4YQKA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
237
Chain Sequence
b'GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 73
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqkA01
1VH0A 4YQ0A 4X3MA 4YQOA 3OINA 1Z85A 3QUVA 4YQ4A 4YVIA 4YQLA 1K3RA 4KDZA 1OY5A 4YQSA 4YQ7A 4YQGA 2HA8A 1UAKA 1O6DA 4KGNA 1V6ZA 5CO4A 4YQ8A 4YVJA 4H3ZA 1UALA 4CNGA 3OIJA 3DCMX 4YQJA 4J3CA 1VHYA 4MCCA 3BBDA 4YQ2A 4YQCA 1IPAA 4CNFA 2QWVA 4YVGA 1VHKA 4YPYA 4FAKA 2EGVA 2EGWA 4JAKA 4YQRA 3KW2A 4YQPA 1MXIA 2V3KA 1V2XA 4YQDA 4E8BA 3N4JA 4YPWA 4YVHA 3KY7A 2V3JA 4MCBA 3AIAA 4YQ9A 4YVKA 5GMCA 4YQIA 4YQBA 2CX8A 4YPXA 1ZJRA 3AI9X 3OIIA 5D9FA 4YQ6A 4YQ1A 4CNDA 4YQNA 3NK7A 3N4KA 1TO0A 4YQ5A 1NXZA 3E5YA 3GYQA 4X3LA 4YQQA 4YQAA 3ONPA 3IEFA 2O3AA 4CNEA 4YQKA 5GMBA 4YQTA 4IG6A 5GM8A 1X7PA 2YY8A 3ILKA 4JALA 4YQ3A 1NS5A 1GZ0A 3O7BA 4L69A 1P9PA 4YPZA 3BBHA 3KNUA 4RG1A 2QMMA 4MCDA 4H3YA 1J85A 1UAMA 3BBEA 3NK6A 2Z0YA 3IC6A 3KTYA 4XBOA 1UAJA 2I6DA 5FAIA 3L8UA 1X7OA 4PZKA 3AXZA
chains in the Genus database with same CATH superfamily
1VH0A 4YQ0A 4X3MA 4YQOA 3OINA 3SSXN 1Z85A 4FMWA 3QUVA 4YQ4A 4YVIA 4YQLA 1K3RA 4KDZA 1TRRA 1X7OA 1OY5A 4YQSA 4JWFA 4YQ7A 4YQGA 1JHGA 2XDIA 4JWGA 2HA8A 1UAKA 3WRPA 1O6DA 4KGNA 1V6ZA 5CO4A 4YQ8A 4YVJA 4H3ZA 1CO0A 1WRTR 1UALA 4CNGA 3OIJA 3DCMX 4YQJA 4J3CA 1VHYA 4MCCA 3BBDA 4YQ2A 4YQCA 1IPAA 4CNFA 2QWVA 4YVGA 1VHKA 3KORA 4YPYA 4FAKA 2EGVA 1RCSA 2EGWA 4JAKA 4YQRA 3KW2A 4YQPA 1MXIA 1ZT9A 2V3KA 1V2XA 4YQDA 4E8BA 4JWJA 3N4JA 4YPWA 4YVHA 3KY7A 2V3JA 4MCBA 3AIAA 4YQ9A 4YVKA 5GMCA 4YQIA 4YQBA 2CX8A 4YPXA 1TROA 1ZJRA 3AI9X 3OIIA 1MI7R 5D9FA 4YQ6A 4YQ1A 4JWHA 4CNDA 4YQNA 3NK7A 3FRWA 3G1CA 3N4KA 1TO0A 4YQ5A 1NXZA 3E5YA 3GYQA 4X3LA 4YQQA 4YQAA 3ONPA 3IEFA 2O3AA 4CNEA 4YQKA 3SSWN 5GMBA 4YQTA 4IG6A 5GM8A 1X7PA 2YY8A 3ILKA 4JALA 4YQ3A 1NS5A 1GZ0A 3O7BA 4L69A 1P9PA 4YPZA 3BBHA 3KNUA 4RG1A 2QMMA 4MCDA 4H3YA 2OZ9R 1J85A 1UAMA 3BBEA 3NK6A 2Z0YA 3IC6A 3KTYA 4XBOA 1UAJA 2I6DA 5FAIA 3L8UA 1WRSR 4PZKA 3AXZA 1WRPR
chains in the Genus database with same CATH topology
1VH0A 4YQ0A 4X3MA 4YQOA 3OINA 1Z85A 4FMWA 3QUVA 4YQ4A 4YVIA 4YQLA 1K3RA 4KDZA 1OY5A 4YQSA 4JWFA 4YQ7A 4YQGA 4JWGA 2HA8A 1UAKA 1O6DA 4KGNA 1V6ZA 5CO4A 4YQ8A 4YVJA 4H3ZA 1UALA 4CNGA 3OIJA 3DCMX 4YQJA 4J3CA 1VHYA 4MCCA 3BBDA 4YQ2A 4YQCA 1IPAA 4CNFA 2QWVA 4YVGA 1VHKA 4YPYA 4FAKA 2EGVA 2EGWA 4JAKA 4YQRA 3KW2A 4YQPA 1MXIA 2V3KA 1V2XA 4YQDA 4E8BA 4JWJA 3N4JA 4YPWA 4YVHA 3KY7A 2V3JA 4MCBA 3AIAA 4YQ9A 4YVKA 5GMCA 4YQIA 4YQBA 2CX8A 4YPXA 1ZJRA 3AI9X 3OIIA 5D9FA 4YQ6A 4YQ1A 4JWHA 4CNDA 4YQNA 3NK7A 3N4KA 1TO0A 4YQ5A 1NXZA 3E5YA 3GYQA 4X3LA 4YQQA 4YQAA 3ONPA 3IEFA 2O3AA 4CNEA 4YQKA 5GMBA 4YQTA 4IG6A 5GM8A 1X7PA 2YY8A 3ILKA 4JALA 4YQ3A 1NS5A 1GZ0A 3O7BA 4L69A 1P9PA 4YPZA 3BBHA 3KNUA 4RG1A 2QMMA 4MCDA 4H3YA 1J85A 1UAMA 3BBEA 3NK6A 2Z0YA 3IC6A 3KTYA 4XBOA 1UAJA 2I6DA 5FAIA 3L8UA 1X7OA 4PZKA 3AXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH0 A;  4YQ0 A;  4X3M A;  4YQO A;  3OIN A;  1Z85 A;  3QUV A;  4YQ4 A;  4YVI A;  4YQL A;  1K3R A;  4KDZ A;  1OY5 A;  4YQS A;  4YQ7 A;  4YQG A;  2HA8 A;  1UAK A;  1O6D A;  4KGN A;  1V6Z A;  5CO4 A;  4YQ8 A;  4YVJ A;  4H3Z A;  1UAL A;  4CNG A;  3OIJ A;  3DCM X;  4YQJ A;  4J3C A;  1VHY A;  4MCC A;  3BBD A;  4YQ2 A;  4YQC A;  1IPA A;  4CNF A;  2QWV A;  4YVG A;  1VHK A;  4YPY A;  4FAK A;  2EGV A;  2EGW A;  4JAK A;  4YQR A;  3KW2 A;  4YQP A;  1MXI A;  2V3K A;  1V2X A;  4YQD A;  4E8B A;  3N4J A;  4YPW A;  4YVH A;  3KY7 A;  2V3J A;  4MCB A;  3AIA A;  4YQ9 A;  4YVK A;  5GMC A;  4YQI A;  4YQB A;  2CX8 A;  4YPX A;  1ZJR A;  3AI9 X;  3OII A;  5D9F A;  4YQ6 A;  4YQ1 A;  4CND A;  4YQN A;  3NK7 A;  3N4K A;  1TO0 A;  4YQ5 A;  1NXZ A;  3E5Y A;  3GYQ A;  4X3L A;  4YQQ A;  4YQA A;  3ONP A;  3IEF A;  2O3A A;  4CNE A;  4YQK A;  5GMB A;  4YQT A;  4IG6 A;  5GM8 A;  1X7P A;  2YY8 A;  3ILK A;  4JAL A;  4YQ3 A;  1NS5 A;  1GZ0 A;  3O7B A;  4L69 A;  1P9P A;  4YPZ A;  3BBH A;  3KNU A;  4RG1 A;  2QMM A;  4MCD A;  4H3Y A;  1J85 A;  1UAM A;  3BBE A;  3NK6 A;  2Z0Y A;  3IC6 A;  3KTY A;  4XBO A;  1UAJ A;  2I6D A;  5FAI A;  3L8U A;  1X7O A;  4PZK A;  3AXZ A; 
#chains in the Genus database with same CATH topology
 1VH0 A;  4YQ0 A;  4X3M A;  4YQO A;  3OIN A;  3SSX N;  1Z85 A;  4FMW A;  3QUV A;  4YQ4 A;  4YVI A;  4YQL A;  1K3R A;  4KDZ A;  1TRR A;  1X7O A;  1OY5 A;  4YQS A;  4JWF A;  4YQ7 A;  4YQG A;  1JHG A;  2XDI A;  4JWG A;  2HA8 A;  1UAK A;  3WRP A;  1O6D A;  4KGN A;  1V6Z A;  5CO4 A;  4YQ8 A;  4YVJ A;  4H3Z A;  1CO0 A;  1WRT R;  1UAL A;  4CNG A;  3OIJ A;  3DCM X;  4YQJ A;  4J3C A;  1VHY A;  4MCC A;  3BBD A;  4YQ2 A;  4YQC A;  1IPA A;  4CNF A;  2QWV A;  4YVG A;  1VHK A;  3KOR A;  4YPY A;  4FAK A;  2EGV A;  1RCS A;  2EGW A;  4JAK A;  4YQR A;  3KW2 A;  4YQP A;  1MXI A;  1ZT9 A;  2V3K A;  1V2X A;  4YQD A;  4E8B A;  4JWJ A;  3N4J A;  4YPW A;  4YVH A;  3KY7 A;  2V3J A;  4MCB A;  3AIA A;  4YQ9 A;  4YVK A;  5GMC A;  4YQI A;  4YQB A;  2CX8 A;  4YPX A;  1TRO A;  1ZJR A;  3AI9 X;  3OII A;  1MI7 R;  5D9F A;  4YQ6 A;  4YQ1 A;  4JWH A;  4CND A;  4YQN A;  3NK7 A;  3FRW A;  3G1C A;  3N4K A;  1TO0 A;  4YQ5 A;  1NXZ A;  3E5Y A;  3GYQ A;  4X3L A;  4YQQ A;  4YQA A;  3ONP A;  3IEF A;  2O3A A;  4CNE A;  4YQK A;  3SSW N;  5GMB A;  4YQT A;  4IG6 A;  5GM8 A;  1X7P A;  2YY8 A;  3ILK A;  4JAL A;  4YQ3 A;  1NS5 A;  1GZ0 A;  3O7B A;  4L69 A;  1P9P A;  4YPZ A;  3BBH A;  3KNU A;  4RG1 A;  2QMM A;  4MCD A;  4H3Y A;  2OZ9 R;  1J85 A;  1UAM A;  3BBE A;  3NK6 A;  2Z0Y A;  3IC6 A;  3KTY A;  4XBO A;  1UAJ A;  2I6D A;  5FAI A;  3L8U A;  1WRS R;  4PZK A;  3AXZ A;  1WRP R; 
#chains in the Genus database with same CATH homology
 1VH0 A;  4YQ0 A;  4X3M A;  4YQO A;  3OIN A;  1Z85 A;  4FMW A;  3QUV A;  4YQ4 A;  4YVI A;  4YQL A;  1K3R A;  4KDZ A;  1OY5 A;  4YQS A;  4JWF A;  4YQ7 A;  4YQG A;  4JWG A;  2HA8 A;  1UAK A;  1O6D A;  4KGN A;  1V6Z A;  5CO4 A;  4YQ8 A;  4YVJ A;  4H3Z A;  1UAL A;  4CNG A;  3OIJ A;  3DCM X;  4YQJ A;  4J3C A;  1VHY A;  4MCC A;  3BBD A;  4YQ2 A;  4YQC A;  1IPA A;  4CNF A;  2QWV A;  4YVG A;  1VHK A;  4YPY A;  4FAK A;  2EGV A;  2EGW A;  4JAK A;  4YQR A;  3KW2 A;  4YQP A;  1MXI A;  2V3K A;  1V2X A;  4YQD A;  4E8B A;  4JWJ A;  3N4J A;  4YPW A;  4YVH A;  3KY7 A;  2V3J A;  4MCB A;  3AIA A;  4YQ9 A;  4YVK A;  5GMC A;  4YQI A;  4YQB A;  2CX8 A;  4YPX A;  1ZJR A;  3AI9 X;  3OII A;  5D9F A;  4YQ6 A;  4YQ1 A;  4JWH A;  4CND A;  4YQN A;  3NK7 A;  3N4K A;  1TO0 A;  4YQ5 A;  1NXZ A;  3E5Y A;  3GYQ A;  4X3L A;  4YQQ A;  4YQA A;  3ONP A;  3IEF A;  2O3A A;  4CNE A;  4YQK A;  5GMB A;  4YQT A;  4IG6 A;  5GM8 A;  1X7P A;  2YY8 A;  3ILK A;  4JAL A;  4YQ3 A;  1NS5 A;  1GZ0 A;  3O7B A;  4L69 A;  1P9P A;  4YPZ A;  3BBH A;  3KNU A;  4RG1 A;  2QMM A;  4MCD A;  4H3Y A;  1J85 A;  1UAM A;  3BBE A;  3NK6 A;  2Z0Y A;  3IC6 A;  3KTY A;  4XBO A;  1UAJ A;  2I6D A;  5FAI A;  3L8U A;  1X7O A;  4PZK A;  3AXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...