4YQQA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
248
structure length
236
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 69
structure length 236
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqqA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqqA01
1UAMA 3BBEA 4YQ5A 3ONPA 1VHYA 3OIIA 4YQQA 1IPAA 5D9FA 1UALA 4YQPA 3N4JA 4YQJA 1VHKA 5GMCA 4L69A 4YQIA 4JAKA 4YQKA 4YQ9A 4YQDA 4YVHA 4YQGA 4CNEA 4YQ4A 4YVJA 4YPXA 4KGNA 2CX8A 3NK7A 4X3MA 3OIJA 4YVKA 4RG1A 3AXZA 3KY7A 3N4KA 4MCCA 1TO0A 3NK6A 3KW2A 4YQ3A 2QWVA 4H3ZA 1ZJRA 4XBOA 1O6DA 4H3YA 3KNUA 4IG6A 2V3KA 4J3CA 2HA8A 2O3AA 3DCMX 4KDZA 4CNGA 4FAKA 2QMMA 4CNFA 4YQLA 4YQ0A 4YQOA 1K3RA 4YPZA 4YQNA 3GYQA 4YQSA 3IEFA 4YQ2A 3BBHA 4PZKA 2Z0YA 4YVIA 4E8BA 4JALA 1V6ZA 2V3JA 1GZ0A 3BBDA 2EGWA 4YQ6A 3OINA 4CNDA 1J85A 1X7PA 2I6DA 3AI9X 3E5YA 4YQ8A 4YQ1A 3IC6A 1UAJA 1V2XA 1UAKA 3QUVA 5GM8A 1P9PA 4YVGA 4YQ7A 3L8UA 2EGVA 5CO4A 4X3LA 4YQCA 4YQTA 1MXIA 1X7OA 1VH0A 5GMBA 3ILKA 4MCDA 3KTYA 4YQAA 4YQRA 2YY8A 4MCBA 3AIAA 1NXZA 1Z85A 5FAIA 4YPYA 3O7BA 1OY5A 1NS5A 4YPWA 4YQBA
chains in the Genus database with same CATH superfamily
1UAMA 3BBEA 2OZ9R 4YQ5A 3ONPA 1VHYA 3OIIA 4YQQA 3KORA 1IPAA 5D9FA 1UALA 4YQPA 3N4JA 1WRPR 4YQJA 1VHKA 5GMCA 4L69A 4YQIA 3SSWN 4JAKA 4YQKA 4YQ9A 4YQDA 4YVHA 4YQGA 4CNEA 4YQ4A 4YVJA 4YPXA 4KGNA 2CX8A 3NK7A 4X3MA 3OIJA 4YVKA 4RG1A 3AXZA 3KY7A 3FRWA 3N4KA 4MCCA 1TO0A 3NK6A 3KW2A 1WRTR 4YQ3A 2QWVA 4H3ZA 1ZJRA 4XBOA 1O6DA 1ZT9A 3KNUA 4H3YA 4IG6A 2V3KA 4J3CA 2HA8A 2O3AA 3DCMX 1TRRA 4KDZA 4CNGA 4FAKA 2QMMA 4CNFA 4YQLA 4YQ0A 4YQOA 1K3RA 4YPZA 4YQNA 3GYQA 4YQSA 3IEFA 4YQ2A 3BBHA 3WRPA 4PZKA 2Z0YA 4YVIA 4FMWA 4E8BA 3G1CA 2XDIA 4JALA 1V6ZA 1RCSA 1GZ0A 2V3JA 3BBDA 2EGWA 4YQ6A 3OINA 4CNDA 1J85A 1X7PA 2I6DA 3AI9X 3E5YA 4YQ8A 4YQ1A 3IC6A 1UAJA 1V2XA 1UAKA 3QUVA 5GM8A 1P9PA 4YVGA 4YQ7A 3L8UA 2EGVA 5CO4A 4X3LA 4YQCA 4YQTA 1MXIA 1X7OA 1VH0A 5GMBA 3SSXN 3ILKA 4MCDA 1WRSR 3KTYA 1TROA 4JWJA 4YQAA 4YQRA 2YY8A 4MCBA 1JHGA 4JWGA 3AIAA 4JWHA 1NXZA 1Z85A 5FAIA 4YPYA 3O7BA 1OY5A 1NS5A 4YPWA 4YQBA 1MI7R 4JWFA 1CO0A
chains in the Genus database with same CATH topology
1UAMA 3BBEA 4YQ5A 3ONPA 1VHYA 3OIIA 4YQQA 1IPAA 5D9FA 1UALA 4YQPA 3N4JA 4YQJA 1VHKA 5GMCA 4L69A 4YQIA 4JAKA 4YQKA 4YQ9A 4YQDA 4YVHA 4YQGA 4CNEA 4YQ4A 4YVJA 4YPXA 4KGNA 2CX8A 3NK7A 4X3MA 3OIJA 4YVKA 4RG1A 3AXZA 3KY7A 3N4KA 4MCCA 1TO0A 3NK6A 3KW2A 4YQ3A 2QWVA 4H3ZA 1ZJRA 4XBOA 1O6DA 4H3YA 3KNUA 4IG6A 2V3KA 4J3CA 2HA8A 2O3AA 3DCMX 4KDZA 4CNGA 4FAKA 2QMMA 4CNFA 4YQLA 4YQ0A 4YQOA 1K3RA 4YPZA 4YQNA 3GYQA 4YQSA 3IEFA 4YQ2A 3BBHA 4PZKA 2Z0YA 4YVIA 4FMWA 4E8BA 4JALA 1V6ZA 2V3JA 1GZ0A 3BBDA 2EGWA 4YQ6A 3OINA 4CNDA 1J85A 1X7PA 2I6DA 3AI9X 3E5YA 4YQ8A 4YQ1A 3IC6A 1UAJA 1V2XA 1UAKA 3QUVA 5GM8A 1P9PA 4YVGA 4YQ7A 3L8UA 2EGVA 5CO4A 4X3LA 4YQCA 4YQTA 1MXIA 1X7OA 1VH0A 5GMBA 3ILKA 4MCDA 3KTYA 4JWJA 4YQAA 4YQRA 2YY8A 4MCBA 4JWGA 3AIAA 4JWHA 1NXZA 1Z85A 5FAIA 4YPYA 3O7BA 1OY5A 1NS5A 4YPWA 4YQBA 4JWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAM A;  3BBE A;  4YQ5 A;  3ONP A;  1VHY A;  3OII A;  4YQQ A;  1IPA A;  5D9F A;  1UAL A;  4YQP A;  3N4J A;  4YQJ A;  1VHK A;  5GMC A;  4L69 A;  4YQI A;  4JAK A;  4YQK A;  4YQ9 A;  4YQD A;  4YVH A;  4YQG A;  4CNE A;  4YQ4 A;  4YVJ A;  4YPX A;  4KGN A;  2CX8 A;  3NK7 A;  4X3M A;  3OIJ A;  4YVK A;  4RG1 A;  3AXZ A;  3KY7 A;  3N4K A;  4MCC A;  1TO0 A;  3NK6 A;  3KW2 A;  4YQ3 A;  2QWV A;  4H3Z A;  1ZJR A;  4XBO A;  1O6D A;  4H3Y A;  3KNU A;  4IG6 A;  2V3K A;  4J3C A;  2HA8 A;  2O3A A;  3DCM X;  4KDZ A;  4CNG A;  4FAK A;  2QMM A;  4CNF A;  4YQL A;  4YQ0 A;  4YQO A;  1K3R A;  4YPZ A;  4YQN A;  3GYQ A;  4YQS A;  3IEF A;  4YQ2 A;  3BBH A;  4PZK A;  2Z0Y A;  4YVI A;  4E8B A;  4JAL A;  1V6Z A;  2V3J A;  1GZ0 A;  3BBD A;  2EGW A;  4YQ6 A;  3OIN A;  4CND A;  1J85 A;  1X7P A;  2I6D A;  3AI9 X;  3E5Y A;  4YQ8 A;  4YQ1 A;  3IC6 A;  1UAJ A;  1V2X A;  1UAK A;  3QUV A;  5GM8 A;  1P9P A;  4YVG A;  4YQ7 A;  3L8U A;  2EGV A;  5CO4 A;  4X3L A;  4YQC A;  4YQT A;  1MXI A;  1X7O A;  1VH0 A;  5GMB A;  3ILK A;  4MCD A;  3KTY A;  4YQA A;  4YQR A;  2YY8 A;  4MCB A;  3AIA A;  1NXZ A;  1Z85 A;  5FAI A;  4YPY A;  3O7B A;  1OY5 A;  1NS5 A;  4YPW A;  4YQB A; 
#chains in the Genus database with same CATH topology
 1UAM A;  3BBE A;  2OZ9 R;  4YQ5 A;  3ONP A;  1VHY A;  3OII A;  4YQQ A;  3KOR A;  1IPA A;  5D9F A;  1UAL A;  4YQP A;  3N4J A;  1WRP R;  4YQJ A;  1VHK A;  5GMC A;  4L69 A;  4YQI A;  3SSW N;  4JAK A;  4YQK A;  4YQ9 A;  4YQD A;  4YVH A;  4YQG A;  4CNE A;  4YQ4 A;  4YVJ A;  4YPX A;  4KGN A;  2CX8 A;  3NK7 A;  4X3M A;  3OIJ A;  4YVK A;  4RG1 A;  3AXZ A;  3KY7 A;  3FRW A;  3N4K A;  4MCC A;  1TO0 A;  3NK6 A;  3KW2 A;  1WRT R;  4YQ3 A;  2QWV A;  4H3Z A;  1ZJR A;  4XBO A;  1O6D A;  1ZT9 A;  3KNU A;  4H3Y A;  4IG6 A;  2V3K A;  4J3C A;  2HA8 A;  2O3A A;  3DCM X;  1TRR A;  4KDZ A;  4CNG A;  4FAK A;  2QMM A;  4CNF A;  4YQL A;  4YQ0 A;  4YQO A;  1K3R A;  4YPZ A;  4YQN A;  3GYQ A;  4YQS A;  3IEF A;  4YQ2 A;  3BBH A;  3WRP A;  4PZK A;  2Z0Y A;  4YVI A;  4FMW A;  4E8B A;  3G1C A;  2XDI A;  4JAL A;  1V6Z A;  1RCS A;  1GZ0 A;  2V3J A;  3BBD A;  2EGW A;  4YQ6 A;  3OIN A;  4CND A;  1J85 A;  1X7P A;  2I6D A;  3AI9 X;  3E5Y A;  4YQ8 A;  4YQ1 A;  3IC6 A;  1UAJ A;  1V2X A;  1UAK A;  3QUV A;  5GM8 A;  1P9P A;  4YVG A;  4YQ7 A;  3L8U A;  2EGV A;  5CO4 A;  4X3L A;  4YQC A;  4YQT A;  1MXI A;  1X7O A;  1VH0 A;  5GMB A;  3SSX N;  3ILK A;  4MCD A;  1WRS R;  3KTY A;  1TRO A;  4JWJ A;  4YQA A;  4YQR A;  2YY8 A;  4MCB A;  1JHG A;  4JWG A;  3AIA A;  4JWH A;  1NXZ A;  1Z85 A;  5FAI A;  4YPY A;  3O7B A;  1OY5 A;  1NS5 A;  4YPW A;  4YQB A;  1MI7 R;  4JWF A;  1CO0 A; 
#chains in the Genus database with same CATH homology
 1UAM A;  3BBE A;  4YQ5 A;  3ONP A;  1VHY A;  3OII A;  4YQQ A;  1IPA A;  5D9F A;  1UAL A;  4YQP A;  3N4J A;  4YQJ A;  1VHK A;  5GMC A;  4L69 A;  4YQI A;  4JAK A;  4YQK A;  4YQ9 A;  4YQD A;  4YVH A;  4YQG A;  4CNE A;  4YQ4 A;  4YVJ A;  4YPX A;  4KGN A;  2CX8 A;  3NK7 A;  4X3M A;  3OIJ A;  4YVK A;  4RG1 A;  3AXZ A;  3KY7 A;  3N4K A;  4MCC A;  1TO0 A;  3NK6 A;  3KW2 A;  4YQ3 A;  2QWV A;  4H3Z A;  1ZJR A;  4XBO A;  1O6D A;  4H3Y A;  3KNU A;  4IG6 A;  2V3K A;  4J3C A;  2HA8 A;  2O3A A;  3DCM X;  4KDZ A;  4CNG A;  4FAK A;  2QMM A;  4CNF A;  4YQL A;  4YQ0 A;  4YQO A;  1K3R A;  4YPZ A;  4YQN A;  3GYQ A;  4YQS A;  3IEF A;  4YQ2 A;  3BBH A;  4PZK A;  2Z0Y A;  4YVI A;  4FMW A;  4E8B A;  4JAL A;  1V6Z A;  2V3J A;  1GZ0 A;  3BBD A;  2EGW A;  4YQ6 A;  3OIN A;  4CND A;  1J85 A;  1X7P A;  2I6D A;  3AI9 X;  3E5Y A;  4YQ8 A;  4YQ1 A;  3IC6 A;  1UAJ A;  1V2X A;  1UAK A;  3QUV A;  5GM8 A;  1P9P A;  4YVG A;  4YQ7 A;  3L8U A;  2EGV A;  5CO4 A;  4X3L A;  4YQC A;  4YQT A;  1MXI A;  1X7O A;  1VH0 A;  5GMB A;  3ILK A;  4MCD A;  3KTY A;  4JWJ A;  4YQA A;  4YQR A;  2YY8 A;  4MCB A;  4JWG A;  3AIA A;  4JWH A;  1NXZ A;  1Z85 A;  5FAI A;  4YPY A;  3O7B A;  1OY5 A;  1NS5 A;  4YPW A;  4YQB A;  4JWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...