2YCXA

Turkey beta1 adrenergic receptor with stabilising mutations and bound antagonist cyanopindolol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
286
structure length
286
Chain Sequence
QWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Distinct Conformations of Helix 6 Observed in Antagonist-Bound Structures of a Beta-1- Adrenergic Receptor.
pubmed doi rcsb
molecule keywords BETA-1 ADRENERGIC RECEPTOR
molecule tags Receptor
source organism Meleagris gallopavo
total genus 113
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2ycxA00
2BRDA 1X0K1 3QJUB 2ZZLA 3VHZA 3ZPRA 4G72B 2AT9A 1M0LA 3PQRA 5H2LA 1PXSA 5EN0A 1HZXA 4X32A 2HPYA 4UHRA 1BRRA 4L35A 5B34A 1LN6A 4Y9HA 2F93A 4L6RA 3QBKA 5ITEA 4PXKA 4QRYA 3CODA 1QKPA 3QAKA 3UTXA 5G36A 4N4WA 4OV0A 3UZCA 4KLYA 1L0MA 5AZDA 2L6XA 5J7AA 4AMJA 3QJVB 3DQBA 3KJ6A 4X1HA 5AX0A 1P8IA 2WJLA 4GYCA 3UTWA 4FAAB 3S3BB 4UG2A 4K5YA 4BEZA 5B6XA 4QIDA 5DHGA 1VJMA 2ZIYA 3OE9A 1DZEA 3S3CB 4IAQA 1BM1A 1JV7A 5A8EA 3OE6A 1U19A 4QI1A 4LDLA 1S8JA 1L9HA 2Y02A 1XIOA 2LNLA 2KSBA 1PY6A 1Q5JA 3NY9A 3A7KA 3SN6R 2YCXA 2Y00A 2R4RA 3T45A 1M0MA 3C9LA 4HYXA 5BR2A 3RFMA 2WJKA 1GZMA 3P0GA 4LDOA 2YCYA 1S53A 5JJJA 1C8SA 3ABWA 5B35A 1TN0A 3AYNA 5DHHA 1KG8A 5G2CA 3QAPA 4G71B 5ETZA 5AHYA 2KSAA 3MBVA 4KNFA 3VI0A 1FBBA 1UCQA 5B6WA 3D4SA 5B6VA 4BUOA 5ITCA 4GPOA 2VT4A 4MBSA 3BVDB 5B2NA 5H2KA 1CWQA 1C8RA 2I1XA 5H2IA 1R2NA 1S8LA 1Q5IA 4G7SB 4N6HA 3NS0A 3PBLA 3V2YA 1AP9A 3X3CA 4DAJA 2JAFA 1F88A 2I20A 4A4MA 1XMEB 4XXJA 2NTWA 3QJSB 2EI4A 4XTLA 4JQ6A 3S8FB 1P8UA 4XT1A 5FJGA 4NC3A 1M0KA 4J4QA 1XJIA 1X0SA 3HAOA 1JV6A 3ZEVA 1GUEA 4BWBA 3COCA 4WW3A 1AT9A 3WQJA 5AHZA 4AMIA 2YCWA 5B6YA 1IXFA 2R4SA 5G2DA 4IB4A 4PXFA 3QBLA 1BRXA 4JKVA 4MD1A 2KSYA 1JGJA 1GU8A 2YDVA 4FPDA 1EHKB 3EH3B 2I21A 4TL3A 5H2MA 3VGAA 3ZPQA 4G7QB 1O0AA 4X31A 5A45A 3NYAA 2KS9A 3VVKA 5H2OA 2Z55A 3AM6A 3PWHA 5H2NA 5H2JA 4MQTA 4FBZA 1UAZA 3EH4B 2Y03A 5JJNA 1IW9A 3QJQB 2NTUA 1QHJA 2Y01A 3S3DB 1C3WA 2QPEB 3UG9A 4DJHA 3QBGA 2RH1A 1KGBA 2JAGA 4GP4B 1TN5A 1X0I1 5B0WA 3HAPA 1H2SA 1IW6A 1BRDA 5AWZA 3REYA 3ODUA 2F95A 1VGOA 3RZEA 5B6ZA 2PEDA 4N4YB 4MD2A 5LWEA 2M3GA 1QKOA 3CAPA 4GP5B 3HASA 2YCZA 5G53A 4XTOA 5G54A 5G2AA 3PDSA 4BV0A 3QJRB 1E0PA 4HYJA 1E12A 1KMEA 3NY8A 5AX1A 5G28A 5A44A 1JFPA 3QJTB 3OAXA 1PXRA 2I35A 1QM8A 4GBRA 1FBKA 4GRVA 4IARA 2QPDB 3DDLA 2X72A 4GP8B 4EJ4A 4BVNA 3X3BA 3EMLA 5C1MA 3EH5B 1KG9A 3VW7A 2YDOA 4XT3A 2J4YA 4HWLA 3V2WA 3UZAA 5JJEA 3UONA 1S54A 1F4ZA 1S51A 4LDEA 3OE0A 4FA7B 2Z73A 4XTNA 4DKLA 3VG9A 5H2HA 3OE8A 4JR8A 3HANA 3S8GB 2Y04A 5F8UA 1R84A 5BR5A 4G7RB 5TGZA 3QBIA 4BEYA 3UTVA 4EA3A 2G87A 3AYMA 3C9MA 3HAQA 4EIYA 1MGYA 1S52A 5KKHA 1P8HA 5DYSA 3NSBA 2ZFEA 3UTYA 3HARA 4G70B 4MQSA 3PXOA 5H2PA 3QDCA 1F50A 1H68A 4WAVA
chains in the Genus database with same CATH superfamily
2BRDA 1X0K1 3QJUB 2ZZLA 3VHZA 3ZPRA 4G72B 2AT9A 1M0LA 3PQRA 5H2LA 1PXSA 5EN0A 1HZXA 4X32A 2HPYA 4UHRA 1BRRA 4L35A 5B34A 1LN6A 4Y9HA 2F93A 4L6RA 3QBKA 5ITEA 4PXKA 4QRYA 3CODA 1QKPA 3QAKA 3UTXA 5G36A 4N4WA 4OV0A 3UZCA 4KLYA 1L0MA 5AZDA 2L6XA 5J7AA 4AMJA 3QJVB 3DQBA 3KJ6A 4X1HA 5AX0A 1P8IA 2WJLA 4GYCA 3UTWA 4FAAB 3S3BB 4UG2A 4K5YA 4BEZA 5B6XA 4QIDA 5DHGA 1VJMA 2ZIYA 3OE9A 1DZEA 3S3CB 4IAQA 1BM1A 1JV7A 5A8EA 3OE6A 1U19A 4QI1A 4LDLA 1S8JA 1L9HA 2Y02A 1XIOA 2LNLA 2KSBA 1PY6A 1Q5JA 3NY9A 3A7KA 3SN6R 2YCXA 2Y00A 2R4RA 3T45A 1M0MA 3C9LA 4HYXA 5BR2A 3RFMA 2WJKA 1GZMA 3P0GA 4LDOA 2YCYA 1S53A 5JJJA 1C8SA 3ABWA 5B35A 1TN0A 3AYNA 5DHHA 1KG8A 5G2CA 3QAPA 4G71B 5ETZA 5AHYA 2KSAA 3MBVA 4KNFA 3VI0A 1FBBA 1UCQA 5B6WA 3D4SA 5B6VA 4BUOA 5ITCA 4GPOA 2VT4A 4MBSA 3BVDB 5B2NA 5H2KA 1CWQA 1C8RA 2I1XA 5H2IA 1R2NA 1S8LA 1Q5IA 4G7SB 4N6HA 3NS0A 3PBLA 3V2YA 1AP9A 3X3CA 4DAJA 2JAFA 1F88A 2I20A 4A4MA 1XMEB 4XXJA 2NTWA 3QJSB 2EI4A 4XTLA 4JQ6A 3S8FB 1P8UA 4XT1A 5FJGA 4NC3A 1M0KA 4J4QA 1XJIA 1X0SA 3HAOA 1JV6A 3ZEVA 1GUEA 4BWBA 3COCA 4WW3A 1AT9A 3WQJA 5AHZA 4AMIA 2YCWA 5B6YA 1IXFA 2R4SA 5G2DA 4IB4A 4PXFA 3QBLA 1BRXA 4JKVA 4MD1A 2KSYA 1JGJA 1GU8A 2YDVA 4FPDA 1EHKB 3EH3B 2I21A 4TL3A 5H2MA 3VGAA 3ZPQA 4G7QB 1O0AA 4X31A 5A45A 3NYAA 2KS9A 3VVKA 5H2OA 2Z55A 3AM6A 3PWHA 5H2NA 5H2JA 4MQTA 4FBZA 1UAZA 3EH4B 2Y03A 5JJNA 1IW9A 3QJQB 2NTUA 1QHJA 2Y01A 3S3DB 1C3WA 2QPEB 3UG9A 4DJHA 3QBGA 2RH1A 1KGBA 2JAGA 4GP4B 1TN5A 1X0I1 5B0WA 3HAPA 1H2SA 1IW6A 1BRDA 5AWZA 3REYA 3ODUA 2F95A 1VGOA 3RZEA 5B6ZA 2PEDA 4N4YB 4MD2A 5LWEA 2M3GA 1QKOA 3CAPA 4GP5B 3HASA 2YCZA 5G53A 4XTOA 5G54A 5G2AA 3PDSA 4BV0A 3QJRB 1E0PA 4HYJA 1E12A 1KMEA 3NY8A 5AX1A 5G28A 5A44A 1JFPA 3QJTB 3OAXA 1PXRA 2I35A 1QM8A 4GBRA 1FBKA 4GRVA 4IARA 2QPDB 3DDLA 2X72A 4GP8B 4EJ4A 4BVNA 3X3BA 3EMLA 5C1MA 3EH5B 1KG9A 3VW7A 2YDOA 4XT3A 2J4YA 4HWLA 3V2WA 3UZAA 5JJEA 3UONA 1S54A 1F4ZA 1S51A 4LDEA 3OE0A 4FA7B 2Z73A 4XTNA 4DKLA 3VG9A 5H2HA 3OE8A 4JR8A 3HANA 3S8GB 2Y04A 4DS7E 5F8UA 1R84A 5BR5A 4G7RB 5TGZA 3QBIA 4BEYA 3UTVA 4EA3A 2G87A 3AYMA 3C9MA 3HAQA 4EIYA 1MGYA 1S52A 5KKHA 1P8HA 5DYSA 3NSBA 2ZFEA 3UTYA 3HARA 4G70B 4MQSA 3PXOA 5H2PA 3QDCA 1F50A 1H68A 4WAVA
chains in the Genus database with same CATH topology
2BRDA 1X0K1 3QJUB 2ZZLA 3VHZA 3ZPRA 4G72B 2AT9A 1M0LA 3PQRA 5H2LA 1PXSA 5EN0A 1HZXA 4X32A 2HPYA 4UHRA 1BRRA 4L35A 5B34A 1LN6A 4Y9HA 2F93A 4L6RA 3QBKA 5ITEA 4PXKA 4QRYA 3CODA 1QKPA 3QAKA 3UTXA 5G36A 4N4WA 4OV0A 3UZCA 4KLYA 1L0MA 5AZDA 2L6XA 5J7AA 4AMJA 3QJVB 3DQBA 3KJ6A 4X1HA 5AX0A 1P8IA 2WJLA 4GYCA 3UTWA 4FAAB 3S3BB 4UG2A 4K5YA 4BEZA 5B6XA 4QIDA 5DHGA 1VJMA 2ZIYA 3OE9A 1DZEA 3S3CB 4IAQA 1BM1A 1JV7A 5A8EA 3OE6A 1U19A 4QI1A 4LDLA 1S8JA 1L9HA 2Y02A 1XIOA 2LNLA 2KSBA 1PY6A 1Q5JA 3NY9A 3A7KA 3SN6R 2YCXA 2Y00A 2R4RA 3T45A 1M0MA 3C9LA 4HYXA 5BR2A 3RFMA 2WJKA 1GZMA 3P0GA 4LDOA 2YCYA 1S53A 5JJJA 1C8SA 3ABWA 5B35A 1TN0A 3AYNA 5DHHA 1KG8A 5G2CA 3QAPA 4G71B 5ETZA 5AHYA 2KSAA 3MBVA 4KNFA 3VI0A 1FBBA 1UCQA 5B6WA 3D4SA 5B6VA 4BUOA 5ITCA 4GPOA 2VT4A 4MBSA 3BVDB 5B2NA 5H2KA 1CWQA 1C8RA 2I1XA 5H2IA 1R2NA 1S8LA 1Q5IA 4G7SB 4N6HA 3NS0A 3PBLA 3V2YA 1AP9A 3X3CA 4DAJA 2JAFA 1F88A 2I20A 4A4MA 1XMEB 4XXJA 2NTWA 3QJSB 2EI4A 4XTLA 4JQ6A 3S8FB 1P8UA 4XT1A 5FJGA 4NC3A 1M0KA 4J4QA 1XJIA 1X0SA 3HAOA 1JV6A 3ZEVA 1GUEA 4BWBA 3COCA 4WW3A 1AT9A 3WQJA 5AHZA 4AMIA 2YCWA 5B6YA 1IXFA 2R4SA 5G2DA 4IB4A 4PXFA 3QBLA 1BRXA 4JKVA 4MD1A 2KSYA 1JGJA 1GU8A 2YDVA 4FPDA 1EHKB 3EH3B 2I21A 4TL3A 5H2MA 3VGAA 3ZPQA 4G7QB 1O0AA 4X31A 5A45A 3NYAA 2KS9A 3VVKA 5H2OA 2Z55A 3AM6A 3PWHA 5H2NA 5H2JA 4MQTA 4FBZA 1UAZA 3EH4B 2Y03A 5JJNA 1IW9A 3QJQB 2NTUA 1QHJA 2Y01A 3S3DB 1C3WA 2QPEB 3UG9A 4DJHA 3QBGA 2RH1A 1KGBA 2JAGA 4GP4B 1TN5A 1X0I1 5B0WA 3HAPA 1H2SA 1IW6A 1BRDA 5AWZA 3REYA 3ODUA 2F95A 1VGOA 3RZEA 5B6ZA 2PEDA 4N4YB 4MD2A 5LWEA 2M3GA 1QKOA 3CAPA 4GP5B 3HASA 2YCZA 5G53A 4XTOA 5G54A 5G2AA 3PDSA 4BV0A 3QJRB 1E0PA 4HYJA 1E12A 1KMEA 3NY8A 5AX1A 5G28A 5A44A 1JFPA 3QJTB 3OAXA 1PXRA 2I35A 1QM8A 4GBRA 1FBKA 4GRVA 4IARA 2QPDB 3DDLA 2X72A 4GP8B 4EJ4A 4BVNA 3X3BA 3EMLA 5C1MA 3EH5B 1KG9A 3VW7A 2YDOA 4XT3A 2J4YA 4HWLA 3V2WA 3UZAA 5JJEA 3UONA 1S54A 1F4ZA 1S51A 4LDEA 3OE0A 4FA7B 2Z73A 4XTNA 4DKLA 3VG9A 5H2HA 3OE8A 4JR8A 3HANA 3S8GB 2Y04A 4DS7E 5F8UA 1R84A 5BR5A 4G7RB 5TGZA 3QBIA 4BEYA 3UTVA 4EA3A 2G87A 3AYMA 3C9MA 3HAQA 4EIYA 1MGYA 1S52A 5KKHA 1P8HA 5DYSA 3NSBA 2ZFEA 3UTYA 3HARA 4G70B 4MQSA 3PXOA 5H2PA 3QDCA 1F50A 1H68A 4WAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRD A;  1X0K 1;  3QJU B;  2ZZL A;  3VHZ A;  3ZPR A;  4G72 B;  2AT9 A;  1M0L A;  3PQR A;  5H2L A;  1PXS A;  5EN0 A;  1HZX A;  4X32 A;  2HPY A;  4UHR A;  1BRR A;  4L35 A;  5B34 A;  1LN6 A;  4Y9H A;  2F93 A;  4L6R A;  3QBK A;  5ITE A;  4PXK A;  4QRY A;  3COD A;  1QKP A;  3QAK A;  3UTX A;  5G36 A;  4N4W A;  4OV0 A;  3UZC A;  4KLY A;  1L0M A;  5AZD A;  2L6X A;  5J7A A;  4AMJ A;  3QJV B;  3DQB A;  3KJ6 A;  4X1H A;  5AX0 A;  1P8I A;  2WJL A;  4GYC A;  3UTW A;  4FAA B;  3S3B B;  4UG2 A;  4K5Y A;  4BEZ A;  5B6X A;  4QID A;  5DHG A;  1VJM A;  2ZIY A;  3OE9 A;  1DZE A;  3S3C B;  4IAQ A;  1BM1 A;  1JV7 A;  5A8E A;  3OE6 A;  1U19 A;  4QI1 A;  4LDL A;  1S8J A;  1L9H A;  2Y02 A;  1XIO A;  2LNL A;  2KSB A;  1PY6 A;  1Q5J A;  3NY9 A;  3A7K A;  3SN6 R;  2YCX A;  2Y00 A;  2R4R A;  3T45 A;  1M0M A;  3C9L A;  4HYX A;  5BR2 A;  3RFM A;  2WJK A;  1GZM A;  3P0G A;  4LDO A;  2YCY A;  1S53 A;  5JJJ A;  1C8S A;  3ABW A;  5B35 A;  1TN0 A;  3AYN A;  5DHH A;  1KG8 A;  5G2C A;  3QAP A;  4G71 B;  5ETZ A;  5AHY A;  2KSA A;  3MBV A;  4KNF A;  3VI0 A;  1FBB A;  1UCQ A;  5B6W A;  3D4S A;  5B6V A;  4BUO A;  5ITC A;  4GPO A;  2VT4 A;  4MBS A;  3BVD B;  5B2N A;  5H2K A;  1CWQ A;  1C8R A;  2I1X A;  5H2I A;  1R2N A;  1S8L A;  1Q5I A;  4G7S B;  4N6H A;  3NS0 A;  3PBL A;  3V2Y A;  1AP9 A;  3X3C A;  4DAJ A;  2JAF A;  1F88 A;  2I20 A;  4A4M A;  1XME B;  4XXJ A;  2NTW A;  3QJS B;  2EI4 A;  4XTL A;  4JQ6 A;  3S8F B;  1P8U A;  4XT1 A;  5FJG A;  4NC3 A;  1M0K A;  4J4Q A;  1XJI A;  1X0S A;  3HAO A;  1JV6 A;  3ZEV A;  1GUE A;  4BWB A;  3COC A;  4WW3 A;  1AT9 A;  3WQJ A;  5AHZ A;  4AMI A;  2YCW A;  5B6Y A;  1IXF A;  2R4S A;  5G2D A;  4IB4 A;  4PXF A;  3QBL A;  1BRX A;  4JKV A;  4MD1 A;  2KSY A;  1JGJ A;  1GU8 A;  2YDV A;  4FPD A;  1EHK B;  3EH3 B;  2I21 A;  4TL3 A;  5H2M A;  3VGA A;  3ZPQ A;  4G7Q B;  1O0A A;  4X31 A;  5A45 A;  3NYA A;  2KS9 A;  3VVK A;  5H2O A;  2Z55 A;  3AM6 A;  3PWH A;  5H2N A;  5H2J A;  4MQT A;  4FBZ A;  1UAZ A;  3EH4 B;  2Y03 A;  5JJN A;  1IW9 A;  3QJQ B;  2NTU A;  1QHJ A;  2Y01 A;  3S3D B;  1C3W A;  2QPE B;  3UG9 A;  4DJH A;  3QBG A;  2RH1 A;  1KGB A;  2JAG A;  4GP4 B;  1TN5 A;  1X0I 1;  5B0W A;  3HAP A;  1H2S A;  1IW6 A;  1BRD A;  5AWZ A;  3REY A;  3ODU A;  2F95 A;  1VGO A;  3RZE A;  5B6Z A;  2PED A;  4N4Y B;  4MD2 A;  5LWE A;  2M3G A;  1QKO A;  3CAP A;  4GP5 B;  3HAS A;  2YCZ A;  5G53 A;  4XTO A;  5G54 A;  5G2A A;  3PDS A;  4BV0 A;  3QJR B;  1E0P A;  4HYJ A;  1E12 A;  1KME A;  3NY8 A;  5AX1 A;  5G28 A;  5A44 A;  1JFP A;  3QJT B;  3OAX A;  1PXR A;  2I35 A;  1QM8 A;  4GBR A;  1FBK A;  4GRV A;  4IAR A;  2QPD B;  3DDL A;  2X72 A;  4GP8 B;  4EJ4 A;  4BVN A;  3X3B A;  3EML A;  5C1M A;  3EH5 B;  1KG9 A;  3VW7 A;  2YDO A;  4XT3 A;  2J4Y A;  4HWL A;  3V2W A;  3UZA A;  5JJE A;  3UON A;  1S54 A;  1F4Z A;  1S51 A;  4LDE A;  3OE0 A;  4FA7 B;  2Z73 A;  4XTN A;  4DKL A;  3VG9 A;  5H2H A;  3OE8 A;  4JR8 A;  3HAN A;  3S8G B;  2Y04 A;  5F8U A;  1R84 A;  5BR5 A;  4G7R B;  5TGZ A;  3QBI A;  4BEY A;  3UTV A;  4EA3 A;  2G87 A;  3AYM A;  3C9M A;  3HAQ A;  4EIY A;  1MGY A;  1S52 A;  5KKH A;  1P8H A;  5DYS A;  3NSB A;  2ZFE A;  3UTY A;  3HAR A;  4G70 B;  4MQS A;  3PXO A;  5H2P A;  3QDC A;  1F50 A;  1H68 A;  4WAV A; 
#chains in the Genus database with same CATH topology
 2BRD A;  1X0K 1;  3QJU B;  2ZZL A;  3VHZ A;  3ZPR A;  4G72 B;  2AT9 A;  1M0L A;  3PQR A;  5H2L A;  1PXS A;  5EN0 A;  1HZX A;  4X32 A;  2HPY A;  4UHR A;  1BRR A;  4L35 A;  5B34 A;  1LN6 A;  4Y9H A;  2F93 A;  4L6R A;  3QBK A;  5ITE A;  4PXK A;  4QRY A;  3COD A;  1QKP A;  3QAK A;  3UTX A;  5G36 A;  4N4W A;  4OV0 A;  3UZC A;  4KLY A;  1L0M A;  5AZD A;  2L6X A;  5J7A A;  4AMJ A;  3QJV B;  3DQB A;  3KJ6 A;  4X1H A;  5AX0 A;  1P8I A;  2WJL A;  4GYC A;  3UTW A;  4FAA B;  3S3B B;  4UG2 A;  4K5Y A;  4BEZ A;  5B6X A;  4QID A;  5DHG A;  1VJM A;  2ZIY A;  3OE9 A;  1DZE A;  3S3C B;  4IAQ A;  1BM1 A;  1JV7 A;  5A8E A;  3OE6 A;  1U19 A;  4QI1 A;  4LDL A;  1S8J A;  1L9H A;  2Y02 A;  1XIO A;  2LNL A;  2KSB A;  1PY6 A;  1Q5J A;  3NY9 A;  3A7K A;  3SN6 R;  2YCX A;  2Y00 A;  2R4R A;  3T45 A;  1M0M A;  3C9L A;  4HYX A;  5BR2 A;  3RFM A;  2WJK A;  1GZM A;  3P0G A;  4LDO A;  2YCY A;  1S53 A;  5JJJ A;  1C8S A;  3ABW A;  5B35 A;  1TN0 A;  3AYN A;  5DHH A;  1KG8 A;  5G2C A;  3QAP A;  4G71 B;  5ETZ A;  5AHY A;  2KSA A;  3MBV A;  4KNF A;  3VI0 A;  1FBB A;  1UCQ A;  5B6W A;  3D4S A;  5B6V A;  4BUO A;  5ITC A;  4GPO A;  2VT4 A;  4MBS A;  3BVD B;  5B2N A;  5H2K A;  1CWQ A;  1C8R A;  2I1X A;  5H2I A;  1R2N A;  1S8L A;  1Q5I A;  4G7S B;  4N6H A;  3NS0 A;  3PBL A;  3V2Y A;  1AP9 A;  3X3C A;  4DAJ A;  2JAF A;  1F88 A;  2I20 A;  4A4M A;  1XME B;  4XXJ A;  2NTW A;  3QJS B;  2EI4 A;  4XTL A;  4JQ6 A;  3S8F B;  1P8U A;  4XT1 A;  5FJG A;  4NC3 A;  1M0K A;  4J4Q A;  1XJI A;  1X0S A;  3HAO A;  1JV6 A;  3ZEV A;  1GUE A;  4BWB A;  3COC A;  4WW3 A;  1AT9 A;  3WQJ A;  5AHZ A;  4AMI A;  2YCW A;  5B6Y A;  1IXF A;  2R4S A;  5G2D A;  4IB4 A;  4PXF A;  3QBL A;  1BRX A;  4JKV A;  4MD1 A;  2KSY A;  1JGJ A;  1GU8 A;  2YDV A;  4FPD A;  1EHK B;  3EH3 B;  2I21 A;  4TL3 A;  5H2M A;  3VGA A;  3ZPQ A;  4G7Q B;  1O0A A;  4X31 A;  5A45 A;  3NYA A;  2KS9 A;  3VVK A;  5H2O A;  2Z55 A;  3AM6 A;  3PWH A;  5H2N A;  5H2J A;  4MQT A;  4FBZ A;  1UAZ A;  3EH4 B;  2Y03 A;  5JJN A;  1IW9 A;  3QJQ B;  2NTU A;  1QHJ A;  2Y01 A;  3S3D B;  1C3W A;  2QPE B;  3UG9 A;  4DJH A;  3QBG A;  2RH1 A;  1KGB A;  2JAG A;  4GP4 B;  1TN5 A;  1X0I 1;  5B0W A;  3HAP A;  1H2S A;  1IW6 A;  1BRD A;  5AWZ A;  3REY A;  3ODU A;  2F95 A;  1VGO A;  3RZE A;  5B6Z A;  2PED A;  4N4Y B;  4MD2 A;  5LWE A;  2M3G A;  1QKO A;  3CAP A;  4GP5 B;  3HAS A;  2YCZ A;  5G53 A;  4XTO A;  5G54 A;  5G2A A;  3PDS A;  4BV0 A;  3QJR B;  1E0P A;  4HYJ A;  1E12 A;  1KME A;  3NY8 A;  5AX1 A;  5G28 A;  5A44 A;  1JFP A;  3QJT B;  3OAX A;  1PXR A;  2I35 A;  1QM8 A;  4GBR A;  1FBK A;  4GRV A;  4IAR A;  2QPD B;  3DDL A;  2X72 A;  4GP8 B;  4EJ4 A;  4BVN A;  3X3B A;  3EML A;  5C1M A;  3EH5 B;  1KG9 A;  3VW7 A;  2YDO A;  4XT3 A;  2J4Y A;  4HWL A;  3V2W A;  3UZA A;  5JJE A;  3UON A;  1S54 A;  1F4Z A;  1S51 A;  4LDE A;  3OE0 A;  4FA7 B;  2Z73 A;  4XTN A;  4DKL A;  3VG9 A;  5H2H A;  3OE8 A;  4JR8 A;  3HAN A;  3S8G B;  2Y04 A;  4DS7 E;  5F8U A;  1R84 A;  5BR5 A;  4G7R B;  5TGZ A;  3QBI A;  4BEY A;  3UTV A;  4EA3 A;  2G87 A;  3AYM A;  3C9M A;  3HAQ A;  4EIY A;  1MGY A;  1S52 A;  5KKH A;  1P8H A;  5DYS A;  3NSB A;  2ZFE A;  3UTY A;  3HAR A;  4G70 B;  4MQS A;  3PXO A;  5H2P A;  3QDC A;  1F50 A;  1H68 A;  4WAV A; 
#chains in the Genus database with same CATH homology
 2BRD A;  1X0K 1;  3QJU B;  2ZZL A;  3VHZ A;  3ZPR A;  4G72 B;  2AT9 A;  1M0L A;  3PQR A;  5H2L A;  1PXS A;  5EN0 A;  1HZX A;  4X32 A;  2HPY A;  4UHR A;  1BRR A;  4L35 A;  5B34 A;  1LN6 A;  4Y9H A;  2F93 A;  4L6R A;  3QBK A;  5ITE A;  4PXK A;  4QRY A;  3COD A;  1QKP A;  3QAK A;  3UTX A;  5G36 A;  4N4W A;  4OV0 A;  3UZC A;  4KLY A;  1L0M A;  5AZD A;  2L6X A;  5J7A A;  4AMJ A;  3QJV B;  3DQB A;  3KJ6 A;  4X1H A;  5AX0 A;  1P8I A;  2WJL A;  4GYC A;  3UTW A;  4FAA B;  3S3B B;  4UG2 A;  4K5Y A;  4BEZ A;  5B6X A;  4QID A;  5DHG A;  1VJM A;  2ZIY A;  3OE9 A;  1DZE A;  3S3C B;  4IAQ A;  1BM1 A;  1JV7 A;  5A8E A;  3OE6 A;  1U19 A;  4QI1 A;  4LDL A;  1S8J A;  1L9H A;  2Y02 A;  1XIO A;  2LNL A;  2KSB A;  1PY6 A;  1Q5J A;  3NY9 A;  3A7K A;  3SN6 R;  2YCX A;  2Y00 A;  2R4R A;  3T45 A;  1M0M A;  3C9L A;  4HYX A;  5BR2 A;  3RFM A;  2WJK A;  1GZM A;  3P0G A;  4LDO A;  2YCY A;  1S53 A;  5JJJ A;  1C8S A;  3ABW A;  5B35 A;  1TN0 A;  3AYN A;  5DHH A;  1KG8 A;  5G2C A;  3QAP A;  4G71 B;  5ETZ A;  5AHY A;  2KSA A;  3MBV A;  4KNF A;  3VI0 A;  1FBB A;  1UCQ A;  5B6W A;  3D4S A;  5B6V A;  4BUO A;  5ITC A;  4GPO A;  2VT4 A;  4MBS A;  3BVD B;  5B2N A;  5H2K A;  1CWQ A;  1C8R A;  2I1X A;  5H2I A;  1R2N A;  1S8L A;  1Q5I A;  4G7S B;  4N6H A;  3NS0 A;  3PBL A;  3V2Y A;  1AP9 A;  3X3C A;  4DAJ A;  2JAF A;  1F88 A;  2I20 A;  4A4M A;  1XME B;  4XXJ A;  2NTW A;  3QJS B;  2EI4 A;  4XTL A;  4JQ6 A;  3S8F B;  1P8U A;  4XT1 A;  5FJG A;  4NC3 A;  1M0K A;  4J4Q A;  1XJI A;  1X0S A;  3HAO A;  1JV6 A;  3ZEV A;  1GUE A;  4BWB A;  3COC A;  4WW3 A;  1AT9 A;  3WQJ A;  5AHZ A;  4AMI A;  2YCW A;  5B6Y A;  1IXF A;  2R4S A;  5G2D A;  4IB4 A;  4PXF A;  3QBL A;  1BRX A;  4JKV A;  4MD1 A;  2KSY A;  1JGJ A;  1GU8 A;  2YDV A;  4FPD A;  1EHK B;  3EH3 B;  2I21 A;  4TL3 A;  5H2M A;  3VGA A;  3ZPQ A;  4G7Q B;  1O0A A;  4X31 A;  5A45 A;  3NYA A;  2KS9 A;  3VVK A;  5H2O A;  2Z55 A;  3AM6 A;  3PWH A;  5H2N A;  5H2J A;  4MQT A;  4FBZ A;  1UAZ A;  3EH4 B;  2Y03 A;  5JJN A;  1IW9 A;  3QJQ B;  2NTU A;  1QHJ A;  2Y01 A;  3S3D B;  1C3W A;  2QPE B;  3UG9 A;  4DJH A;  3QBG A;  2RH1 A;  1KGB A;  2JAG A;  4GP4 B;  1TN5 A;  1X0I 1;  5B0W A;  3HAP A;  1H2S A;  1IW6 A;  1BRD A;  5AWZ A;  3REY A;  3ODU A;  2F95 A;  1VGO A;  3RZE A;  5B6Z A;  2PED A;  4N4Y B;  4MD2 A;  5LWE A;  2M3G A;  1QKO A;  3CAP A;  4GP5 B;  3HAS A;  2YCZ A;  5G53 A;  4XTO A;  5G54 A;  5G2A A;  3PDS A;  4BV0 A;  3QJR B;  1E0P A;  4HYJ A;  1E12 A;  1KME A;  3NY8 A;  5AX1 A;  5G28 A;  5A44 A;  1JFP A;  3QJT B;  3OAX A;  1PXR A;  2I35 A;  1QM8 A;  4GBR A;  1FBK A;  4GRV A;  4IAR A;  2QPD B;  3DDL A;  2X72 A;  4GP8 B;  4EJ4 A;  4BVN A;  3X3B A;  3EML A;  5C1M A;  3EH5 B;  1KG9 A;  3VW7 A;  2YDO A;  4XT3 A;  2J4Y A;  4HWL A;  3V2W A;  3UZA A;  5JJE A;  3UON A;  1S54 A;  1F4Z A;  1S51 A;  4LDE A;  3OE0 A;  4FA7 B;  2Z73 A;  4XTN A;  4DKL A;  3VG9 A;  5H2H A;  3OE8 A;  4JR8 A;  3HAN A;  3S8G B;  2Y04 A;  4DS7 E;  5F8U A;  1R84 A;  5BR5 A;  4G7R B;  5TGZ A;  3QBI A;  4BEY A;  3UTV A;  4EA3 A;  2G87 A;  3AYM A;  3C9M A;  3HAQ A;  4EIY A;  1MGY A;  1S52 A;  5KKH A;  1P8H A;  5DYS A;  3NSB A;  2ZFE A;  3UTY A;  3HAR A;  4G70 B;  4MQS A;  3PXO A;  5H2P A;  3QDC A;  1F50 A;  1H68 A;  4WAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...