEKA 4TTPA 3AVQA 4QU5A 4RFSB 2YRFA 5FR2A 4RPJA 4DV4B 2JA2A 3W7VA 3VH2A 3CLVA 3W4JA 4L95C 2YIVX 3FETA 4U0KA 4FGLA 1H5QA 4CFSA 5I9SA 1DCIA 1C1DB 2FEMA 2FEPA 2G08A 5EKSA 5EZYB 1FTWA 1PEAA 1YASA 4EJ0A 3R0OA 1YUNA 4HPXB 2FLKA 4FFMA 3NQ41 5C2JB 1T1EA 1OFUX 4FCCA 3LSTA 5FBRB 4XYMA 4A23A 4LUCA 3FPCA 2JCYA 2ZRLA 4GX1A 1DKNA 5EA2A 3NC0C 5EXTA 1SXPA 1KRHA 4YCNA 1QAMA 2NO6A 2MU1A 4DZTA 4F9FA 1RRKA 4DEVA 3CEMA 1D4AA 3OPQA 4LOKA 4X66B 4KL8S 4OKIA 1X8LA 2B69A 4FYKA 2F2TA 4RACA 4HZGA 2WVAA 1XZ8A 4V1CA 5ELMA 2QZ4A 2C5HA 1RM4A 3QSGA 1XFAA 2JGFA 2NUTA 3L06A 4FM9A 2JLBA 2P9EA 3C5WP 4WFQA 1TT5A 4YRJA 1KNXA 2BTEA 3UAWA 5TGZA 4EI9A 4I99A 3A26A 3QKUA 1KQGA 5DBFA 1W29A 2XECA 5FBLB 2RB5A 1KKLA 1QO7A 4JODA 4KMMA 3CGGA 3DV0B 4MIYA 2P75A 4NPAA 1AKQA 1REQA 2X4GA 5HCIA 5E9JA 3LGAA 5FLXA 1NHGA 2ZSHA 1WLYA 3ZDDA 2KS6A 5BNFA 1H42A 1H6CA 2Q0XA 2ZPUA 3QVTA 4XLZA 5FBQB 4XQ0A 1VRCA 1Z7YA 1Z38A 5E4JA 1A0OA 2Q2NA 4KO3S 3VMMA 5C7OO 1N2CA 2VFAA 3ISJA 4MAMA 5DNEA 1BWRA 2ZJYA 2FN7A 3AY3A 4MV9A 4DCSA 1A2BA 1X14A 5JMOA 3S81A 2GCOB 1YBFA 3MWDB 3LCUA 5EZSA 1UM9A 3TW4A 1KWGA 1SZPA 3ZD7A 4IRMA 4IZDA 3RVSA 1Z2DA 3EGXA 3WK4A 3CNBA 4FR5A 1CB7A 3TFOA 2NADA 4HT3B 2UYQA 3IOCA 3PEFA 4X94A 3A6LA 1Q1ZA 1KGDA 4H16A 5CLHA 2PBRA 3FZYA 3OUZA 4Q3KA 2H2DA 3OQIA 2Y1WA 3R3HA 1T3HA 1GQFA 5IDQA 2X2OA 2Y1LA 3SQLA 3T0IA 5A6SA 4UXHA 5DX0A 4MOUA 1JTFA 4TM7A 3T88A 5DM4A 2YZMA 4CIWA 3H04A 1MIOB 3KYDA 3ZIUA 2D7DA 2Y77A 2ZE7A 3IAFA 5KOHA 3TLXA 2EV9A 2CCJA 2F6RA 5B1YA 2PQMA 4EECA 5BRAA 2PKQP 4O2AB 4CKCA 1NOIA 2EJCA 2QVBA 3K0EA 4H1UA 2ASVA 3OZXA 4HVTA 4C0QC 1OXUA 2ERCA 5TMBA 5BSKA 3IOEA 5FL7A 1IQPA 2MYTA 5JXWA 4OQEA 4NS1A 1N4DA 1HNXB 4FFWA 2JI4A 2VT2A 2GEFA 1SCUA 2WRZA 1Q16A 4HWPA 3WYAA 4B3TB 5HM8A 5AUQA 1BKYA 3NAQA 2DQSA 4NMMA 1TVKA 2Y1XA 3VH4A 3WB9A 3PC6A 3SPXA 4D02A 3T1HB 4J16C 2Y2UA 4DIEA 4JFAA 4Q7KA 3LC1O 1GRCA 1TUBA 3LUHA 1SOAA 4JCCA 4PM4A 1MO3A 4LY9A 4OXNA 1Y3AA 5JNRA 3CZQA 2G70A 1O0SA 1VE1A 5CJ2A 1KVUA 3K2QA 4GBED 5KTNA 4JC0A 1FYEA 1M1YA 2G82A 2I4RA 3MW8A 3VOBA 1KPGA 4UHDA 3WSVA 4DADA 1QLHA 3E3NA 3I01M 4QKQA 2IU0A 1JG1A 3RU3A 4XSGA 3C3EA 3C3MA 1QF9A 3RSOA 1LZKA 1C9DB 1Y4AE 1Q0SA 4FFPA 1JMVA 2Q5FA 1UMBB 1I9CA 3PWKA 3IP6A 2FPWA 1T5IA 2KSQA 4DA9A 4EY4A 1Z0SA 2E1PA 4M1MA 4BNXA 3FPBA 4ZEMA 5IJ9B 3SEZA 3FYUB 3NETA 5I7AA 1Y89A 4DILA 4EQZA 3ZE2B 1ZXBA 5BN5A 4NCAA 2A0WA 3CNQS 3EVNA 5GZ6A 3QFRA 5ITVA 4B6JA 5AM4A 4RZSA 4Z4GA 2RIRA 3FLBA 2V4ZA 1TQHA 2C9OA 4PSAA 3TQRA 2R9VA 2ERYA 3ESYA 3PWTA 4ZGBA 1HKUA 1QKKA 1UBMS 2PZLA 3LVQE 4B48A 1Z5OA 3T8AA 2QL7A 4B81A 4DLRA 5A4KA 4REQA 1KQOA 2B4RO 2Z98A 4KIUA 5K3OA 4LXTA 1CUCA 3GLHA 1M7GA 3RK1A 3HC7A 2QTLA 4DLSA 3WAGA 4PG7A 4RXTA 4Z5XA 3UGTA 2VDUE 3OF5A 5C4IA 1FMFA 1NU8A 2VZ8A 1JPVA 4TTJA 3E61A 4TQUS 1CXZA 1IBSA 4U3JA 4RORA 2HWKA 1I2MA 1EVYA 3CNEA 4UARA 1IZ9A 4KWTA 1PK7A 1K6EA 2J9XB 1TKBA 5K0BA 1RE0A 4JVLA 2HDHA 2V97A 4JKOA 1JHMA 5ERYA 3WHIA 1TQDA 2ATXA 1B16A 3ONNA 3WNZA 2R8PA 1ZJJA 2HLNA 2QL5A 2QVXX 3PTAA 4B75A 4K2NA 1W25A 4G26A 4JBYA 3MHTA 4DZRA 1W6RA 3KTOA 5CLGA 5CH3A 2C2GA 4PRKA 3N76A 5FLEX 3WLOA 4BX9A 4CTJA 5F7OA 4RWEA 5PNTA 1ZX1A 4UM9D 4H7JA 5C8XA 2IP2A 3KJFA 1UQTA 1PS0A 3ZQ6A 5K8UA 2BGIA 1LFAA 4GE0A 5FT9A 4KPUA 4AJPA 1XKXA 3BA1A 2HUNA 2L0XA 2J3HA 3L1KA 2B99A 1M1UA 3MJEA 1TM5E 2FVXA 2ZJ3A 4OQNA 5EQDA 3QEBZ 4DPKA 4BCDA 4C0JA 3C4JA 1QO9A 3E5RA 3G17A 1ZR4A 2I8CA 4XDZA 3PXBA 5JAQA 1S7GA 3A4YA 1OAAA 5I7HA 1XVAA 4XB6B 2JI7A 3F98A 4RA6A 4BNNA 3JCZA 3B82A 3NT2A 1FMTA 4DRYA 5G1OA 3K70B 4D96A 1SG9A 3C8HA 3ONEA 3QGMA 2H6EA 4IG9A 1OLSB 5A9RA 5E0OA 3IQGX 2UDPA 4F9GA 2EFJA 3HCFA 3HCBA 3VUFA 3A2KA 5C9GA 4G5RA 1OYOA 5A9TA 2GYWA 1GVNB 3UB4A 1T5LA 4BUCA 4ZANA 5KINB 1MVNA 3NGMA 4J6FA 1O6ZA 3LLMA 1YB7A 4UHFA 1ZI6A 3OLXA 1EQ2A 4JXJA 2GDZA 1FPMA 2Y6UA 5CX1B 3SFTA 1C1XA 1HDGO 4PLTA 5KYYB 1YQQA 3V8BA 2HRRA 4JB0A 3OM0A 2AVNA 2IXGA 1SY7A 1UFOA 4U1AA 2Y68A 3ZLTA 5LQRA 3TSOA 5DGTA 4NMLA 5A71A 4R2HA 1BS9A 1GU1A 2KX7A 3CCFA 2J45A 4O1IA 1F9AA 4EKIA 1XNQB 1GKKA 3KT0A 1TJ5A 3U2QA 4UDNA 4UCQA 1XQ6A 2CT8A 1IUPA 2P90A 4HMOA 1PLKA 4Q4DA 3DD1A 4HRXA 3RLFA 1X1EA 1DO2A 2CLLB 3KDPA 2ZXUA 1HRDA 3NWJA 2FLWA 4JNCA 2RH9B 3P4XA 2FMFA 2QU8A 1SD5A 1M8PA 1MEOA 1V3QE 2C4UA 3EEIA 4QAJA 4EKNB 2AWOA 3K9HA 4LHWA 5MFZA 1POWA 2DJIA 5AJHA 4AWBA 4G5YA 4RD3A 3T7JA 2G4CA 3QELB 4N0DA 2XCUA 2OXTA 3AR9A 5HJ5A 1UPFA 3FZQA 3FUUA 4RFLA 4DXDA 4CJXA 1NKTA 3GJYA 3VO9A 1NJ8A 4FSHA 3X3HA 4KGXA 2JCGA 5EJ9A 2G6TA 1SMKA 2JW5A 2OCGA 3AYZB 4H31A 3E7FA 4M21A 4ZJUA 3CPSA 4RADA 3ZQJA 4C3VA 3UGJA 2IZZA 2DQKA 5ICCA 2XGOA 1U9IC 4RANA 3DPSA 4JJEA 4GOKA 4C01A 2CKDA 3IEMA 1TA0A 3O3NB 3ZGLA 1N0WA 1ND5A 2YXDA 1FXWF 1E61A 3KEMA 1N6OA 1KE1A 7ADHA 4N8EA 5JNUA 1M83A 4HNUA 1SKQA 1XF9A 2A5GA 4CHGA 2PG3A 2OG2A 5KOJB 4EJ6A 3I12A 4J0IA 4X95A 3H1BA 3ZYZA 4DIBA 5EIBD 1VZ2A 3MSXA 5TS3A 1IQ0A 3TIFA 4JDUA 3FTPA 1YULA 3EGVA 4Z0PA 4Y9SA 4LE1A 4W8HA 1MX9A 3LUFA 4D4GA 1A5TA 1NVTA 1VDMA 2BEUA 4FYYA 3ZY2A 3VR5A 1JEYA 2I3GA 2RHHA 3HJUA 3QMWA 5JXJA 4NV0A 1U94A 1RWVA 3G68A 3MJDA 3IQIX 1GAWA 3K5PA 1TYAE 1RRGA 4H0CA 4F86A 2ZRFA 1N92A 2YZKA 1DIOB 4G4IA 4ES6A 5KNBH 1GPH1 1COWA 2BDTA 2DP4E 3AF6A 1GQQA 2PLAA 3GN1A 5THXA 2QG4A 1X0VA 1JAIA 4GPD1 2JFQA 2R6AA 4LV6A 4PFSA 1KQFA 1F06A 1G18A 4RQAA 1QGZA 2AN5A 2J9GA 4FEEA 3VBCA 2G28A 4Q16A 1HDYA 2H1FA 3I6QA 4E12A 1JILA 3WKDA 1PFUA 1V26A 3OSZA 1VIMA 1YDFA 4OYHA 4MVJH 5EIAA 4UAJA 1YC2A 2QAJA 2YQ4A 5JTUA 3MSCA 4NEGA 3ET5A 3GYBA 1PGQA 3M6XA 4TTIA 1X7ZA 2AL7A 1ZCZA 2Q1SA 1DS6A 3AEZA 3AZQA 2O05A 2X2FA 5FWYB 3WRWA 3L8FA 4ED9A 3H2GA 4G4SO 1W4RA 2P9QA 4Q0MA 3GEPA 2P1ZA 1WO8A 1TTHA 4KLCA 1QHIA 4BMNA 2Q27A 2Q5EA 1GITA 5AJUA 4OAPA 1CR2A 1T8TA 3UM9A 1TW2A 2EGHA 3EWSA 4EEZA 1MO2A 3FPGA 1FEZA 1ZGZA 3MAJA 2O5RA 4OA8A 2H8GA 3P96A 2PT9A 2D7CA 2C59A 3C4VA 2WFLB 3ORQA 3I45A 4N0EA 2ZYAA 5BN3A 1HT0A 2GPYA 3I8OA 2FUEA 4H7KA 4TVOA 1GEGA 1UAYA 2L18A 4JC8A 2WR8A 1WSBA 2C92A 5A5VA 4LE0A 3BH7A 1YKSA 1P7WA 1EVJA 1K97A 3L18A 4XR4A 1TQ4A 4JOCA 5EP2A 4H7PA 2PUJA 4MGYR 3SG0A 1JEJA 2HV9A 3HO8A 4W6QA 4DBLC 4EYKA 3NVAA 2XXAB 2VYQA 3WNCA 3TIXB 3MXTA 1H0RA 3PX7A 3OA2A 3D5TA 3OUUA 4KH0A 1W8IA 5HILA 1MRSA 3FGZA 1TXGA 1BXRB 5EPUA 3OPNA 1WXGA 2PZFA 5KDOA 1SXJD 3WFJA 1H69A 4DG8A 3SU8A 3HVJA 4KREA 4IIJB 1PNQA 2G7MC 1KP2A 1WCIA 3EVTA 2A9QA 3ZE1B 4UD2A 2NLOA 4PC3A 3O4XE 3LPCA 3PGMA 1NWHA 2AI2A 5JY1A 5K0SA 2FE4A 1FDTA 1JLMA 1OZHA 4HEJA 3OHMA 2OECA 1V71A 1SKYE 2AD5A 3JWHA 9MHTA 3Q87B 5KIAA 3WWPA 1CY0A 1L1RA 3WXBA 2C42A 4H18A 1T36A 3T38A 2ZSJA 2QG9A 2GILA 5SV2A 4Z1MD 1XR3A 3IV9A 4IEFB 1S2LA 5G4KA 2BM0A 1PNTA 4CG3A 1EF9A 2Q49A 2YV3A 4KRYA 1UZAA 2XJ4A 1QNFA 3VHRA 5BQ3A 1BC5A 1QKIA 4B2PA 1M2FA 3K35A 4YP7A 1SJ9A 2F1RA 2RGNA 3A1FA 4AO6A 5JI3E 3L8JA 2JFBA 5F51A 1AKUA 1E2MA 4D0LB 1T9GS 4BLPA 3GGGA 3D7RA 4JELA 2VHVA 2QLMA 3DMHA 5K3CA 4E09A 3PEWA 1Z63A 5F1PA 3CPHA 4NE9A 3BQMB 1OT3A 3IVCA 3WGJA 3GCZA 1UM8A 1KVQA 1UPXA 2WU1A 2OXRA 5FPHA 2CXUA 2LDXA 3STXA 1T5DX 2HV8A 3U5TA 1N25A 2PMFA 4A6XA 4E6PA 1DUSA 4S05A 4YY3B 4ILKA 4AJHA 5FTLA 3JQ8B 4MITA 4F21A 2RHLA 2HGZA 4UBLA 4E2WA 1T4GA 1R1DA 1F51E 3D4OA 3VU1A 3QA9A 4JI4B 3MBKA 2OV8A 4YUYA 4WZAA 5FI0B 1FS6A 1OI4A 2H59A 4ODIA 5CHEA 3WOVA 5JXGA 1D9ZA 4JKYA 1QRUA 4LY0A 5C3UA 2OESA 1ULZA 3GVXA 1BWPA 2WJVA 1FJ2A 1ENPA 2A33A 2D74A 2G04A 3EEYA 4EA7A 1WCIB 1E1LA 1XMPA 2YZ2A 3L6DA 4L2IB 2WIKA 3C3PA 3DMYA 4O2BF 2JCBA 1KH2A 2FMTA 3IT2A 4JI8B 2ABWA 3NBKA 4ZRMA 3IPRA 5IZCC 3N2LA 1XN4A 4IHQA 3F4LA 1MKYA 5UKDA 3EOAI 4N8SA 3O8DA 5C81A 3HXQA 2Q6OA 4JJ7A 4LAFA 1D0SA 1I3NA 3VKWA 1T9KA 4C0WA 5A4MS 2W2NA 1ESMA 4FB4A 1RFGE 3G85A 3K9CA 3FBWA 1V3UA 5ALLA 2FSPA 3DHNA 4DLAA 5JALA 3V1NA 3EGEA 4Z4IA 1AF7A 5EXSA 3T5GA 3QM1A 4XRGA 1ABFA 1E8MA 3SBDA 4BBPA 1NF2A 3OEHA 1JDBB 3FHOA 3OOHA 1OFUA 5F7ZA 2JAOA 3PA8A 4QBFA 5HFJA 4X61A 3FVTA 1X1QA 2WF6A 5BSWA 1ZY2A 1GZVA 2RD2A 4EQ6A 1FU7A 2PV0A 3PT9A 4HBGA 4RM3A 4UHEA 4I8XA 4JLWA 2VJBA 4LGVA 4NK4A 4PS0A 2BFEA 3HLTA 3C6YA 1ZNYA 3K8QA 3OEEA 1NATA 1XTPA 2BF4A 3SC6A 3I61A 4MW7A 5AHRA 2BHTA 4WDQA 2O8FB 3FJ1A 1TM7E 3D54D 2PH7A 1KDYA 4KQEA 3RK0A 4DIFA 1J8QA 1FFAA 4XIYA 5FWYA 1FFXB 1W5SA 2RHJA 3FLMA 4CIVA 3ZDAA 1BU8A 2C82A 3AGPA 2HREA 4LVNA 1RJ9B 1RJDA 1YBAA 3A6FA 4M0EA 3MT7A 2X5OA 3FMFA 1OFHA 2QN3A 3D8BA 2ZLBA 1S8OA 1GDDA 1JEQB 3LLCA 1CQWA 5H0IA 3U3RA 4EKGA 5JO9A 4A91A 4TS1A 5EUQB 2JC3A 1R0SA 3FPLA 5LN1A 1R9GA 1X80A 1NF9A 3PIDA 2G9UA 1SBIA 4UATA 2L42A 2WJYA 1VE7A 2JEOA 3U44A 2OTCA 3Q0TA 3M82A 4OSEA 4PYLA 4A5SA 3GV0A 1AM4D 1YACA 1U8CB 2GD0A 2Q99A 3DAFA 3OZWA 1X2EA 1NR1A 2W2XA 5C5CA 4BPBA 4RZHA 1UEIA 5EESA 3AHDA 4D0NA 2PYIA 2J5XA 1U3UA 4Q3CA 3WLSA 2LXNA 5EJ2A 4PICA 1FTSA 3Q6IA 2QSUA 1H2XA 3DWEX 3TBKA 2Z2ZA 3I73A 1Q50A 3RU7A 3O8QB 3NONA 1MMFB 2JIQA 4G5HA 3AM1A 1FQJA 1XT6A 2Z8XA 4S24A 5EIHA 4YQFA 2BCJQ 3MOYA 2IU6A 4LECA 2PGLA 1HDXA 3GEEA 4QYIA 4UNNA 1Q1AA 4LVUA 3ZDRA 5IYZB 5LNK6 2WJZB 3QSYA 4BLRA 2BFBA 3I6IA 2BSAA 3BD8A 1QYWA 2A9JA 4QPCA 4XQ9A 5FFNA 3V1YA 5ER9A 2PZAA 5CFLA 3D3WA 2W9XA 2AOUA 1FLDA 3CONA 5B1SA 3Q3CA 3VHXB 1EG7A 4JH0A 5LP6C 3P0RA 3M6VA 2ONYA 4D7AA 1IATA 5D3QA 4ZVNA 3N28A 1Q6YA 3EIXA 4BVLA 4KYIB 4ONEA 1QSGA 4HX5A 1JI0A 2HPVA 2JS7A 2IYQA 3ZWMA 2DECA 3PF9A 1G7CA 3QKRB 1CPYA 2A0XA 4JP8A 1NMQA 3EXEA 4PO9A 4NZNA 2XH8A 3ZVKA 3V4RA 1N5LA 4FC6A 4HQOA 4YLGA 1JIKA 1MPXA 2IDZA 4QYXA 5K45A 4UNSA 1M6HA 1WPGA 1RWKA 2FX5A 3SK0A 1Q2XA 1C81A 5BR4A 4KNVA 1KMNA 3H9UA 3K05A 3RM3A 1P2TA 2C07A 1HO3A 3DLCA 4IDCA 3TTWA 3LDGA 4RKWA 1X8JA 4JI7B 4IOMA 1NUTA 1SVNA 3C45A 4J2TA 4P4NA 1ULUA 4BUJA 3S2YA 3ITKA 3BDAA 4JB3A 4W5RA 4HGZA 3ZE6A 4ZDWA 3QZUA 4NBUA 2FG6C 3CKKA 2RGCA 4Y6SA 1VFNA 4S35A 3C6QA 5EI5A 1BRTA 3LX8A 1VB3A 2P68A 3JRWA 3MYBA 1W0JD 1JP7A 2VATA 3A6HA 4JJ8A 4GKVA 3PCTA 1PT8A 3PNBA 2BTOA 3ASZA 4ALNA 4JP2A 2A9PA 2DPHA 2EX0A 4U1RA 3V1UA 1KEZA 2IHNA 2NYRA 1TPZA 3M6UA 2ZRBA 4JB2A 4TUYA 4RH3A 4QYIB 2ONJA 3K5HA 1CUUA 3GT3A 4ZAVA 4LXIA 3MN1A 2C7QA 3BTUA 5BYAA 1NM5C 4CMIA 3LYUA 3DTNA 5FOSA 3B9RA 3TH5A 1MR3F 4M49A 4R83A 1NV9A 2I0FA 3FI9A 4FDMA 4NY1A 4RIGA 4YI5A 3CMCO 4MS3B 2CXPA 3CWCA 3ECSA 3PICA 5K3FA 2PBZA 1L7RA 1T1IA 3FOCA 4LBVA 5E6SB 4QLBA 4US0R 3PE6A 5CLLA 6GPBA 2YJZA 5JJBA 3WTCA 4HH1A 2JIMA 3A6GA 2OOSA 2HWWA 3E7PA 2HXSA 2F1IA 1CK4A 1NFRA 3BFVA 3HV2A 3LH5A 4FLFA 4JSRA 4QUEA 1I14A 1Z36A 5IARA 4DV0B 1QFJA 2WDZA 3SYMA 5AW4A 3OX2A 4XSVA 3QJ5A 4YQYA 3MWLA 4FYVA 1XMXA 3VBEA 4ZQFA 4RPCA 5JROA 1RWMA 1MFZA 3ZDYB 4Q37A 1QP4A 1XTJA 3ZLUA 2NVUA 4QBIA 5DLQC 2DWPA 1JG2A 5E2AA 5HP4A 5K8CA 1W36C 4XVHA 1XIVA 4YQZA 3LIIA 4OFBA 3FCEA 4ZCRA 3ADPA 3C7DB 1KQPA 4UBIA 1PGNA 3ZYCA 5JQGB 1OXXK 4QIIA 2Q6IA 2W7TA 3IP1A 3KAQA 5DDIP 2BFPA 3QI7A 4ER6A 5BXYA 4F6RA 5DN6D 2WJJA 3ANYB 1SKAA 2GFHA 1G41A 2HKIA 3C14C 4NARA 2VYND 1XZMA 2QSZA 5EEGA 2QRNA 4TLLB 4OQZA 4B3XA 1YR9A 4L4RA 4EKDA 5C7YA 3RC2A 3E03A 2VT7A 3JQ9A 4UHBA 1X1AA 3A31A 1THZA 2YJ3A 3PQ7A 4H17A 2XCOA 1G5QA 2O07A 1YDGA 2PRSA 2G63A 3EG9A 4PNHA 4QYMA 3WYCA 5J3JA 5LMUB 1T5SA 4LXUA 3VH1A 1UQRA 3OG9A 4D82A 5JSUA 1Y6GA 1T1JA 5I8PA 5EKUA 1RYZA 3PHCA 3WL6A 4DMGA 1L4UA 2AA3A 4KYVA 2JFPA 3R76A 3P0FA 2Y1GA 4JB8A 5ALMA 1EWKA 1YCFA 5A0VA 3C6XA 5E6UA 3ZY3A 1ZMOA 2AEMA 1RRCA 3IIKA 5KQMA 3IOYA 4MPRA 4JEIA 1NRJB 3BTOA 1QFMA 2D4HA 2YYSA 2QOEA 4B6FA 4X7PA 1I1HA 1VGRA 2BISA 2JIPA 1QAOA 4L4SA 2J3MA 2BGNA 5SICE 4BUZA 4IFEA 4ZTBA 3BGWA 4BO8A 3H6HA 1G6OA 2XITA 2LZ0A 1UXHA 4NJEB 4RS3A 1PWEA 1NI3A 4R5HA 2VPPA 3HYT