2Y04A

Turkey beta1 adrenergic receptor with stabilising mutations and bound partial agonist salbutamol
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
298
structure length
286
Chain Sequence
AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Agonist and Partial Agonist Action on a Beta1-Adrenergic Receptor
pubmed doi rcsb
molecule keywords BETA-1 ADRENERGIC RECEPTOR
molecule tags Receptor
source organism Meleagris gallopavo
total genus 121
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2y04A00
4WAVA 5BR5A 5LWEA 5G2AA 3S3CB 2QPDB 4MQTA 5AX0A 2HPYA 2I21A 4HYJA 3UONA 1QM8A 4HYXA 1L0MA 3P0GA 4XT1A 3X3BA 3PXOA 4L35A 2KSAA 3T45A 2YDVA 1M0KA 1IXFA 1VJMA 3ODUA 1M0MA 3QJUB 5FJGA 5B35A 4QIDA 3QBGA 5ITEA 5G28A 2Z73A 2KS9A 1S53A 5B6WA 4DJHA 1PY6A 4G72B 3OAXA 1R2NA 2KSBA 1KGBA 1JGJA 1P8UA 4BVNA 5G2DA 5ITCA 4X32A 4JQ6A 1BRXA 5JJNA 1Q5IA 4IARA 4G71B 5G36A 4EIYA 1PXRA 5AZDA 4X31A 2Y00A 1JV7A 3RZEA 2F93A 1PXSA 3ZEVA 3AYNA 4XTNA 2YCZA 1JFPA 3VW7A 1FBBA 1L9HA 3ZPRA 4BUOA 2ZFEA 1HZXA 4JKVA 1QKPA 4FPDA 4L6RA 1O0AA 3PDSA 5B0WA 3DDLA 1Q5JA 3S8FB 1KG9A 5G53A 2YDOA 3ZPQA 5KKHA 3EH4B 2EI4A 3REYA 3EMLA 4FBZA 3NY9A 5B6XA 3EH5B 4GP8B 2ZZLA 2J4YA 1P8IA 4GPOA 5AHYA 3UTXA 3UZAA 4MD1A 3WQJA 3S8GB 4X1HA 4MD2A 3EH3B 2ZIYA 5H2HA 3AM6A 3QBIA 4MQSA 1GZMA 2JAFA 3V2WA 3S3BB 5JJEA 1IW6A 2I1XA 4FAAB 1C3WA 2YCWA 3HARA 1AP9A 4NC3A 4Y9HA 1F4ZA 1S51A 5DYSA 1H68A 4EA3A 3C9MA 1X0K1 4GP4B 4GP5B 2YCYA 1VGOA 3UZCA 4PXFA 3VGAA 1S8JA 3BVDB 4IAQA 4UHRA 4HWLA 5H2MA 4K5YA 3AYMA 1C8SA 1MGYA 2X72A 3VHZA 1IW9A 1QHJA 3HAQA 5TGZA 2QPEB 4N4YB 3HANA 2Y04A 5B34A 5B6ZA 5H2NA 2F95A 4XXJA 1M0LA 1FBKA 2I20A 5H2PA 2WJKA 4OV0A 5F8UA 4G70B 3KJ6A 1S54A 1QKOA 2R4SA 4XTLA 3VG9A 5AX1A 1E0PA 3HASA 2JAGA 2AT9A 5DHHA 3QJRB 1LN6A 3V2YA 1AT9A 2VT4A 1TN0A 1R84A 1TN5A 4WW3A 2RH1A 4AMJA 4AMIA 2LNLA 2G87A 2PEDA 2I35A 5A45A 3RFMA 3OE0A 5H2JA 3QJSB 4QI1A 4DAJA 3VVKA 4LDLA 3D4SA 4G7SB 2BRDA 1UAZA 4BEZA 5C1MA 3X3CA 3UTVA 5B2NA 3QDCA 5J7AA 1UCQA 4BEYA 1DZEA 4G7RB 4IB4A 2WJLA 1S52A 1XMEB 4DKLA 4J4QA 1CWQA 3COCA 4A4MA 1BRRA 5H2IA 5B6VA 3NSBA 5DHGA 3OE9A 5BR2A 1XJIA 4XTOA 3A7KA 3DQBA 3UTWA 2YCXA 4GRVA 3QBLA 4GYCA 3QBKA 4QRYA 1U19A 4XT3A 2NTUA 4MBSA 3UTYA 1BRDA 4BWBA 3OE6A 3NS0A 5B6YA 5JJJA 4TL3A 1C8RA 3S3DB 2Y02A 1GU8A 4N6HA 3SN6R 3UG9A 5ETZA 2Y03A 3QJTB 4G7QB 3NY8A 2Y01A 5A44A 3HAPA 1XIOA 5A8EA 4GBRA 1EHKB 5H2OA 3PWHA 2Z55A 3PBLA 5H2KA 3CODA 3PQRA 4KLYA 3OE8A 3QAKA 3MBVA 4UG2A 1H2SA 3ABWA 4N4WA 2KSYA 2R4RA 4PXKA 1F50A 1P8HA 3C9LA 1X0I1 4JR8A 4KNFA 3QAPA 1JV6A 4BV0A 3CAPA 3HAOA 3VI0A 3QJQB 1BM1A 2L6XA 2NTWA 5AWZA 4LDOA 3QJVB 1KMEA 5EN0A 1KG8A 4FA7B 1X0SA 5H2LA 1GUEA 1E12A 5G2CA 5AHZA 1S8LA 2M3GA 4EJ4A 4LDEA 5G54A 3NYAA 1F88A
chains in the Genus database with same CATH superfamily
4WAVA 5BR5A 5LWEA 5G2AA 3S3CB 2QPDB 4MQTA 5AX0A 2HPYA 2I21A 4HYJA 3UONA 1QM8A 4HYXA 1L0MA 3P0GA 4XT1A 3X3BA 3PXOA 4L35A 2KSAA 3T45A 2YDVA 1M0KA 1IXFA 1VJMA 3ODUA 1M0MA 3QJUB 5FJGA 5B35A 4QIDA 3QBGA 5ITEA 5G28A 2Z73A 2KS9A 1S53A 5B6WA 4DJHA 1PY6A 4G72B 3OAXA 1R2NA 2KSBA 1KGBA 1JGJA 1P8UA 4BVNA 5G2DA 5ITCA 4X32A 4JQ6A 1BRXA 5JJNA 1Q5IA 4IARA 4G71B 5G36A 4EIYA 1PXRA 5AZDA 4X31A 2Y00A 1JV7A 3RZEA 2F93A 1PXSA 3ZEVA 3AYNA 4XTNA 2YCZA 1JFPA 3VW7A 1FBBA 1L9HA 3ZPRA 4BUOA 2ZFEA 1HZXA 4JKVA 1QKPA 4FPDA 4L6RA 1O0AA 3PDSA 5B0WA 3DDLA 1Q5JA 3S8FB 1KG9A 5G53A 2YDOA 3ZPQA 5KKHA 3EH4B 2EI4A 3REYA 3EMLA 4FBZA 3NY9A 5B6XA 3EH5B 4GP8B 2ZZLA 2J4YA 1P8IA 4GPOA 4DS7E 5AHYA 3UTXA 3UZAA 4MD1A 3WQJA 3S8GB 4X1HA 4MD2A 3EH3B 2ZIYA 5H2HA 3AM6A 3QBIA 4MQSA 1GZMA 2JAFA 3V2WA 3S3BB 5JJEA 1IW6A 2I1XA 4FAAB 1C3WA 2YCWA 3HARA 1AP9A 4NC3A 4Y9HA 1F4ZA 1S51A 5DYSA 1H68A 4EA3A 3C9MA 1X0K1 4GP4B 4GP5B 2YCYA 1VGOA 3UZCA 4PXFA 3VGAA 1S8JA 3BVDB 4IAQA 4UHRA 4HWLA 5H2MA 4K5YA 3AYMA 1C8SA 1MGYA 2X72A 3VHZA 1IW9A 1QHJA 3HAQA 5TGZA 2QPEB 4N4YB 3HANA 2Y04A 5B34A 5B6ZA 5H2NA 2F95A 4XXJA 1M0LA 1FBKA 2I20A 5H2PA 2WJKA 4OV0A 5F8UA 4G70B 3KJ6A 1S54A 1QKOA 2R4SA 4XTLA 3VG9A 5AX1A 1E0PA 3HASA 2JAGA 2AT9A 5DHHA 3QJRB 1LN6A 3V2YA 1AT9A 2VT4A 1TN0A 1R84A 1TN5A 4WW3A 2RH1A 4AMJA 4AMIA 2LNLA 2G87A 2PEDA 2I35A 5A45A 3RFMA 3OE0A 5H2JA 3QJSB 4QI1A 4DAJA 3VVKA 4LDLA 3D4SA 4G7SB 2BRDA 1UAZA 4BEZA 5C1MA 3X3CA 3UTVA 5B2NA 3QDCA 5J7AA 1UCQA 4BEYA 1DZEA 4G7RB 4IB4A 2WJLA 1S52A 1XMEB 4DKLA 4J4QA 1CWQA 3COCA 4A4MA 1BRRA 5H2IA 5B6VA 3NSBA 5DHGA 3OE9A 5BR2A 1XJIA 4XTOA 3A7KA 3DQBA 3UTWA 2YCXA 4GRVA 3QBLA 4GYCA 3QBKA 4QRYA 1U19A 4XT3A 2NTUA 4MBSA 3UTYA 1BRDA 4BWBA 3OE6A 3NS0A 5B6YA 5JJJA 4TL3A 1C8RA 3S3DB 2Y02A 1GU8A 4N6HA 3SN6R 3UG9A 5ETZA 2Y03A 3QJTB 4G7QB 3NY8A 2Y01A 5A44A 3HAPA 1XIOA 5A8EA 4GBRA 1EHKB 5H2OA 3PWHA 2Z55A 3PBLA 5H2KA 3CODA 3PQRA 4KLYA 3OE8A 3QAKA 3MBVA 4UG2A 1H2SA 3ABWA 4N4WA 2KSYA 2R4RA 4PXKA 1F50A 1P8HA 3C9LA 1X0I1 4JR8A 4KNFA 3QAPA 1JV6A 4BV0A 3CAPA 3HAOA 3VI0A 3QJQB 1BM1A 2L6XA 2NTWA 5AWZA 4LDOA 3QJVB 1KMEA 5EN0A 1KG8A 4FA7B 1X0SA 5H2LA 1GUEA 1E12A 5G2CA 5AHZA 1S8LA 2M3GA 4EJ4A 4LDEA 5G54A 3NYAA 1F88A
chains in the Genus database with same CATH topology
4WAVA 5BR5A 5LWEA 5G2AA 3S3CB 2QPDB 4MQTA 5AX0A 2HPYA 2I21A 4HYJA 3UONA 1QM8A 4HYXA 1L0MA 3P0GA 4XT1A 3X3BA 3PXOA 4L35A 2KSAA 3T45A 2YDVA 1M0KA 1IXFA 1VJMA 3ODUA 1M0MA 3QJUB 5FJGA 5B35A 4QIDA 3QBGA 5ITEA 5G28A 2Z73A 2KS9A 1S53A 5B6WA 4DJHA 1PY6A 4G72B 3OAXA 1R2NA 2KSBA 1KGBA 1JGJA 1P8UA 4BVNA 5G2DA 5ITCA 4X32A 4JQ6A 1BRXA 5JJNA 1Q5IA 4IARA 4G71B 5G36A 4EIYA 1PXRA 5AZDA 4X31A 2Y00A 1JV7A 3RZEA 2F93A 1PXSA 3ZEVA 3AYNA 4XTNA 2YCZA 1JFPA 3VW7A 1FBBA 1L9HA 3ZPRA 4BUOA 2ZFEA 1HZXA 4JKVA 1QKPA 4FPDA 4L6RA 1O0AA 3PDSA 5B0WA 3DDLA 1Q5JA 3S8FB 1KG9A 5G53A 2YDOA 3ZPQA 5KKHA 3EH4B 2EI4A 3REYA 3EMLA 4FBZA 3NY9A 5B6XA 3EH5B 4GP8B 2ZZLA 2J4YA 1P8IA 4GPOA 4DS7E 5AHYA 3UTXA 3UZAA 4MD1A 3WQJA 3S8GB 4X1HA 4MD2A 3EH3B 2ZIYA 5H2HA 3AM6A 3QBIA 4MQSA 1GZMA 2JAFA 3V2WA 3S3BB 5JJEA 1IW6A 2I1XA 4FAAB 1C3WA 2YCWA 3HARA 1AP9A 4NC3A 4Y9HA 1F4ZA 1S51A 5DYSA 1H68A 4EA3A 3C9MA 1X0K1 4GP4B 4GP5B 2YCYA 1VGOA 3UZCA 4PXFA 3VGAA 1S8JA 3BVDB 4IAQA 4UHRA 4HWLA 5H2MA 4K5YA 3AYMA 1C8SA 1MGYA 2X72A 3VHZA 1IW9A 1QHJA 3HAQA 5TGZA 2QPEB 4N4YB 3HANA 2Y04A 5B34A 5B6ZA 5H2NA 2F95A 4XXJA 1M0LA 1FBKA 2I20A 5H2PA 2WJKA 4OV0A 5F8UA 4G70B 3KJ6A 1S54A 1QKOA 2R4SA 4XTLA 3VG9A 5AX1A 1E0PA 3HASA 2JAGA 2AT9A 5DHHA 3QJRB 1LN6A 3V2YA 1AT9A 2VT4A 1TN0A 1R84A 1TN5A 4WW3A 2RH1A 4AMJA 4AMIA 2LNLA 2G87A 2PEDA 2I35A 5A45A 3RFMA 3OE0A 5H2JA 3QJSB 4QI1A 4DAJA 3VVKA 4LDLA 3D4SA 4G7SB 2BRDA 1UAZA 4BEZA 5C1MA 3X3CA 3UTVA 5B2NA 3QDCA 5J7AA 1UCQA 4BEYA 1DZEA 4G7RB 4IB4A 2WJLA 1S52A 1XMEB 4DKLA 4J4QA 1CWQA 3COCA 4A4MA 1BRRA 5H2IA 5B6VA 3NSBA 5DHGA 3OE9A 5BR2A 1XJIA 4XTOA 3A7KA 3DQBA 3UTWA 2YCXA 4GRVA 3QBLA 4GYCA 3QBKA 4QRYA 1U19A 4XT3A 2NTUA 4MBSA 3UTYA 1BRDA 4BWBA 3OE6A 3NS0A 5B6YA 5JJJA 4TL3A 1C8RA 3S3DB 2Y02A 1GU8A 4N6HA 3SN6R 3UG9A 5ETZA 2Y03A 3QJTB 4G7QB 3NY8A 2Y01A 5A44A 3HAPA 1XIOA 5A8EA 4GBRA 1EHKB 5H2OA 3PWHA 2Z55A 3PBLA 5H2KA 3CODA 3PQRA 4KLYA 3OE8A 3QAKA 3MBVA 4UG2A 1H2SA 3ABWA 4N4WA 2KSYA 2R4RA 4PXKA 1F50A 1P8HA 3C9LA 1X0I1 4JR8A 4KNFA 3QAPA 1JV6A 4BV0A 3CAPA 3HAOA 3VI0A 3QJQB 1BM1A 2L6XA 2NTWA 5AWZA 4LDOA 3QJVB 1KMEA 5EN0A 1KG8A 4FA7B 1X0SA 5H2LA 1GUEA 1E12A 5G2CA 5AHZA 1S8LA 2M3GA 4EJ4A 4LDEA 5G54A 3NYAA 1F88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAV A;  5BR5 A;  5LWE A;  5G2A A;  3S3C B;  2QPD B;  4MQT A;  5AX0 A;  2HPY A;  2I21 A;  4HYJ A;  3UON A;  1QM8 A;  4HYX A;  1L0M A;  3P0G A;  4XT1 A;  3X3B A;  3PXO A;  4L35 A;  2KSA A;  3T45 A;  2YDV A;  1M0K A;  1IXF A;  1VJM A;  3ODU A;  1M0M A;  3QJU B;  5FJG A;  5B35 A;  4QID A;  3QBG A;  5ITE A;  5G28 A;  2Z73 A;  2KS9 A;  1S53 A;  5B6W A;  4DJH A;  1PY6 A;  4G72 B;  3OAX A;  1R2N A;  2KSB A;  1KGB A;  1JGJ A;  1P8U A;  4BVN A;  5G2D A;  5ITC A;  4X32 A;  4JQ6 A;  1BRX A;  5JJN A;  1Q5I A;  4IAR A;  4G71 B;  5G36 A;  4EIY A;  1PXR A;  5AZD A;  4X31 A;  2Y00 A;  1JV7 A;  3RZE A;  2F93 A;  1PXS A;  3ZEV A;  3AYN A;  4XTN A;  2YCZ A;  1JFP A;  3VW7 A;  1FBB A;  1L9H A;  3ZPR A;  4BUO A;  2ZFE A;  1HZX A;  4JKV A;  1QKP A;  4FPD A;  4L6R A;  1O0A A;  3PDS A;  5B0W A;  3DDL A;  1Q5J A;  3S8F B;  1KG9 A;  5G53 A;  2YDO A;  3ZPQ A;  5KKH A;  3EH4 B;  2EI4 A;  3REY A;  3EML A;  4FBZ A;  3NY9 A;  5B6X A;  3EH5 B;  4GP8 B;  2ZZL A;  2J4Y A;  1P8I A;  4GPO A;  5AHY A;  3UTX A;  3UZA A;  4MD1 A;  3WQJ A;  3S8G B;  4X1H A;  4MD2 A;  3EH3 B;  2ZIY A;  5H2H A;  3AM6 A;  3QBI A;  4MQS A;  1GZM A;  2JAF A;  3V2W A;  3S3B B;  5JJE A;  1IW6 A;  2I1X A;  4FAA B;  1C3W A;  2YCW A;  3HAR A;  1AP9 A;  4NC3 A;  4Y9H A;  1F4Z A;  1S51 A;  5DYS A;  1H68 A;  4EA3 A;  3C9M A;  1X0K 1;  4GP4 B;  4GP5 B;  2YCY A;  1VGO A;  3UZC A;  4PXF A;  3VGA A;  1S8J A;  3BVD B;  4IAQ A;  4UHR A;  4HWL A;  5H2M A;  4K5Y A;  3AYM A;  1C8S A;  1MGY A;  2X72 A;  3VHZ A;  1IW9 A;  1QHJ A;  3HAQ A;  5TGZ A;  2QPE B;  4N4Y B;  3HAN A;  2Y04 A;  5B34 A;  5B6Z A;  5H2N A;  2F95 A;  4XXJ A;  1M0L A;  1FBK A;  2I20 A;  5H2P A;  2WJK A;  4OV0 A;  5F8U A;  4G70 B;  3KJ6 A;  1S54 A;  1QKO A;  2R4S A;  4XTL A;  3VG9 A;  5AX1 A;  1E0P A;  3HAS A;  2JAG A;  2AT9 A;  5DHH A;  3QJR B;  1LN6 A;  3V2Y A;  1AT9 A;  2VT4 A;  1TN0 A;  1R84 A;  1TN5 A;  4WW3 A;  2RH1 A;  4AMJ A;  4AMI A;  2LNL A;  2G87 A;  2PED A;  2I35 A;  5A45 A;  3RFM A;  3OE0 A;  5H2J A;  3QJS B;  4QI1 A;  4DAJ A;  3VVK A;  4LDL A;  3D4S A;  4G7S B;  2BRD A;  1UAZ A;  4BEZ A;  5C1M A;  3X3C A;  3UTV A;  5B2N A;  3QDC A;  5J7A A;  1UCQ A;  4BEY A;  1DZE A;  4G7R B;  4IB4 A;  2WJL A;  1S52 A;  1XME B;  4DKL A;  4J4Q A;  1CWQ A;  3COC A;  4A4M A;  1BRR A;  5H2I A;  5B6V A;  3NSB A;  5DHG A;  3OE9 A;  5BR2 A;  1XJI A;  4XTO A;  3A7K A;  3DQB A;  3UTW A;  2YCX A;  4GRV A;  3QBL A;  4GYC A;  3QBK A;  4QRY A;  1U19 A;  4XT3 A;  2NTU A;  4MBS A;  3UTY A;  1BRD A;  4BWB A;  3OE6 A;  3NS0 A;  5B6Y A;  5JJJ A;  4TL3 A;  1C8R A;  3S3D B;  2Y02 A;  1GU8 A;  4N6H A;  3SN6 R;  3UG9 A;  5ETZ A;  2Y03 A;  3QJT B;  4G7Q B;  3NY8 A;  2Y01 A;  5A44 A;  3HAP A;  1XIO A;  5A8E A;  4GBR A;  1EHK B;  5H2O A;  3PWH A;  2Z55 A;  3PBL A;  5H2K A;  3COD A;  3PQR A;  4KLY A;  3OE8 A;  3QAK A;  3MBV A;  4UG2 A;  1H2S A;  3ABW A;  4N4W A;  2KSY A;  2R4R A;  4PXK A;  1F50 A;  1P8H A;  3C9L A;  1X0I 1;  4JR8 A;  4KNF A;  3QAP A;  1JV6 A;  4BV0 A;  3CAP A;  3HAO A;  3VI0 A;  3QJQ B;  1BM1 A;  2L6X A;  2NTW A;  5AWZ A;  4LDO A;  3QJV B;  1KME A;  5EN0 A;  1KG8 A;  4FA7 B;  1X0S A;  5H2L A;  1GUE A;  1E12 A;  5G2C A;  5AHZ A;  1S8L A;  2M3G A;  4EJ4 A;  4LDE A;  5G54 A;  3NYA A;  1F88 A; 
#chains in the Genus database with same CATH topology
 4WAV A;  5BR5 A;  5LWE A;  5G2A A;  3S3C B;  2QPD B;  4MQT A;  5AX0 A;  2HPY A;  2I21 A;  4HYJ A;  3UON A;  1QM8 A;  4HYX A;  1L0M A;  3P0G A;  4XT1 A;  3X3B A;  3PXO A;  4L35 A;  2KSA A;  3T45 A;  2YDV A;  1M0K A;  1IXF A;  1VJM A;  3ODU A;  1M0M A;  3QJU B;  5FJG A;  5B35 A;  4QID A;  3QBG A;  5ITE A;  5G28 A;  2Z73 A;  2KS9 A;  1S53 A;  5B6W A;  4DJH A;  1PY6 A;  4G72 B;  3OAX A;  1R2N A;  2KSB A;  1KGB A;  1JGJ A;  1P8U A;  4BVN A;  5G2D A;  5ITC A;  4X32 A;  4JQ6 A;  1BRX A;  5JJN A;  1Q5I A;  4IAR A;  4G71 B;  5G36 A;  4EIY A;  1PXR A;  5AZD A;  4X31 A;  2Y00 A;  1JV7 A;  3RZE A;  2F93 A;  1PXS A;  3ZEV A;  3AYN A;  4XTN A;  2YCZ A;  1JFP A;  3VW7 A;  1FBB A;  1L9H A;  3ZPR A;  4BUO A;  2ZFE A;  1HZX A;  4JKV A;  1QKP A;  4FPD A;  4L6R A;  1O0A A;  3PDS A;  5B0W A;  3DDL A;  1Q5J A;  3S8F B;  1KG9 A;  5G53 A;  2YDO A;  3ZPQ A;  5KKH A;  3EH4 B;  2EI4 A;  3REY A;  3EML A;  4FBZ A;  3NY9 A;  5B6X A;  3EH5 B;  4GP8 B;  2ZZL A;  2J4Y A;  1P8I A;  4GPO A;  4DS7 E;  5AHY A;  3UTX A;  3UZA A;  4MD1 A;  3WQJ A;  3S8G B;  4X1H A;  4MD2 A;  3EH3 B;  2ZIY A;  5H2H A;  3AM6 A;  3QBI A;  4MQS A;  1GZM A;  2JAF A;  3V2W A;  3S3B B;  5JJE A;  1IW6 A;  2I1X A;  4FAA B;  1C3W A;  2YCW A;  3HAR A;  1AP9 A;  4NC3 A;  4Y9H A;  1F4Z A;  1S51 A;  5DYS A;  1H68 A;  4EA3 A;  3C9M A;  1X0K 1;  4GP4 B;  4GP5 B;  2YCY A;  1VGO A;  3UZC A;  4PXF A;  3VGA A;  1S8J A;  3BVD B;  4IAQ A;  4UHR A;  4HWL A;  5H2M A;  4K5Y A;  3AYM A;  1C8S A;  1MGY A;  2X72 A;  3VHZ A;  1IW9 A;  1QHJ A;  3HAQ A;  5TGZ A;  2QPE B;  4N4Y B;  3HAN A;  2Y04 A;  5B34 A;  5B6Z A;  5H2N A;  2F95 A;  4XXJ A;  1M0L A;  1FBK A;  2I20 A;  5H2P A;  2WJK A;  4OV0 A;  5F8U A;  4G70 B;  3KJ6 A;  1S54 A;  1QKO A;  2R4S A;  4XTL A;  3VG9 A;  5AX1 A;  1E0P A;  3HAS A;  2JAG A;  2AT9 A;  5DHH A;  3QJR B;  1LN6 A;  3V2Y A;  1AT9 A;  2VT4 A;  1TN0 A;  1R84 A;  1TN5 A;  4WW3 A;  2RH1 A;  4AMJ A;  4AMI A;  2LNL A;  2G87 A;  2PED A;  2I35 A;  5A45 A;  3RFM A;  3OE0 A;  5H2J A;  3QJS B;  4QI1 A;  4DAJ A;  3VVK A;  4LDL A;  3D4S A;  4G7S B;  2BRD A;  1UAZ A;  4BEZ A;  5C1M A;  3X3C A;  3UTV A;  5B2N A;  3QDC A;  5J7A A;  1UCQ A;  4BEY A;  1DZE A;  4G7R B;  4IB4 A;  2WJL A;  1S52 A;  1XME B;  4DKL A;  4J4Q A;  1CWQ A;  3COC A;  4A4M A;  1BRR A;  5H2I A;  5B6V A;  3NSB A;  5DHG A;  3OE9 A;  5BR2 A;  1XJI A;  4XTO A;  3A7K A;  3DQB A;  3UTW A;  2YCX A;  4GRV A;  3QBL A;  4GYC A;  3QBK A;  4QRY A;  1U19 A;  4XT3 A;  2NTU A;  4MBS A;  3UTY A;  1BRD A;  4BWB A;  3OE6 A;  3NS0 A;  5B6Y A;  5JJJ A;  4TL3 A;  1C8R A;  3S3D B;  2Y02 A;  1GU8 A;  4N6H A;  3SN6 R;  3UG9 A;  5ETZ A;  2Y03 A;  3QJT B;  4G7Q B;  3NY8 A;  2Y01 A;  5A44 A;  3HAP A;  1XIO A;  5A8E A;  4GBR A;  1EHK B;  5H2O A;  3PWH A;  2Z55 A;  3PBL A;  5H2K A;  3COD A;  3PQR A;  4KLY A;  3OE8 A;  3QAK A;  3MBV A;  4UG2 A;  1H2S A;  3ABW A;  4N4W A;  2KSY A;  2R4R A;  4PXK A;  1F50 A;  1P8H A;  3C9L A;  1X0I 1;  4JR8 A;  4KNF A;  3QAP A;  1JV6 A;  4BV0 A;  3CAP A;  3HAO A;  3VI0 A;  3QJQ B;  1BM1 A;  2L6X A;  2NTW A;  5AWZ A;  4LDO A;  3QJV B;  1KME A;  5EN0 A;  1KG8 A;  4FA7 B;  1X0S A;  5H2L A;  1GUE A;  1E12 A;  5G2C A;  5AHZ A;  1S8L A;  2M3G A;  4EJ4 A;  4LDE A;  5G54 A;  3NYA A;  1F88 A; 
#chains in the Genus database with same CATH homology
 4WAV A;  5BR5 A;  5LWE A;  5G2A A;  3S3C B;  2QPD B;  4MQT A;  5AX0 A;  2HPY A;  2I21 A;  4HYJ A;  3UON A;  1QM8 A;  4HYX A;  1L0M A;  3P0G A;  4XT1 A;  3X3B A;  3PXO A;  4L35 A;  2KSA A;  3T45 A;  2YDV A;  1M0K A;  1IXF A;  1VJM A;  3ODU A;  1M0M A;  3QJU B;  5FJG A;  5B35 A;  4QID A;  3QBG A;  5ITE A;  5G28 A;  2Z73 A;  2KS9 A;  1S53 A;  5B6W A;  4DJH A;  1PY6 A;  4G72 B;  3OAX A;  1R2N A;  2KSB A;  1KGB A;  1JGJ A;  1P8U A;  4BVN A;  5G2D A;  5ITC A;  4X32 A;  4JQ6 A;  1BRX A;  5JJN A;  1Q5I A;  4IAR A;  4G71 B;  5G36 A;  4EIY A;  1PXR A;  5AZD A;  4X31 A;  2Y00 A;  1JV7 A;  3RZE A;  2F93 A;  1PXS A;  3ZEV A;  3AYN A;  4XTN A;  2YCZ A;  1JFP A;  3VW7 A;  1FBB A;  1L9H A;  3ZPR A;  4BUO A;  2ZFE A;  1HZX A;  4JKV A;  1QKP A;  4FPD A;  4L6R A;  1O0A A;  3PDS A;  5B0W A;  3DDL A;  1Q5J A;  3S8F B;  1KG9 A;  5G53 A;  2YDO A;  3ZPQ A;  5KKH A;  3EH4 B;  2EI4 A;  3REY A;  3EML A;  4FBZ A;  3NY9 A;  5B6X A;  3EH5 B;  4GP8 B;  2ZZL A;  2J4Y A;  1P8I A;  4GPO A;  4DS7 E;  5AHY A;  3UTX A;  3UZA A;  4MD1 A;  3WQJ A;  3S8G B;  4X1H A;  4MD2 A;  3EH3 B;  2ZIY A;  5H2H A;  3AM6 A;  3QBI A;  4MQS A;  1GZM A;  2JAF A;  3V2W A;  3S3B B;  5JJE A;  1IW6 A;  2I1X A;  4FAA B;  1C3W A;  2YCW A;  3HAR A;  1AP9 A;  4NC3 A;  4Y9H A;  1F4Z A;  1S51 A;  5DYS A;  1H68 A;  4EA3 A;  3C9M A;  1X0K 1;  4GP4 B;  4GP5 B;  2YCY A;  1VGO A;  3UZC A;  4PXF A;  3VGA A;  1S8J A;  3BVD B;  4IAQ A;  4UHR A;  4HWL A;  5H2M A;  4K5Y A;  3AYM A;  1C8S A;  1MGY A;  2X72 A;  3VHZ A;  1IW9 A;  1QHJ A;  3HAQ A;  5TGZ A;  2QPE B;  4N4Y B;  3HAN A;  2Y04 A;  5B34 A;  5B6Z A;  5H2N A;  2F95 A;  4XXJ A;  1M0L A;  1FBK A;  2I20 A;  5H2P A;  2WJK A;  4OV0 A;  5F8U A;  4G70 B;  3KJ6 A;  1S54 A;  1QKO A;  2R4S A;  4XTL A;  3VG9 A;  5AX1 A;  1E0P A;  3HAS A;  2JAG A;  2AT9 A;  5DHH A;  3QJR B;  1LN6 A;  3V2Y A;  1AT9 A;  2VT4 A;  1TN0 A;  1R84 A;  1TN5 A;  4WW3 A;  2RH1 A;  4AMJ A;  4AMI A;  2LNL A;  2G87 A;  2PED A;  2I35 A;  5A45 A;  3RFM A;  3OE0 A;  5H2J A;  3QJS B;  4QI1 A;  4DAJ A;  3VVK A;  4LDL A;  3D4S A;  4G7S B;  2BRD A;  1UAZ A;  4BEZ A;  5C1M A;  3X3C A;  3UTV A;  5B2N A;  3QDC A;  5J7A A;  1UCQ A;  4BEY A;  1DZE A;  4G7R B;  4IB4 A;  2WJL A;  1S52 A;  1XME B;  4DKL A;  4J4Q A;  1CWQ A;  3COC A;  4A4M A;  1BRR A;  5H2I A;  5B6V A;  3NSB A;  5DHG A;  3OE9 A;  5BR2 A;  1XJI A;  4XTO A;  3A7K A;  3DQB A;  3UTW A;  2YCX A;  4GRV A;  3QBL A;  4GYC A;  3QBK A;  4QRY A;  1U19 A;  4XT3 A;  2NTU A;  4MBS A;  3UTY A;  1BRD A;  4BWB A;  3OE6 A;  3NS0 A;  5B6Y A;  5JJJ A;  4TL3 A;  1C8R A;  3S3D B;  2Y02 A;  1GU8 A;  4N6H A;  3SN6 R;  3UG9 A;  5ETZ A;  2Y03 A;  3QJT B;  4G7Q B;  3NY8 A;  2Y01 A;  5A44 A;  3HAP A;  1XIO A;  5A8E A;  4GBR A;  1EHK B;  5H2O A;  3PWH A;  2Z55 A;  3PBL A;  5H2K A;  3COD A;  3PQR A;  4KLY A;  3OE8 A;  3QAK A;  3MBV A;  4UG2 A;  1H2S A;  3ABW A;  4N4W A;  2KSY A;  2R4R A;  4PXK A;  1F50 A;  1P8H A;  3C9L A;  1X0I 1;  4JR8 A;  4KNF A;  3QAP A;  1JV6 A;  4BV0 A;  3CAP A;  3HAO A;  3VI0 A;  3QJQ B;  1BM1 A;  2L6X A;  2NTW A;  5AWZ A;  4LDO A;  3QJV B;  1KME A;  5EN0 A;  1KG8 A;  4FA7 B;  1X0S A;  5H2L A;  1GUE A;  1E12 A;  5G2C A;  5AHZ A;  1S8L A;  2M3G A;  4EJ4 A;  4LDE A;  5G54 A;  3NYA A;  1F88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...