2Y03A

Turkey beta1 adrenergic receptor with stabilising mutations and bound agonist isoprenaline
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
288
Chain Sequence
AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Agonist and Partial Agonist Action on a Beta1-Adrenergic Receptor
pubmed doi rcsb
molecule keywords BETA-1 ADRENERGIC RECEPTOR
molecule tags Receptor
source organism Meleagris gallopavo
total genus 117
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2y03A00
5B2NA 2YCXA 5H2PA 2YDVA 5JJNA 2J4YA 2X72A 1P8HA 4BWBA 3S3CB 4DAJA 3X3CA 4BUOA 3QAPA 3UTXA 1EHKB 3OAXA 1KMEA 4JR8A 4GP5B 4GRVA 4WW3A 4MD2A 3NSBA 4OV0A 5H2KA 1QKPA 3T45A 2KSBA 4MQSA 5A45A 1VJMA 3QJTB 4MBSA 1KG9A 4HYXA 1QM8A 3SN6R 1BM1A 4G71B 1X0I1 3QBLA 4IAQA 5LWEA 2ZIYA 3EH5B 1R2NA 2M3GA 3UTWA 5A8EA 4Y9HA 1BRDA 1E12A 3BVDB 2PEDA 4PXFA 2YDOA 5H2MA 3OE0A 1XIOA 4BEYA 2HPYA 1C8RA 5AX0A 1S52A 3VI0A 1M0KA 3QJQB 1JV6A 4AMIA 4MQTA 1PXRA 3PXOA 1F88A 1C3WA 5J7AA 5G54A 5BR5A 3UTYA 1S53A 5FJGA 3S8GB 2RH1A 1TN0A 5H2NA 3VG9A 4UG2A 2QPDB 4A4MA 3HANA 3A7KA 5BR2A 2F93A 4IARA 3AYMA 4QI1A 3OE8A 1AT9A 2YCZA 5AX1A 1PXSA 3PQRA 3QJSB 4JKVA 1P8IA 4X32A 1F50A 3X3BA 4BEZA 3NYAA 1JFPA 1H68A 2JAFA 4KLYA 3QJVB 5AWZA 5AHZA 4G72B 1S8LA 2NTWA 3ZPQA 4MD1A 3C9MA 3EH4B 4DJHA 3EMLA 3HAQA 5B6ZA 1L0MA 4FPDA 1S54A 3DDLA 5B6VA 5G36A 1S8JA 1O0AA 4QIDA 5H2OA 4N4YB 3VHZA 1E0PA 4L6RA 4FAAB 5ITCA 5A44A 3VW7A 1X0K1 1GZMA 1IW9A 4BV0A 2AT9A 4G70B 4TL3A 3QBIA 3PDSA 5G2DA 3ZPRA 3UG9A 4J4QA 1PY6A 1C8SA 2Y01A 4HWLA 3HASA 3COCA 2R4SA 5DYSA 1BRXA 5G53A 4IB4A 1F4ZA 1X0SA 3REYA 4X1HA 3V2WA 1QHJA 1GU8A 2YCYA 5B0WA 4PXKA 3VGAA 4LDEA 1Q5JA 3S3BB 3UTVA 1M0LA 1JV7A 4GP4B 1S51A 3EH3B 4G7SB 5H2IA 4DKLA 3KJ6A 3RZEA 3PBLA 4NC3A 3ODUA 2QPEB 2G87A 3NS0A 3AM6A 5B6YA 4L35A 1IXFA 5G28A 5G2CA 1HZXA 4GPOA 5JJJA 5ITEA 2LNLA 4N6HA 3UONA 2I20A 5H2HA 2WJLA 5ETZA 5G2AA 5C1MA 2ZZLA 1MGYA 4X31A 3QBGA 2KS9A 5KKHA 2Z73A 2I35A 2KSAA 3UZAA 1P8UA 3NY8A 1AP9A 4XXJA 5H2JA 4QRYA 3HAPA 4JQ6A 3QAKA 3OE9A 3ZEVA 4WAVA 3UZCA 3CODA 5B35A 4XTNA 1DZEA 4GYCA 4XT1A 5EN0A 1UAZA 3HARA 4HYJA 5F8UA 3OE6A 3AYNA 4KNFA 1H2SA 1M0MA 2R4RA 1IW6A 2VT4A 2JAGA 4N4WA 4FBZA 3MBVA 3HAOA 1XJIA 1GUEA 3QJUB 4EJ4A 2Y02A 2EI4A 4GBRA 3ABWA 4LDOA 3NY9A 1FBBA 1TN5A 3C9LA 5B6WA 4XTOA 4G7QB 2BRDA 4GP8B 3QJRB 1UCQA 4AMJA 2F95A 1R84A 1KGBA 5AZDA 3PWHA 1U19A 3CAPA 1FBKA 5DHGA 5B6XA 3D4SA 2Y00A 4XTLA 4K5YA 2ZFEA 3DQBA 1L9HA 1Q5IA 5AHYA 3QDCA 5DHHA 4UHRA 2NTUA 5H2LA 2I1XA 3S8FB 1CWQA 4EIYA 1XMEB 2I21A 5B34A 2Z55A 4EA3A 3P0GA 1KG8A 2Y03A 3QBKA 4G7RB 2YCWA 1JGJA 1LN6A 2Y04A 1BRRA 3WQJA 3RFMA 3VVKA 4LDLA 3V2YA 1VGOA 4XT3A 5JJEA 2WJKA 4FA7B 5TGZA 3S3DB 1QKOA 2KSYA 4BVNA 2L6XA
chains in the Genus database with same CATH superfamily
5B2NA 2YCXA 5H2PA 2YDVA 5JJNA 2J4YA 2X72A 1P8HA 4BWBA 3S3CB 4DAJA 3X3CA 4BUOA 3QAPA 3UTXA 1EHKB 3OAXA 1KMEA 4JR8A 4GP5B 4GRVA 4WW3A 4MD2A 3NSBA 4OV0A 5H2KA 1QKPA 3T45A 2KSBA 4MQSA 5A45A 1VJMA 3QJTB 4MBSA 1KG9A 4HYXA 1QM8A 3SN6R 1BM1A 4G71B 4DS7E 1X0I1 3QBLA 4IAQA 5LWEA 2ZIYA 3EH5B 1R2NA 2M3GA 3UTWA 5A8EA 4Y9HA 1BRDA 1E12A 3BVDB 2PEDA 4PXFA 2YDOA 5H2MA 3OE0A 1XIOA 4BEYA 2HPYA 1C8RA 5AX0A 1S52A 3VI0A 1M0KA 3QJQB 1JV6A 4AMIA 4MQTA 1PXRA 3PXOA 1F88A 1C3WA 5J7AA 5G54A 5BR5A 3UTYA 1S53A 5FJGA 3S8GB 2RH1A 1TN0A 5H2NA 3VG9A 4UG2A 2QPDB 4A4MA 3HANA 3A7KA 5BR2A 2F93A 4IARA 3AYMA 4QI1A 3OE8A 1AT9A 2YCZA 5AX1A 1PXSA 3PQRA 3QJSB 4JKVA 1P8IA 4X32A 1F50A 3X3BA 4BEZA 3NYAA 1JFPA 1H68A 2JAFA 4KLYA 3QJVB 5AWZA 5AHZA 4G72B 1S8LA 2NTWA 3ZPQA 4MD1A 3C9MA 3EH4B 4DJHA 3EMLA 3HAQA 5B6ZA 1L0MA 4FPDA 1S54A 3DDLA 5B6VA 5G36A 1S8JA 1O0AA 4QIDA 5H2OA 4N4YB 3VHZA 1E0PA 4L6RA 4FAAB 5ITCA 5A44A 3VW7A 1X0K1 1GZMA 1IW9A 4BV0A 2AT9A 4G70B 4TL3A 3QBIA 3PDSA 5G2DA 3ZPRA 3UG9A 4J4QA 1PY6A 1C8SA 2Y01A 4HWLA 3HASA 3COCA 2R4SA 5DYSA 1BRXA 5G53A 4IB4A 1F4ZA 1X0SA 3REYA 4X1HA 3V2WA 1QHJA 1GU8A 2YCYA 5B0WA 4PXKA 3VGAA 4LDEA 1Q5JA 3S3BB 3UTVA 1M0LA 1JV7A 4GP4B 1S51A 3EH3B 4G7SB 5H2IA 4DKLA 3KJ6A 3RZEA 3PBLA 4NC3A 3ODUA 2QPEB 2G87A 3NS0A 3AM6A 5B6YA 4L35A 1IXFA 5G28A 5G2CA 1HZXA 4GPOA 5JJJA 5ITEA 2LNLA 4N6HA 3UONA 2I20A 5H2HA 2WJLA 5ETZA 5G2AA 5C1MA 2ZZLA 1MGYA 4X31A 3QBGA 2KS9A 5KKHA 2Z73A 2I35A 2KSAA 3UZAA 1P8UA 3NY8A 1AP9A 4XXJA 5H2JA 4QRYA 3HAPA 4JQ6A 3QAKA 3OE9A 3ZEVA 4WAVA 3UZCA 3CODA 5B35A 4XTNA 1DZEA 4GYCA 4XT1A 5EN0A 1UAZA 3HARA 4HYJA 5F8UA 3OE6A 3AYNA 4KNFA 1H2SA 1M0MA 2R4RA 1IW6A 2VT4A 2JAGA 4N4WA 4FBZA 3MBVA 3HAOA 1XJIA 1GUEA 3QJUB 4EJ4A 2Y02A 2EI4A 4GBRA 3ABWA 4LDOA 3NY9A 1FBBA 1TN5A 3C9LA 5B6WA 4XTOA 4G7QB 2BRDA 4GP8B 3QJRB 1UCQA 4AMJA 2F95A 1R84A 1KGBA 5AZDA 3PWHA 1U19A 3CAPA 1FBKA 5DHGA 5B6XA 3D4SA 2Y00A 4XTLA 4K5YA 2ZFEA 3DQBA 1L9HA 1Q5IA 5AHYA 3QDCA 5DHHA 4UHRA 2NTUA 5H2LA 2I1XA 3S8FB 1CWQA 4EIYA 1XMEB 2I21A 5B34A 2Z55A 4EA3A 3P0GA 1KG8A 2Y03A 3QBKA 4G7RB 2YCWA 1JGJA 1LN6A 2Y04A 1BRRA 3WQJA 3RFMA 3VVKA 4LDLA 3V2YA 1VGOA 4XT3A 5JJEA 2WJKA 4FA7B 5TGZA 3S3DB 1QKOA 2KSYA 4BVNA 2L6XA
chains in the Genus database with same CATH topology
5B2NA 2YCXA 5H2PA 2YDVA 5JJNA 2J4YA 2X72A 1P8HA 4BWBA 3S3CB 4DAJA 3X3CA 4BUOA 3QAPA 3UTXA 1EHKB 3OAXA 1KMEA 4JR8A 4GP5B 4GRVA 4WW3A 4MD2A 3NSBA 4OV0A 5H2KA 1QKPA 3T45A 2KSBA 4MQSA 5A45A 1VJMA 3QJTB 4MBSA 1KG9A 4HYXA 1QM8A 3SN6R 1BM1A 4G71B 4DS7E 1X0I1 3QBLA 4IAQA 5LWEA 2ZIYA 3EH5B 1R2NA 2M3GA 3UTWA 5A8EA 4Y9HA 1BRDA 1E12A 3BVDB 2PEDA 4PXFA 2YDOA 5H2MA 3OE0A 1XIOA 4BEYA 2HPYA 1C8RA 5AX0A 1S52A 3VI0A 1M0KA 3QJQB 1JV6A 4AMIA 4MQTA 1PXRA 3PXOA 1F88A 1C3WA 5J7AA 5G54A 5BR5A 3UTYA 1S53A 5FJGA 3S8GB 2RH1A 1TN0A 5H2NA 3VG9A 4UG2A 2QPDB 4A4MA 3HANA 3A7KA 5BR2A 2F93A 4IARA 3AYMA 4QI1A 3OE8A 1AT9A 2YCZA 5AX1A 1PXSA 3PQRA 3QJSB 4JKVA 1P8IA 4X32A 1F50A 3X3BA 4BEZA 3NYAA 1JFPA 1H68A 2JAFA 4KLYA 3QJVB 5AWZA 5AHZA 4G72B 1S8LA 2NTWA 3ZPQA 4MD1A 3C9MA 3EH4B 4DJHA 3EMLA 3HAQA 5B6ZA 1L0MA 4FPDA 1S54A 3DDLA 5B6VA 5G36A 1S8JA 1O0AA 4QIDA 5H2OA 4N4YB 3VHZA 1E0PA 4L6RA 4FAAB 5ITCA 5A44A 3VW7A 1X0K1 1GZMA 1IW9A 4BV0A 2AT9A 4G70B 4TL3A 3QBIA 3PDSA 5G2DA 3ZPRA 3UG9A 4J4QA 1PY6A 1C8SA 2Y01A 4HWLA 3HASA 3COCA 2R4SA 5DYSA 1BRXA 5G53A 4IB4A 1F4ZA 1X0SA 3REYA 4X1HA 3V2WA 1QHJA 1GU8A 2YCYA 5B0WA 4PXKA 3VGAA 4LDEA 1Q5JA 3S3BB 3UTVA 1M0LA 1JV7A 4GP4B 1S51A 3EH3B 4G7SB 5H2IA 4DKLA 3KJ6A 3RZEA 3PBLA 4NC3A 3ODUA 2QPEB 2G87A 3NS0A 3AM6A 5B6YA 4L35A 1IXFA 5G28A 5G2CA 1HZXA 4GPOA 5JJJA 5ITEA 2LNLA 4N6HA 3UONA 2I20A 5H2HA 2WJLA 5ETZA 5G2AA 5C1MA 2ZZLA 1MGYA 4X31A 3QBGA 2KS9A 5KKHA 2Z73A 2I35A 2KSAA 3UZAA 1P8UA 3NY8A 1AP9A 4XXJA 5H2JA 4QRYA 3HAPA 4JQ6A 3QAKA 3OE9A 3ZEVA 4WAVA 3UZCA 3CODA 5B35A 4XTNA 1DZEA 4GYCA 4XT1A 5EN0A 1UAZA 3HARA 4HYJA 5F8UA 3OE6A 3AYNA 4KNFA 1H2SA 1M0MA 2R4RA 1IW6A 2VT4A 2JAGA 4N4WA 4FBZA 3MBVA 3HAOA 1XJIA 1GUEA 3QJUB 4EJ4A 2Y02A 2EI4A 4GBRA 3ABWA 4LDOA 3NY9A 1FBBA 1TN5A 3C9LA 5B6WA 4XTOA 4G7QB 2BRDA 4GP8B 3QJRB 1UCQA 4AMJA 2F95A 1R84A 1KGBA 5AZDA 3PWHA 1U19A 3CAPA 1FBKA 5DHGA 5B6XA 3D4SA 2Y00A 4XTLA 4K5YA 2ZFEA 3DQBA 1L9HA 1Q5IA 5AHYA 3QDCA 5DHHA 4UHRA 2NTUA 5H2LA 2I1XA 3S8FB 1CWQA 4EIYA 1XMEB 2I21A 5B34A 2Z55A 4EA3A 3P0GA 1KG8A 2Y03A 3QBKA 4G7RB 2YCWA 1JGJA 1LN6A 2Y04A 1BRRA 3WQJA 3RFMA 3VVKA 4LDLA 3V2YA 1VGOA 4XT3A 5JJEA 2WJKA 4FA7B 5TGZA 3S3DB 1QKOA 2KSYA 4BVNA 2L6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2N A;  2YCX A;  5H2P A;  2YDV A;  5JJN A;  2J4Y A;  2X72 A;  1P8H A;  4BWB A;  3S3C B;  4DAJ A;  3X3C A;  4BUO A;  3QAP A;  3UTX A;  1EHK B;  3OAX A;  1KME A;  4JR8 A;  4GP5 B;  4GRV A;  4WW3 A;  4MD2 A;  3NSB A;  4OV0 A;  5H2K A;  1QKP A;  3T45 A;  2KSB A;  4MQS A;  5A45 A;  1VJM A;  3QJT B;  4MBS A;  1KG9 A;  4HYX A;  1QM8 A;  3SN6 R;  1BM1 A;  4G71 B;  1X0I 1;  3QBL A;  4IAQ A;  5LWE A;  2ZIY A;  3EH5 B;  1R2N A;  2M3G A;  3UTW A;  5A8E A;  4Y9H A;  1BRD A;  1E12 A;  3BVD B;  2PED A;  4PXF A;  2YDO A;  5H2M A;  3OE0 A;  1XIO A;  4BEY A;  2HPY A;  1C8R A;  5AX0 A;  1S52 A;  3VI0 A;  1M0K A;  3QJQ B;  1JV6 A;  4AMI A;  4MQT A;  1PXR A;  3PXO A;  1F88 A;  1C3W A;  5J7A A;  5G54 A;  5BR5 A;  3UTY A;  1S53 A;  5FJG A;  3S8G B;  2RH1 A;  1TN0 A;  5H2N A;  3VG9 A;  4UG2 A;  2QPD B;  4A4M A;  3HAN A;  3A7K A;  5BR2 A;  2F93 A;  4IAR A;  3AYM A;  4QI1 A;  3OE8 A;  1AT9 A;  2YCZ A;  5AX1 A;  1PXS A;  3PQR A;  3QJS B;  4JKV A;  1P8I A;  4X32 A;  1F50 A;  3X3B A;  4BEZ A;  3NYA A;  1JFP A;  1H68 A;  2JAF A;  4KLY A;  3QJV B;  5AWZ A;  5AHZ A;  4G72 B;  1S8L A;  2NTW A;  3ZPQ A;  4MD1 A;  3C9M A;  3EH4 B;  4DJH A;  3EML A;  3HAQ A;  5B6Z A;  1L0M A;  4FPD A;  1S54 A;  3DDL A;  5B6V A;  5G36 A;  1S8J A;  1O0A A;  4QID A;  5H2O A;  4N4Y B;  3VHZ A;  1E0P A;  4L6R A;  4FAA B;  5ITC A;  5A44 A;  3VW7 A;  1X0K 1;  1GZM A;  1IW9 A;  4BV0 A;  2AT9 A;  4G70 B;  4TL3 A;  3QBI A;  3PDS A;  5G2D A;  3ZPR A;  3UG9 A;  4J4Q A;  1PY6 A;  1C8S A;  2Y01 A;  4HWL A;  3HAS A;  3COC A;  2R4S A;  5DYS A;  1BRX A;  5G53 A;  4IB4 A;  1F4Z A;  1X0S A;  3REY A;  4X1H A;  3V2W A;  1QHJ A;  1GU8 A;  2YCY A;  5B0W A;  4PXK A;  3VGA A;  4LDE A;  1Q5J A;  3S3B B;  3UTV A;  1M0L A;  1JV7 A;  4GP4 B;  1S51 A;  3EH3 B;  4G7S B;  5H2I A;  4DKL A;  3KJ6 A;  3RZE A;  3PBL A;  4NC3 A;  3ODU A;  2QPE B;  2G87 A;  3NS0 A;  3AM6 A;  5B6Y A;  4L35 A;  1IXF A;  5G28 A;  5G2C A;  1HZX A;  4GPO A;  5JJJ A;  5ITE A;  2LNL A;  4N6H A;  3UON A;  2I20 A;  5H2H A;  2WJL A;  5ETZ A;  5G2A A;  5C1M A;  2ZZL A;  1MGY A;  4X31 A;  3QBG A;  2KS9 A;  5KKH A;  2Z73 A;  2I35 A;  2KSA A;  3UZA A;  1P8U A;  3NY8 A;  1AP9 A;  4XXJ A;  5H2J A;  4QRY A;  3HAP A;  4JQ6 A;  3QAK A;  3OE9 A;  3ZEV A;  4WAV A;  3UZC A;  3COD A;  5B35 A;  4XTN A;  1DZE A;  4GYC A;  4XT1 A;  5EN0 A;  1UAZ A;  3HAR A;  4HYJ A;  5F8U A;  3OE6 A;  3AYN A;  4KNF A;  1H2S A;  1M0M A;  2R4R A;  1IW6 A;  2VT4 A;  2JAG A;  4N4W A;  4FBZ A;  3MBV A;  3HAO A;  1XJI A;  1GUE A;  3QJU B;  4EJ4 A;  2Y02 A;  2EI4 A;  4GBR A;  3ABW A;  4LDO A;  3NY9 A;  1FBB A;  1TN5 A;  3C9L A;  5B6W A;  4XTO A;  4G7Q B;  2BRD A;  4GP8 B;  3QJR B;  1UCQ A;  4AMJ A;  2F95 A;  1R84 A;  1KGB A;  5AZD A;  3PWH A;  1U19 A;  3CAP A;  1FBK A;  5DHG A;  5B6X A;  3D4S A;  2Y00 A;  4XTL A;  4K5Y A;  2ZFE A;  3DQB A;  1L9H A;  1Q5I A;  5AHY A;  3QDC A;  5DHH A;  4UHR A;  2NTU A;  5H2L A;  2I1X A;  3S8F B;  1CWQ A;  4EIY A;  1XME B;  2I21 A;  5B34 A;  2Z55 A;  4EA3 A;  3P0G A;  1KG8 A;  2Y03 A;  3QBK A;  4G7R B;  2YCW A;  1JGJ A;  1LN6 A;  2Y04 A;  1BRR A;  3WQJ A;  3RFM A;  3VVK A;  4LDL A;  3V2Y A;  1VGO A;  4XT3 A;  5JJE A;  2WJK A;  4FA7 B;  5TGZ A;  3S3D B;  1QKO A;  2KSY A;  4BVN A;  2L6X A; 
#chains in the Genus database with same CATH topology
 5B2N A;  2YCX A;  5H2P A;  2YDV A;  5JJN A;  2J4Y A;  2X72 A;  1P8H A;  4BWB A;  3S3C B;  4DAJ A;  3X3C A;  4BUO A;  3QAP A;  3UTX A;  1EHK B;  3OAX A;  1KME A;  4JR8 A;  4GP5 B;  4GRV A;  4WW3 A;  4MD2 A;  3NSB A;  4OV0 A;  5H2K A;  1QKP A;  3T45 A;  2KSB A;  4MQS A;  5A45 A;  1VJM A;  3QJT B;  4MBS A;  1KG9 A;  4HYX A;  1QM8 A;  3SN6 R;  1BM1 A;  4G71 B;  4DS7 E;  1X0I 1;  3QBL A;  4IAQ A;  5LWE A;  2ZIY A;  3EH5 B;  1R2N A;  2M3G A;  3UTW A;  5A8E A;  4Y9H A;  1BRD A;  1E12 A;  3BVD B;  2PED A;  4PXF A;  2YDO A;  5H2M A;  3OE0 A;  1XIO A;  4BEY A;  2HPY A;  1C8R A;  5AX0 A;  1S52 A;  3VI0 A;  1M0K A;  3QJQ B;  1JV6 A;  4AMI A;  4MQT A;  1PXR A;  3PXO A;  1F88 A;  1C3W A;  5J7A A;  5G54 A;  5BR5 A;  3UTY A;  1S53 A;  5FJG A;  3S8G B;  2RH1 A;  1TN0 A;  5H2N A;  3VG9 A;  4UG2 A;  2QPD B;  4A4M A;  3HAN A;  3A7K A;  5BR2 A;  2F93 A;  4IAR A;  3AYM A;  4QI1 A;  3OE8 A;  1AT9 A;  2YCZ A;  5AX1 A;  1PXS A;  3PQR A;  3QJS B;  4JKV A;  1P8I A;  4X32 A;  1F50 A;  3X3B A;  4BEZ A;  3NYA A;  1JFP A;  1H68 A;  2JAF A;  4KLY A;  3QJV B;  5AWZ A;  5AHZ A;  4G72 B;  1S8L A;  2NTW A;  3ZPQ A;  4MD1 A;  3C9M A;  3EH4 B;  4DJH A;  3EML A;  3HAQ A;  5B6Z A;  1L0M A;  4FPD A;  1S54 A;  3DDL A;  5B6V A;  5G36 A;  1S8J A;  1O0A A;  4QID A;  5H2O A;  4N4Y B;  3VHZ A;  1E0P A;  4L6R A;  4FAA B;  5ITC A;  5A44 A;  3VW7 A;  1X0K 1;  1GZM A;  1IW9 A;  4BV0 A;  2AT9 A;  4G70 B;  4TL3 A;  3QBI A;  3PDS A;  5G2D A;  3ZPR A;  3UG9 A;  4J4Q A;  1PY6 A;  1C8S A;  2Y01 A;  4HWL A;  3HAS A;  3COC A;  2R4S A;  5DYS A;  1BRX A;  5G53 A;  4IB4 A;  1F4Z A;  1X0S A;  3REY A;  4X1H A;  3V2W A;  1QHJ A;  1GU8 A;  2YCY A;  5B0W A;  4PXK A;  3VGA A;  4LDE A;  1Q5J A;  3S3B B;  3UTV A;  1M0L A;  1JV7 A;  4GP4 B;  1S51 A;  3EH3 B;  4G7S B;  5H2I A;  4DKL A;  3KJ6 A;  3RZE A;  3PBL A;  4NC3 A;  3ODU A;  2QPE B;  2G87 A;  3NS0 A;  3AM6 A;  5B6Y A;  4L35 A;  1IXF A;  5G28 A;  5G2C A;  1HZX A;  4GPO A;  5JJJ A;  5ITE A;  2LNL A;  4N6H A;  3UON A;  2I20 A;  5H2H A;  2WJL A;  5ETZ A;  5G2A A;  5C1M A;  2ZZL A;  1MGY A;  4X31 A;  3QBG A;  2KS9 A;  5KKH A;  2Z73 A;  2I35 A;  2KSA A;  3UZA A;  1P8U A;  3NY8 A;  1AP9 A;  4XXJ A;  5H2J A;  4QRY A;  3HAP A;  4JQ6 A;  3QAK A;  3OE9 A;  3ZEV A;  4WAV A;  3UZC A;  3COD A;  5B35 A;  4XTN A;  1DZE A;  4GYC A;  4XT1 A;  5EN0 A;  1UAZ A;  3HAR A;  4HYJ A;  5F8U A;  3OE6 A;  3AYN A;  4KNF A;  1H2S A;  1M0M A;  2R4R A;  1IW6 A;  2VT4 A;  2JAG A;  4N4W A;  4FBZ A;  3MBV A;  3HAO A;  1XJI A;  1GUE A;  3QJU B;  4EJ4 A;  2Y02 A;  2EI4 A;  4GBR A;  3ABW A;  4LDO A;  3NY9 A;  1FBB A;  1TN5 A;  3C9L A;  5B6W A;  4XTO A;  4G7Q B;  2BRD A;  4GP8 B;  3QJR B;  1UCQ A;  4AMJ A;  2F95 A;  1R84 A;  1KGB A;  5AZD A;  3PWH A;  1U19 A;  3CAP A;  1FBK A;  5DHG A;  5B6X A;  3D4S A;  2Y00 A;  4XTL A;  4K5Y A;  2ZFE A;  3DQB A;  1L9H A;  1Q5I A;  5AHY A;  3QDC A;  5DHH A;  4UHR A;  2NTU A;  5H2L A;  2I1X A;  3S8F B;  1CWQ A;  4EIY A;  1XME B;  2I21 A;  5B34 A;  2Z55 A;  4EA3 A;  3P0G A;  1KG8 A;  2Y03 A;  3QBK A;  4G7R B;  2YCW A;  1JGJ A;  1LN6 A;  2Y04 A;  1BRR A;  3WQJ A;  3RFM A;  3VVK A;  4LDL A;  3V2Y A;  1VGO A;  4XT3 A;  5JJE A;  2WJK A;  4FA7 B;  5TGZ A;  3S3D B;  1QKO A;  2KSY A;  4BVN A;  2L6X A; 
#chains in the Genus database with same CATH homology
 5B2N A;  2YCX A;  5H2P A;  2YDV A;  5JJN A;  2J4Y A;  2X72 A;  1P8H A;  4BWB A;  3S3C B;  4DAJ A;  3X3C A;  4BUO A;  3QAP A;  3UTX A;  1EHK B;  3OAX A;  1KME A;  4JR8 A;  4GP5 B;  4GRV A;  4WW3 A;  4MD2 A;  3NSB A;  4OV0 A;  5H2K A;  1QKP A;  3T45 A;  2KSB A;  4MQS A;  5A45 A;  1VJM A;  3QJT B;  4MBS A;  1KG9 A;  4HYX A;  1QM8 A;  3SN6 R;  1BM1 A;  4G71 B;  4DS7 E;  1X0I 1;  3QBL A;  4IAQ A;  5LWE A;  2ZIY A;  3EH5 B;  1R2N A;  2M3G A;  3UTW A;  5A8E A;  4Y9H A;  1BRD A;  1E12 A;  3BVD B;  2PED A;  4PXF A;  2YDO A;  5H2M A;  3OE0 A;  1XIO A;  4BEY A;  2HPY A;  1C8R A;  5AX0 A;  1S52 A;  3VI0 A;  1M0K A;  3QJQ B;  1JV6 A;  4AMI A;  4MQT A;  1PXR A;  3PXO A;  1F88 A;  1C3W A;  5J7A A;  5G54 A;  5BR5 A;  3UTY A;  1S53 A;  5FJG A;  3S8G B;  2RH1 A;  1TN0 A;  5H2N A;  3VG9 A;  4UG2 A;  2QPD B;  4A4M A;  3HAN A;  3A7K A;  5BR2 A;  2F93 A;  4IAR A;  3AYM A;  4QI1 A;  3OE8 A;  1AT9 A;  2YCZ A;  5AX1 A;  1PXS A;  3PQR A;  3QJS B;  4JKV A;  1P8I A;  4X32 A;  1F50 A;  3X3B A;  4BEZ A;  3NYA A;  1JFP A;  1H68 A;  2JAF A;  4KLY A;  3QJV B;  5AWZ A;  5AHZ A;  4G72 B;  1S8L A;  2NTW A;  3ZPQ A;  4MD1 A;  3C9M A;  3EH4 B;  4DJH A;  3EML A;  3HAQ A;  5B6Z A;  1L0M A;  4FPD A;  1S54 A;  3DDL A;  5B6V A;  5G36 A;  1S8J A;  1O0A A;  4QID A;  5H2O A;  4N4Y B;  3VHZ A;  1E0P A;  4L6R A;  4FAA B;  5ITC A;  5A44 A;  3VW7 A;  1X0K 1;  1GZM A;  1IW9 A;  4BV0 A;  2AT9 A;  4G70 B;  4TL3 A;  3QBI A;  3PDS A;  5G2D A;  3ZPR A;  3UG9 A;  4J4Q A;  1PY6 A;  1C8S A;  2Y01 A;  4HWL A;  3HAS A;  3COC A;  2R4S A;  5DYS A;  1BRX A;  5G53 A;  4IB4 A;  1F4Z A;  1X0S A;  3REY A;  4X1H A;  3V2W A;  1QHJ A;  1GU8 A;  2YCY A;  5B0W A;  4PXK A;  3VGA A;  4LDE A;  1Q5J A;  3S3B B;  3UTV A;  1M0L A;  1JV7 A;  4GP4 B;  1S51 A;  3EH3 B;  4G7S B;  5H2I A;  4DKL A;  3KJ6 A;  3RZE A;  3PBL A;  4NC3 A;  3ODU A;  2QPE B;  2G87 A;  3NS0 A;  3AM6 A;  5B6Y A;  4L35 A;  1IXF A;  5G28 A;  5G2C A;  1HZX A;  4GPO A;  5JJJ A;  5ITE A;  2LNL A;  4N6H A;  3UON A;  2I20 A;  5H2H A;  2WJL A;  5ETZ A;  5G2A A;  5C1M A;  2ZZL A;  1MGY A;  4X31 A;  3QBG A;  2KS9 A;  5KKH A;  2Z73 A;  2I35 A;  2KSA A;  3UZA A;  1P8U A;  3NY8 A;  1AP9 A;  4XXJ A;  5H2J A;  4QRY A;  3HAP A;  4JQ6 A;  3QAK A;  3OE9 A;  3ZEV A;  4WAV A;  3UZC A;  3COD A;  5B35 A;  4XTN A;  1DZE A;  4GYC A;  4XT1 A;  5EN0 A;  1UAZ A;  3HAR A;  4HYJ A;  5F8U A;  3OE6 A;  3AYN A;  4KNF A;  1H2S A;  1M0M A;  2R4R A;  1IW6 A;  2VT4 A;  2JAG A;  4N4W A;  4FBZ A;  3MBV A;  3HAO A;  1XJI A;  1GUE A;  3QJU B;  4EJ4 A;  2Y02 A;  2EI4 A;  4GBR A;  3ABW A;  4LDO A;  3NY9 A;  1FBB A;  1TN5 A;  3C9L A;  5B6W A;  4XTO A;  4G7Q B;  2BRD A;  4GP8 B;  3QJR B;  1UCQ A;  4AMJ A;  2F95 A;  1R84 A;  1KGB A;  5AZD A;  3PWH A;  1U19 A;  3CAP A;  1FBK A;  5DHG A;  5B6X A;  3D4S A;  2Y00 A;  4XTL A;  4K5Y A;  2ZFE A;  3DQB A;  1L9H A;  1Q5I A;  5AHY A;  3QDC A;  5DHH A;  4UHR A;  2NTU A;  5H2L A;  2I1X A;  3S8F B;  1CWQ A;  4EIY A;  1XME B;  2I21 A;  5B34 A;  2Z55 A;  4EA3 A;  3P0G A;  1KG8 A;  2Y03 A;  3QBK A;  4G7R B;  2YCW A;  1JGJ A;  1LN6 A;  2Y04 A;  1BRR A;  3WQJ A;  3RFM A;  3VVK A;  4LDL A;  3V2Y A;  1VGO A;  4XT3 A;  5JJE A;  2WJK A;  4FA7 B;  5TGZ A;  3S3D B;  1QKO A;  2KSY A;  4BVN A;  2L6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...