1UAMA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
252
structure length
250
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 74
structure length 250
sequence length 252
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uamA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uamA01
4YVKA 1ZJRA 4YPWA 4X3MA 1GZ0A 4YQPA 2EGWA 4H3ZA 4RG1A 4CNFA 3QUVA 1IPAA 1UAKA 3IEFA 4YQ0A 5GMBA 3IC6A 2QWVA 2YY8A 1VHYA 4YQBA 4CNDA 4YQRA 4YQGA 4YPZA 4YQJA 4YQ3A 4YVIA 4YQ1A 4JALA 4FAKA 3NK6A 1OY5A 3N4KA 4KDZA 3BBDA 1X7PA 4YQ9A 1V2XA 4YQ6A 4MCDA 1UAJA 1J85A 2I6DA 1UAMA 4YQ4A 4YPXA 2O3AA 2Z0YA 4IG6A 1O6DA 4L69A 2V3KA 4X3LA 1Z85A 2EGVA 1MXIA 4YQKA 1V6ZA 4YQDA 5GMCA 3AXZA 3OIJA 3NK7A 3O7BA 5D9FA 1K3RA 3BBHA 4J3CA 4H3YA 4YQCA 4YVGA 4JAKA 3KY7A 3ILKA 4YQNA 4CNEA 4YVHA 3DCMX 1VHKA 4YQTA 1NS5A 3GYQA 1UALA 3KTYA 2CX8A 3N4JA 5CO4A 4YQQA 3ONPA 4YQLA 1VH0A 5GM8A 3AI9X 4MCCA 4YQAA 4YQ2A 4KGNA 4YQ5A 4YVJA 3OINA 4XBOA 4YQSA 2QMMA 1X7OA 4E8BA 4CNGA 3E5YA 3BBEA 4YQOA 2HA8A 1P9PA 3AIAA 1TO0A 2V3JA 3L8UA 3KW2A 3OIIA 5FAIA 4MCBA 3KNUA 4YQIA 4PZKA 1NXZA 4YQ7A 4YPYA 4YQ8A
chains in the Genus database with same CATH superfamily
4YVKA 1ZJRA 4YPWA 4X3MA 1GZ0A 4YQPA 2EGWA 4H3ZA 4RG1A 4CNFA 3QUVA 1IPAA 1UAKA 1WRPR 3IEFA 4YQ0A 5GMBA 3IC6A 2QWVA 1WRTR 2YY8A 1VHYA 4YQBA 4CNDA 4YQRA 3KORA 1CO0A 4YQGA 3SSXN 4YPZA 1ZT9A 4YQJA 4YQ3A 3WRPA 4YQ1A 4YVIA 4JALA 4FAKA 3NK6A 1TROA 1OY5A 3N4KA 4JWHA 4KDZA 1JHGA 3BBDA 1X7PA 4YQ9A 1V2XA 4YQ6A 4MCDA 1UAJA 1J85A 2I6DA 1UAMA 4YQ4A 4YPXA 2O3AA 2Z0YA 4IG6A 1O6DA 4L69A 2V3KA 4X3LA 1Z85A 2EGVA 1MXIA 4YQKA 1MI7R 1V6ZA 4YQDA 5GMCA 3AXZA 1WRSR 3OIJA 3NK7A 3O7BA 4JWGA 5D9FA 1K3RA 3BBHA 1TRRA 4J3CA 4H3YA 4YQCA 4YVGA 4JAKA 3KY7A 3ILKA 4YQNA 4FMWA 4CNEA 4YVHA 3DCMX 1VHKA 4YQTA 1NS5A 3GYQA 1UALA 4JWFA 3KTYA 2CX8A 3N4JA 5CO4A 2XDIA 3G1CA 4YQQA 4YQLA 3ONPA 1VH0A 5GM8A 3AI9X 4MCCA 4YQAA 4YQ2A 4KGNA 4YQ5A 4YVJA 3OINA 4XBOA 4YQSA 2QMMA 1X7OA 4E8BA 3FRWA 4CNGA 3E5YA 1RCSA 3BBEA 4JWJA 4YQOA 3SSWN 1P9PA 2HA8A 3AIAA 1TO0A 2V3JA 3L8UA 3KW2A 3OIIA 5FAIA 2OZ9R 4MCBA 3KNUA 4YQIA 4PZKA 1NXZA 4YQ7A 4YPYA 4YQ8A
chains in the Genus database with same CATH topology
4YVKA 1ZJRA 4YPWA 4X3MA 1GZ0A 4YQPA 2EGWA 4H3ZA 4RG1A 4CNFA 3QUVA 1IPAA 1UAKA 3IEFA 4YQ0A 5GMBA 3IC6A 2QWVA 2YY8A 1VHYA 4YQBA 4CNDA 4YQRA 4YQGA 4YPZA 4YQJA 4YQ3A 4YVIA 4YQ1A 4JALA 4FAKA 3NK6A 1OY5A 3N4KA 4JWHA 4KDZA 3BBDA 1X7PA 4YQ9A 1V2XA 4YQ6A 4MCDA 1UAJA 1J85A 2I6DA 1UAMA 4YQ4A 4YPXA 2O3AA 2Z0YA 4IG6A 1O6DA 4L69A 2V3KA 4X3LA 1Z85A 2EGVA 1MXIA 4YQKA 1V6ZA 4YQDA 5GMCA 3AXZA 3OIJA 3NK7A 3O7BA 4JWGA 5D9FA 1K3RA 3BBHA 4J3CA 4H3YA 4YQCA 4YVGA 4JAKA 3KY7A 3ILKA 4YQNA 4FMWA 4CNEA 4YVHA 3DCMX 1VHKA 4YQTA 1NS5A 3GYQA 1UALA 4JWFA 3KTYA 2CX8A 3N4JA 5CO4A 4YQQA 3ONPA 4YQLA 1VH0A 5GM8A 3AI9X 4MCCA 4YQAA 4YQ2A 4KGNA 4YQ5A 4YVJA 3OINA 4XBOA 4YQSA 2QMMA 1X7OA 4E8BA 4CNGA 3E5YA 3BBEA 4JWJA 4YQOA 2HA8A 1P9PA 3AIAA 1TO0A 2V3JA 3L8UA 3KW2A 3OIIA 5FAIA 4MCBA 3KNUA 4YQIA 4PZKA 1NXZA 4YQ7A 4YPYA 4YQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVK A;  1ZJR A;  4YPW A;  4X3M A;  1GZ0 A;  4YQP A;  2EGW A;  4H3Z A;  4RG1 A;  4CNF A;  3QUV A;  1IPA A;  1UAK A;  3IEF A;  4YQ0 A;  5GMB A;  3IC6 A;  2QWV A;  2YY8 A;  1VHY A;  4YQB A;  4CND A;  4YQR A;  4YQG A;  4YPZ A;  4YQJ A;  4YQ3 A;  4YVI A;  4YQ1 A;  4JAL A;  4FAK A;  3NK6 A;  1OY5 A;  3N4K A;  4KDZ A;  3BBD A;  1X7P A;  4YQ9 A;  1V2X A;  4YQ6 A;  4MCD A;  1UAJ A;  1J85 A;  2I6D A;  1UAM A;  4YQ4 A;  4YPX A;  2O3A A;  2Z0Y A;  4IG6 A;  1O6D A;  4L69 A;  2V3K A;  4X3L A;  1Z85 A;  2EGV A;  1MXI A;  4YQK A;  1V6Z A;  4YQD A;  5GMC A;  3AXZ A;  3OIJ A;  3NK7 A;  3O7B A;  5D9F A;  1K3R A;  3BBH A;  4J3C A;  4H3Y A;  4YQC A;  4YVG A;  4JAK A;  3KY7 A;  3ILK A;  4YQN A;  4CNE A;  4YVH A;  3DCM X;  1VHK A;  4YQT A;  1NS5 A;  3GYQ A;  1UAL A;  3KTY A;  2CX8 A;  3N4J A;  5CO4 A;  4YQQ A;  3ONP A;  4YQL A;  1VH0 A;  5GM8 A;  3AI9 X;  4MCC A;  4YQA A;  4YQ2 A;  4KGN A;  4YQ5 A;  4YVJ A;  3OIN A;  4XBO A;  4YQS A;  2QMM A;  1X7O A;  4E8B A;  4CNG A;  3E5Y A;  3BBE A;  4YQO A;  2HA8 A;  1P9P A;  3AIA A;  1TO0 A;  2V3J A;  3L8U A;  3KW2 A;  3OII A;  5FAI A;  4MCB A;  3KNU A;  4YQI A;  4PZK A;  1NXZ A;  4YQ7 A;  4YPY A;  4YQ8 A; 
#chains in the Genus database with same CATH topology
 4YVK A;  1ZJR A;  4YPW A;  4X3M A;  1GZ0 A;  4YQP A;  2EGW A;  4H3Z A;  4RG1 A;  4CNF A;  3QUV A;  1IPA A;  1UAK A;  1WRP R;  3IEF A;  4YQ0 A;  5GMB A;  3IC6 A;  2QWV A;  1WRT R;  2YY8 A;  1VHY A;  4YQB A;  4CND A;  4YQR A;  3KOR A;  1CO0 A;  4YQG A;  3SSX N;  4YPZ A;  1ZT9 A;  4YQJ A;  4YQ3 A;  3WRP A;  4YQ1 A;  4YVI A;  4JAL A;  4FAK A;  3NK6 A;  1TRO A;  1OY5 A;  3N4K A;  4JWH A;  4KDZ A;  1JHG A;  3BBD A;  1X7P A;  4YQ9 A;  1V2X A;  4YQ6 A;  4MCD A;  1UAJ A;  1J85 A;  2I6D A;  1UAM A;  4YQ4 A;  4YPX A;  2O3A A;  2Z0Y A;  4IG6 A;  1O6D A;  4L69 A;  2V3K A;  4X3L A;  1Z85 A;  2EGV A;  1MXI A;  4YQK A;  1MI7 R;  1V6Z A;  4YQD A;  5GMC A;  3AXZ A;  1WRS R;  3OIJ A;  3NK7 A;  3O7B A;  4JWG A;  5D9F A;  1K3R A;  3BBH A;  1TRR A;  4J3C A;  4H3Y A;  4YQC A;  4YVG A;  4JAK A;  3KY7 A;  3ILK A;  4YQN A;  4FMW A;  4CNE A;  4YVH A;  3DCM X;  1VHK A;  4YQT A;  1NS5 A;  3GYQ A;  1UAL A;  4JWF A;  3KTY A;  2CX8 A;  3N4J A;  5CO4 A;  2XDI A;  3G1C A;  4YQQ A;  4YQL A;  3ONP A;  1VH0 A;  5GM8 A;  3AI9 X;  4MCC A;  4YQA A;  4YQ2 A;  4KGN A;  4YQ5 A;  4YVJ A;  3OIN A;  4XBO A;  4YQS A;  2QMM A;  1X7O A;  4E8B A;  3FRW A;  4CNG A;  3E5Y A;  1RCS A;  3BBE A;  4JWJ A;  4YQO A;  3SSW N;  1P9P A;  2HA8 A;  3AIA A;  1TO0 A;  2V3J A;  3L8U A;  3KW2 A;  3OII A;  5FAI A;  2OZ9 R;  4MCB A;  3KNU A;  4YQI A;  4PZK A;  1NXZ A;  4YQ7 A;  4YPY A;  4YQ8 A; 
#chains in the Genus database with same CATH homology
 4YVK A;  1ZJR A;  4YPW A;  4X3M A;  1GZ0 A;  4YQP A;  2EGW A;  4H3Z A;  4RG1 A;  4CNF A;  3QUV A;  1IPA A;  1UAK A;  3IEF A;  4YQ0 A;  5GMB A;  3IC6 A;  2QWV A;  2YY8 A;  1VHY A;  4YQB A;  4CND A;  4YQR A;  4YQG A;  4YPZ A;  4YQJ A;  4YQ3 A;  4YVI A;  4YQ1 A;  4JAL A;  4FAK A;  3NK6 A;  1OY5 A;  3N4K A;  4JWH A;  4KDZ A;  3BBD A;  1X7P A;  4YQ9 A;  1V2X A;  4YQ6 A;  4MCD A;  1UAJ A;  1J85 A;  2I6D A;  1UAM A;  4YQ4 A;  4YPX A;  2O3A A;  2Z0Y A;  4IG6 A;  1O6D A;  4L69 A;  2V3K A;  4X3L A;  1Z85 A;  2EGV A;  1MXI A;  4YQK A;  1V6Z A;  4YQD A;  5GMC A;  3AXZ A;  3OIJ A;  3NK7 A;  3O7B A;  4JWG A;  5D9F A;  1K3R A;  3BBH A;  4J3C A;  4H3Y A;  4YQC A;  4YVG A;  4JAK A;  3KY7 A;  3ILK A;  4YQN A;  4FMW A;  4CNE A;  4YVH A;  3DCM X;  1VHK A;  4YQT A;  1NS5 A;  3GYQ A;  1UAL A;  4JWF A;  3KTY A;  2CX8 A;  3N4J A;  5CO4 A;  4YQQ A;  3ONP A;  4YQL A;  1VH0 A;  5GM8 A;  3AI9 X;  4MCC A;  4YQA A;  4YQ2 A;  4KGN A;  4YQ5 A;  4YVJ A;  3OIN A;  4XBO A;  4YQS A;  2QMM A;  1X7O A;  4E8B A;  4CNG A;  3E5Y A;  3BBE A;  4JWJ A;  4YQO A;  2HA8 A;  1P9P A;  3AIA A;  1TO0 A;  2V3J A;  3L8U A;  3KW2 A;  3OII A;  5FAI A;  4MCB A;  3KNU A;  4YQI A;  4PZK A;  1NXZ A;  4YQ7 A;  4YPY A;  4YQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...