The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
IRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAKMLTDKRTYLDISEKTGASTATISRVNRSLNYGNDGYEMVFSRMKEKET
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
X-ray crystal structure of putative TrpR protein from Ruminococcus obeum.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Ruminococcus obeum atcc 29174
|
molecule keywords |
Putative Trp repressor protein
|
total genus |
33
|
structure length |
94
|
sequence length |
94
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature | |
pdb deposition date | 2009-01-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01371 | Trp_repressor | Trp repressor protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Trp Operon Repressor; Chain A | TrpR-like |
#chains in the Genus database with same CATH superfamily 1ZT9 A; 3SSX N; 1RCS A; 1TRR A; 1JHG A; 1CO0 A; 3KOR A; 3SSW N; 1WRT R; 3FRW A; 3G1C A; 1WRS R; 1MI7 R; 1WRP R; 3WRP A; 2XDI A; 2OZ9 R; 1TRO A; #chains in the Genus database with same CATH topology 4YQQ A; 1ZT9 A; 4YQS A; 4YQ8 A; 4YQ4 A; 4YQ9 A; 4YPX A; 1JHG A; 4YQA A; 4YVJ A; 4MCC A; 4H3Z A; 4YQC A; 5D9F A; 4YQB A; 1WRS R; 4YQ2 A; 4YQR A; 1WRP R; 3AXZ A; 4YVK A; 4YQL A; 1RCS A; 3KOR A; 4YQ1 A; 1UAJ A; 3KNU A; 4YPW A; 4YQT A; 4YVG A; 4YVH A; 4YQP A; 3IEF A; 2OZ9 R; 4YQJ A; 1TRO A; 3KY7 A; 4MCB A; 4YQ7 A; 4YQ6 A; 3QUV A; 4YQO A; 4YPZ A; 4YQG A; 4YQD A; 4YQN A; 3G1C A; 1MI7 R; 4MCD A; 1CO0 A; 1P9P A; 2XDI A; 3FRW A; 4YQK A; 4YQ0 A; 4IG6 A; 4YQ3 A; 4YQ5 A; 4YQI A; 3SSX N; 4YVI A; 1TRR A; 3SSW N; 1WRT R; 1UAM A; 1UAK A; 3WRP A; 1OY5 A; 4H3Y A; 1UAL A; 4YPY A; #chains in the Genus database with same CATH homology 1ZT9 A; 3SSX N; 1RCS A; 1TRR A; 1JHG A; 1CO0 A; 3KOR A; 3SSW N; 1WRT R; 3FRW A; 3G1C A; 1WRS R; 1MI7 R; 1WRP R; 3WRP A; 2XDI A; 2OZ9 R; 1TRO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...