4YQKA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
237
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 73
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqkA01
1ZJRA 3OIIA 4YQCA 4YQGA 3KNUA 3AI9X 4YPXA 1VHKA 4XBOA 3KY7A 3IEFA 4YVGA 4YPZA 2I6DA 3ILKA 4KDZA 2EGVA 2CX8A 5GMCA 3O7BA 1UAMA 2O3AA 2QWVA 2HA8A 3KW2A 4KGNA 4YQPA 3AXZA 1V6ZA 1V2XA 4MCCA 4J3CA 3QUVA 4YQOA 4X3MA 3N4KA 2YY8A 4YQKA 1X7PA 1O6DA 4CNDA 4YQIA 4X3LA 2V3JA 3DCMX 1K3RA 4MCDA 4YQJA 4YVIA 4MCBA 4YQNA 1VH0A 5GM8A 4YQ0A 4YQBA 3BBDA 4YPWA 4YQTA 4YQ3A 4CNGA 1IPAA 2Z0YA 3BBEA 3GYQA 1TO0A 3OIJA 3NK6A 4YQLA 1UAJA 4YQ4A 4JAKA 5GMBA 4YQ6A 3OINA 4YPYA 2QMMA 3IC6A 4PZKA 5FAIA 1NS5A 4RG1A 5CO4A 4H3YA 2EGWA 1MXIA 4CNFA 4YVHA 1P9PA 1VHYA 1Z85A 3NK7A 4YQ5A 4JALA 4CNEA 1UAKA 3N4JA 4YQ2A 3AIAA 1UALA 4IG6A 3KTYA 5D9FA 3L8UA 1X7OA 1J85A 4L69A 4YVJA 4YQDA 4H3ZA 4YVKA 2V3KA 4YQ1A 4FAKA 4YQAA 1OY5A 4YQ8A 4YQ9A 4YQSA 3ONPA 4YQQA 1GZ0A 4YQ7A 3BBHA 3E5YA 4YQRA 1NXZA 4E8BA
chains in the Genus database with same CATH superfamily
1ZJRA 3OIIA 4YQCA 4YQGA 3KNUA 1CO0A 3AI9X 4YPXA 1VHKA 4XBOA 3KY7A 3IEFA 4YVGA 4YPZA 2I6DA 3ILKA 4KDZA 2EGVA 2CX8A 5GMCA 3O7BA 1UAMA 2O3AA 2QWVA 2HA8A 3KW2A 4KGNA 4YQPA 4JWJA 3AXZA 1V6ZA 1V2XA 4MCCA 3FRWA 4J3CA 3QUVA 4YQOA 4X3MA 3N4KA 2YY8A 3SSWN 4YQKA 3SSXN 1JHGA 1X7PA 3KORA 1O6DA 4CNDA 4YQIA 4X3LA 2V3JA 3DCMX 1K3RA 4MCDA 4YQJA 1TROA 4YVIA 4MCBA 4YQNA 1VH0A 3WRPA 5GM8A 4YQ0A 4JWHA 4YQBA 3BBDA 4JWGA 4YPWA 4YQTA 4YQ3A 1RCSA 4CNGA 1IPAA 4JWFA 2Z0YA 3BBEA 3GYQA 1TO0A 3OIJA 3NK6A 4YQLA 1UAJA 4YQ4A 1WRSR 4JAKA 5GMBA 4YQ6A 3OINA 4YPYA 2QMMA 3IC6A 4PZKA 1WRPR 5FAIA 1NS5A 4RG1A 5CO4A 4FMWA 4H3YA 2EGWA 1MXIA 4CNFA 1P9PA 4YVHA 1VHYA 1Z85A 1ZT9A 3NK7A 4YQ5A 4JALA 1WRTR 4CNEA 1UAKA 3N4JA 4YQ2A 3AIAA 1UALA 4IG6A 3G1CA 3KTYA 5D9FA 3L8UA 1X7OA 1J85A 4L69A 4YVJA 1TRRA 4YQDA 4H3ZA 4YVKA 2V3KA 2XDIA 4YQ1A 4FAKA 4YQAA 1OY5A 4YQ8A 4YQ9A 4YQSA 2OZ9R 3ONPA 4YQQA 1MI7R 1GZ0A 4YQ7A 3BBHA 3E5YA 4YQRA 1NXZA 4E8BA
chains in the Genus database with same CATH topology
1ZJRA 3OIIA 4YQCA 4YQGA 3KNUA 3AI9X 4YPXA 1VHKA 4XBOA 3KY7A 3IEFA 4YVGA 4YPZA 2I6DA 3ILKA 4KDZA 2EGVA 2CX8A 5GMCA 3O7BA 1UAMA 2O3AA 2QWVA 2HA8A 3KW2A 4KGNA 4YQPA 4JWJA 3AXZA 1V6ZA 1V2XA 4MCCA 4J3CA 3QUVA 4YQOA 4X3MA 3N4KA 2YY8A 4YQKA 1X7PA 1O6DA 4CNDA 4YQIA 4X3LA 2V3JA 3DCMX 1K3RA 4MCDA 4YQJA 4YVIA 4MCBA 4YQNA 1VH0A 5GM8A 4YQ0A 4JWHA 4YQBA 3BBDA 4JWGA 4YPWA 4YQTA 4YQ3A 4CNGA 1IPAA 4JWFA 2Z0YA 3BBEA 3GYQA 1TO0A 3OIJA 3NK6A 4YQLA 1UAJA 4YQ4A 4JAKA 5GMBA 4YQ6A 3OINA 4YPYA 2QMMA 3IC6A 4PZKA 5FAIA 1NS5A 4RG1A 5CO4A 4FMWA 4H3YA 2EGWA 1MXIA 4CNFA 4YVHA 1P9PA 1VHYA 1Z85A 3NK7A 4YQ5A 4JALA 4CNEA 1UAKA 3N4JA 4YQ2A 3AIAA 1UALA 4IG6A 3KTYA 5D9FA 3L8UA 1X7OA 1J85A 4L69A 4YVJA 4YQDA 4H3ZA 4YVKA 2V3KA 4YQ1A 4FAKA 4YQAA 1OY5A 4YQ8A 4YQ9A 4YQSA 3ONPA 4YQQA 1GZ0A 4YQ7A 3BBHA 3E5YA 4YQRA 1NXZA 4E8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJR A;  3OII A;  4YQC A;  4YQG A;  3KNU A;  3AI9 X;  4YPX A;  1VHK A;  4XBO A;  3KY7 A;  3IEF A;  4YVG A;  4YPZ A;  2I6D A;  3ILK A;  4KDZ A;  2EGV A;  2CX8 A;  5GMC A;  3O7B A;  1UAM A;  2O3A A;  2QWV A;  2HA8 A;  3KW2 A;  4KGN A;  4YQP A;  3AXZ A;  1V6Z A;  1V2X A;  4MCC A;  4J3C A;  3QUV A;  4YQO A;  4X3M A;  3N4K A;  2YY8 A;  4YQK A;  1X7P A;  1O6D A;  4CND A;  4YQI A;  4X3L A;  2V3J A;  3DCM X;  1K3R A;  4MCD A;  4YQJ A;  4YVI A;  4MCB A;  4YQN A;  1VH0 A;  5GM8 A;  4YQ0 A;  4YQB A;  3BBD A;  4YPW A;  4YQT A;  4YQ3 A;  4CNG A;  1IPA A;  2Z0Y A;  3BBE A;  3GYQ A;  1TO0 A;  3OIJ A;  3NK6 A;  4YQL A;  1UAJ A;  4YQ4 A;  4JAK A;  5GMB A;  4YQ6 A;  3OIN A;  4YPY A;  2QMM A;  3IC6 A;  4PZK A;  5FAI A;  1NS5 A;  4RG1 A;  5CO4 A;  4H3Y A;  2EGW A;  1MXI A;  4CNF A;  4YVH A;  1P9P A;  1VHY A;  1Z85 A;  3NK7 A;  4YQ5 A;  4JAL A;  4CNE A;  1UAK A;  3N4J A;  4YQ2 A;  3AIA A;  1UAL A;  4IG6 A;  3KTY A;  5D9F A;  3L8U A;  1X7O A;  1J85 A;  4L69 A;  4YVJ A;  4YQD A;  4H3Z A;  4YVK A;  2V3K A;  4YQ1 A;  4FAK A;  4YQA A;  1OY5 A;  4YQ8 A;  4YQ9 A;  4YQS A;  3ONP A;  4YQQ A;  1GZ0 A;  4YQ7 A;  3BBH A;  3E5Y A;  4YQR A;  1NXZ A;  4E8B A; 
#chains in the Genus database with same CATH topology
 1ZJR A;  3OII A;  4YQC A;  4YQG A;  3KNU A;  1CO0 A;  3AI9 X;  4YPX A;  1VHK A;  4XBO A;  3KY7 A;  3IEF A;  4YVG A;  4YPZ A;  2I6D A;  3ILK A;  4KDZ A;  2EGV A;  2CX8 A;  5GMC A;  3O7B A;  1UAM A;  2O3A A;  2QWV A;  2HA8 A;  3KW2 A;  4KGN A;  4YQP A;  4JWJ A;  3AXZ A;  1V6Z A;  1V2X A;  4MCC A;  3FRW A;  4J3C A;  3QUV A;  4YQO A;  4X3M A;  3N4K A;  2YY8 A;  3SSW N;  4YQK A;  3SSX N;  1JHG A;  1X7P A;  3KOR A;  1O6D A;  4CND A;  4YQI A;  4X3L A;  2V3J A;  3DCM X;  1K3R A;  4MCD A;  4YQJ A;  1TRO A;  4YVI A;  4MCB A;  4YQN A;  1VH0 A;  3WRP A;  5GM8 A;  4YQ0 A;  4JWH A;  4YQB A;  3BBD A;  4JWG A;  4YPW A;  4YQT A;  4YQ3 A;  1RCS A;  4CNG A;  1IPA A;  4JWF A;  2Z0Y A;  3BBE A;  3GYQ A;  1TO0 A;  3OIJ A;  3NK6 A;  4YQL A;  1UAJ A;  4YQ4 A;  1WRS R;  4JAK A;  5GMB A;  4YQ6 A;  3OIN A;  4YPY A;  2QMM A;  3IC6 A;  4PZK A;  1WRP R;  5FAI A;  1NS5 A;  4RG1 A;  5CO4 A;  4FMW A;  4H3Y A;  2EGW A;  1MXI A;  4CNF A;  1P9P A;  4YVH A;  1VHY A;  1Z85 A;  1ZT9 A;  3NK7 A;  4YQ5 A;  4JAL A;  1WRT R;  4CNE A;  1UAK A;  3N4J A;  4YQ2 A;  3AIA A;  1UAL A;  4IG6 A;  3G1C A;  3KTY A;  5D9F A;  3L8U A;  1X7O A;  1J85 A;  4L69 A;  4YVJ A;  1TRR A;  4YQD A;  4H3Z A;  4YVK A;  2V3K A;  2XDI A;  4YQ1 A;  4FAK A;  4YQA A;  1OY5 A;  4YQ8 A;  4YQ9 A;  4YQS A;  2OZ9 R;  3ONP A;  4YQQ A;  1MI7 R;  1GZ0 A;  4YQ7 A;  3BBH A;  3E5Y A;  4YQR A;  1NXZ A;  4E8B A; 
#chains in the Genus database with same CATH homology
 1ZJR A;  3OII A;  4YQC A;  4YQG A;  3KNU A;  3AI9 X;  4YPX A;  1VHK A;  4XBO A;  3KY7 A;  3IEF A;  4YVG A;  4YPZ A;  2I6D A;  3ILK A;  4KDZ A;  2EGV A;  2CX8 A;  5GMC A;  3O7B A;  1UAM A;  2O3A A;  2QWV A;  2HA8 A;  3KW2 A;  4KGN A;  4YQP A;  4JWJ A;  3AXZ A;  1V6Z A;  1V2X A;  4MCC A;  4J3C A;  3QUV A;  4YQO A;  4X3M A;  3N4K A;  2YY8 A;  4YQK A;  1X7P A;  1O6D A;  4CND A;  4YQI A;  4X3L A;  2V3J A;  3DCM X;  1K3R A;  4MCD A;  4YQJ A;  4YVI A;  4MCB A;  4YQN A;  1VH0 A;  5GM8 A;  4YQ0 A;  4JWH A;  4YQB A;  3BBD A;  4JWG A;  4YPW A;  4YQT A;  4YQ3 A;  4CNG A;  1IPA A;  4JWF A;  2Z0Y A;  3BBE A;  3GYQ A;  1TO0 A;  3OIJ A;  3NK6 A;  4YQL A;  1UAJ A;  4YQ4 A;  4JAK A;  5GMB A;  4YQ6 A;  3OIN A;  4YPY A;  2QMM A;  3IC6 A;  4PZK A;  5FAI A;  1NS5 A;  4RG1 A;  5CO4 A;  4FMW A;  4H3Y A;  2EGW A;  1MXI A;  4CNF A;  4YVH A;  1P9P A;  1VHY A;  1Z85 A;  3NK7 A;  4YQ5 A;  4JAL A;  4CNE A;  1UAK A;  3N4J A;  4YQ2 A;  3AIA A;  1UAL A;  4IG6 A;  3KTY A;  5D9F A;  3L8U A;  1X7O A;  1J85 A;  4L69 A;  4YVJ A;  4YQD A;  4H3Z A;  4YVK A;  2V3K A;  4YQ1 A;  4FAK A;  4YQA A;  1OY5 A;  4YQ8 A;  4YQ9 A;  4YQS A;  3ONP A;  4YQQ A;  1GZ0 A;  4YQ7 A;  3BBH A;  3E5Y A;  4YQR A;  1NXZ A;  4E8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...