3W8IB

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of mst4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
PGSMLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
total genus 29
structure length 67
sequence length 67
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3w8iB00
3RQFA 3L8IA 4GEHB 3L8JA 3W8HB 3RQGA 3W8IB 3RQEA 3AJMA
chains in the Genus database with same CATH superfamily
3FDUA 4FJWD 4NEKA 1UX5A 4OLQA 4QIIA 1UX4A 3AJMA 3SWXA 3G64A 2ZQQA 3RSIA 4JFCA 3W8IB 3H02A 3PZKA 4ELSA 4GEHB 3ADDA 3Q0GA 1DUBA 4I52A 3Q1TA 2FW2A 5JBXA 2HW5A 3HINA 2VREA 4K3WA 2UZFA 1MJ3A 3KQFA 3O4XE 3AM1A 4IZBA 4I42A 3I47A 3H81A 4I4ZA 2PBPA 4JOTA 4JWVA 3W8HB 4F47A 2GTRA 4ZU2A 3RQGA 3R9TA 3A4LA 4U18A 2FBMA 4WCZA 3A4NA 1Q51A 2F6QA 1Y64B 3RQFA 2EJ5A 1Q52A 2PPYA 3T89A 4OG1A 3TRRA 1HZDA 2VX2A 3Q0JA 1RJNA 4MI2A 1DCIA 4IZDA 2P63A 4U19A 2IEXA 2ZQRA 4JYLA 4FZWC 3QXZA 5C9GA 3HRXA 4U1AA 4ELWA 3QK8A 1EF8A 4K2NA 3TLFA 4IZCA 4JCSA 3R0OA 2QQ3A 3MYBA 4KNPA 3QXIA 3IRBA 3OC7A 3P5MA 3MOYA 4MOUA 3T88A 1EY3A 3T8AA 3A4MA 3L8IA 5KJPA 3L8JA 4NNQA 1RJMA 4QIJA 4FZWA 1UIYA 1NZYB 4EMLA 3SLLA 4ELXA 3RQEA 1JXZA 2DUBA 5JBWA 3R9SA 1EF9A 3ADBA 1NZYA 3ADCA 1WZ8A
chains in the Genus database with same CATH topology
1UX5A 3IRBA 3O4XE 3AM1A 3AJMA 1UX4A 2P63A 3A4MA 3L8IA 3L8JA 3W8HB 4NNQA 1RJMA 3RQGA 3W8IB 3A4LA 3A4NA 4GEHB 3ADDA 3RQEA 1Y64B 3RQFA 3ADBA 3ADCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQF A;  3L8I A;  4GEH B;  3L8J A;  3W8H B;  3RQG A;  3W8I B;  3RQE A;  3AJM A; 
#chains in the Genus database with same CATH topology
 3FDU A;  4FJW D;  4NEK A;  1UX5 A;  4OLQ A;  4QII A;  1UX4 A;  3AJM A;  3SWX A;  3G64 A;  2ZQQ A;  3RSI A;  4JFC A;  3W8I B;  3H02 A;  3PZK A;  4ELS A;  4GEH B;  3ADD A;  3Q0G A;  1DUB A;  4I52 A;  3Q1T A;  2FW2 A;  5JBX A;  2HW5 A;  3HIN A;  2VRE A;  4K3W A;  2UZF A;  1MJ3 A;  3KQF A;  3O4X E;  3AM1 A;  4IZB A;  4I42 A;  3I47 A;  3H81 A;  4I4Z A;  2PBP A;  4JOT A;  4JWV A;  3W8H B;  4F47 A;  2GTR A;  4ZU2 A;  3RQG A;  3R9T A;  3A4L A;  4U18 A;  2FBM A;  4WCZ A;  3A4N A;  1Q51 A;  2F6Q A;  1Y64 B;  3RQF A;  2EJ5 A;  1Q52 A;  2PPY A;  3T89 A;  4OG1 A;  3TRR A;  1HZD A;  2VX2 A;  3Q0J A;  1RJN A;  4MI2 A;  1DCI A;  4IZD A;  2P63 A;  4U19 A;  2IEX A;  2ZQR A;  4JYL A;  4FZW C;  3QXZ A;  5C9G A;  3HRX A;  4U1A A;  4ELW A;  3QK8 A;  1EF8 A;  4K2N A;  3TLF A;  4IZC A;  4JCS A;  3R0O A;  2QQ3 A;  3MYB A;  4KNP A;  3QXI A;  3IRB A;  3OC7 A;  3P5M A;  3MOY A;  4MOU A;  3T88 A;  1EY3 A;  3T8A A;  3A4M A;  3L8I A;  5KJP A;  3L8J A;  4NNQ A;  1RJM A;  4QIJ A;  4FZW A;  1UIY A;  1NZY B;  4EML A;  3SLL A;  4ELX A;  3RQE A;  1JXZ A;  2DUB A;  5JBW A;  3R9S A;  1EF9 A;  3ADB A;  1NZY A;  3ADC A;  1WZ8 A; 
#chains in the Genus database with same CATH homology
 1UX5 A;  3IRB A;  3O4X E;  3AM1 A;  3AJM A;  1UX4 A;  2P63 A;  3A4M A;  3L8I A;  3L8J A;  3W8H B;  4NNQ A;  1RJM A;  3RQG A;  3W8I B;  3A4L A;  3A4N A;  4GEH B;  3ADD A;  3RQE A;  1Y64 B;  3RQF A;  3ADB A;  3ADC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...