4YQQA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
248
structure length
236
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 69
structure length 236
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqqA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqqA01
4YPZA 4YQPA 4YQRA 4RG1A 4YQSA 4YQNA 4KDZA 4JAKA 1V2XA 4YPYA 2V3JA 4YQJA 2YY8A 4JALA 2CX8A 4XBOA 3ONPA 4YQ4A 3ILKA 1MXIA 1UAMA 4CNGA 4YQOA 4YQCA 4L69A 2QWVA 4FAKA 1Z85A 4YQ6A 1O6DA 4E8BA 4YVHA 4YPWA 4YQ5A 3NK7A 3KTYA 5GMBA 1IPAA 1OY5A 1X7OA 3OINA 4CNDA 4KGNA 3IEFA 4YQ9A 3E5YA 1X7PA 4MCDA 4YQ2A 4X3LA 1UAKA 2QMMA 5CO4A 1GZ0A 5FAIA 2O3AA 1NS5A 3O7BA 3L8UA 4CNFA 4YQ8A 4YVJA 3BBEA 1VHKA 4YQIA 1TO0A 4X3MA 1VH0A 1NXZA 3BBHA 3KNUA 2V3KA 3N4JA 3AIAA 2HA8A 4YVIA 4YQDA 4YQQA 2I6DA 4YQ0A 4PZKA 2EGWA 3IC6A 4YPXA 4YQAA 4YVKA 4YQ3A 4H3YA 3N4KA 3OIIA 4MCCA 3DCMX 3OIJA 1P9PA 2EGVA 2Z0YA 4YQ1A 3AXZA 4YQTA 1K3RA 1UAJA 1J85A 4YQBA 4YQKA 3AI9X 4IG6A 3KW2A 4YQ7A 4J3CA 4CNEA 3NK6A 4YQLA 3BBDA 5D9FA 4YVGA 3KY7A 3QUVA 1V6ZA 4YQGA 3GYQA 1VHYA 5GM8A 4H3ZA 1UALA 5GMCA 1ZJRA 4MCBA
chains in the Genus database with same CATH superfamily
4YPZA 4YQPA 4JWJA 4YQRA 4RG1A 4YQSA 4YQNA 4KDZA 4JAKA 1V2XA 4YPYA 2V3JA 4YQJA 2YY8A 4JALA 2CX8A 4XBOA 3KORA 1ZJRA 3ONPA 4YQ4A 3ILKA 1MXIA 1UAMA 1RCSA 4CNGA 4YQOA 4L69A 2QWVA 4FAKA 1Z85A 4YQ6A 1O6DA 4E8BA 4YVHA 4YPWA 4YQ5A 3NK7A 3KTYA 5GMBA 1MI7R 1IPAA 1OY5A 4FMWA 1X7OA 3OINA 4CNDA 4KGNA 3IEFA 4YQ9A 3E5YA 1X7PA 4MCDA 4YQ2A 4X3LA 1UAKA 2QMMA 5CO4A 1GZ0A 5FAIA 3G1CA 1NS5A 2O3AA 3O7BA 3L8UA 2OZ9R 4YQ8A 4YVJA 4CNFA 3BBEA 1VHKA 4YQIA 1TO0A 4JWGA 4X3MA 1VH0A 1NXZA 3BBHA 3KNUA 2V3KA 3N4JA 2XDIA 3AIAA 2HA8A 4YVIA 4YQDA 3WRPA 4YQQA 2I6DA 4YQ0A 4PZKA 2EGWA 3IC6A 4YPXA 4YQAA 4YVKA 4YQ3A 4H3YA 3N4KA 3OIIA 3SSWN 4MCCA 3DCMX 3OIJA 1TRRA 1P9PA 2EGVA 2Z0YA 4YQ1A 3AXZA 4YQTA 1K3RA 1UAJA 1J85A 4JWFA 4YQBA 4YQKA 3AI9X 4IG6A 3KW2A 4YQ7A 4J3CA 4CNEA 3NK6A 1ZT9A 4YQLA 1WRSR 3BBDA 5D9FA 3FRWA 4YVGA 3KY7A 3QUVA 1V6ZA 4YQGA 1CO0A 1WRTR 1VHYA 3GYQA 5GM8A 4H3ZA 1JHGA 1WRPR 1UALA 3SSXN 5GMCA 4JWHA 4YQCA 1TROA 4MCBA
chains in the Genus database with same CATH topology
4YPZA 4YQPA 4JWJA 4YQRA 4RG1A 4YQSA 4YQNA 4KDZA 4JAKA 1V2XA 4YPYA 2V3JA 4YQJA 2YY8A 4JALA 2CX8A 4XBOA 3ONPA 4YQ4A 3ILKA 1MXIA 1UAMA 4CNGA 4YQOA 4YQCA 4L69A 2QWVA 4FAKA 1Z85A 4YQ6A 1O6DA 4E8BA 4YVHA 4YPWA 4YQ5A 3NK7A 3KTYA 5GMBA 1IPAA 1OY5A 4FMWA 1X7OA 3OINA 4CNDA 4KGNA 3IEFA 4YQ9A 3E5YA 1X7PA 4MCDA 4YQ2A 4X3LA 1UAKA 2QMMA 5CO4A 1GZ0A 5FAIA 2O3AA 1NS5A 3O7BA 3L8UA 4CNFA 4YQ8A 4YVJA 3BBEA 1VHKA 4YQIA 1TO0A 4JWGA 4X3MA 1VH0A 1NXZA 3BBHA 3KNUA 2V3KA 3N4JA 3AIAA 2HA8A 4YVIA 4YQDA 4YQQA 2I6DA 4YQ0A 4PZKA 2EGWA 3IC6A 4YPXA 4YQAA 4YVKA 4YQ3A 4H3YA 3N4KA 3OIIA 4MCCA 3DCMX 3OIJA 1P9PA 2EGVA 2Z0YA 4YQ1A 3AXZA 4YQTA 1K3RA 1UAJA 1J85A 4JWFA 4YQBA 4YQKA 3AI9X 4IG6A 3KW2A 4YQ7A 4J3CA 4CNEA 3NK6A 4YQLA 3BBDA 5D9FA 4YVGA 3KY7A 3QUVA 1V6ZA 4YQGA 3GYQA 1VHYA 5GM8A 4H3ZA 1UALA 5GMCA 4JWHA 1ZJRA 4MCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPZ A;  4YQP A;  4YQR A;  4RG1 A;  4YQS A;  4YQN A;  4KDZ A;  4JAK A;  1V2X A;  4YPY A;  2V3J A;  4YQJ A;  2YY8 A;  4JAL A;  2CX8 A;  4XBO A;  3ONP A;  4YQ4 A;  3ILK A;  1MXI A;  1UAM A;  4CNG A;  4YQO A;  4YQC A;  4L69 A;  2QWV A;  4FAK A;  1Z85 A;  4YQ6 A;  1O6D A;  4E8B A;  4YVH A;  4YPW A;  4YQ5 A;  3NK7 A;  3KTY A;  5GMB A;  1IPA A;  1OY5 A;  1X7O A;  3OIN A;  4CND A;  4KGN A;  3IEF A;  4YQ9 A;  3E5Y A;  1X7P A;  4MCD A;  4YQ2 A;  4X3L A;  1UAK A;  2QMM A;  5CO4 A;  1GZ0 A;  5FAI A;  2O3A A;  1NS5 A;  3O7B A;  3L8U A;  4CNF A;  4YQ8 A;  4YVJ A;  3BBE A;  1VHK A;  4YQI A;  1TO0 A;  4X3M A;  1VH0 A;  1NXZ A;  3BBH A;  3KNU A;  2V3K A;  3N4J A;  3AIA A;  2HA8 A;  4YVI A;  4YQD A;  4YQQ A;  2I6D A;  4YQ0 A;  4PZK A;  2EGW A;  3IC6 A;  4YPX A;  4YQA A;  4YVK A;  4YQ3 A;  4H3Y A;  3N4K A;  3OII A;  4MCC A;  3DCM X;  3OIJ A;  1P9P A;  2EGV A;  2Z0Y A;  4YQ1 A;  3AXZ A;  4YQT A;  1K3R A;  1UAJ A;  1J85 A;  4YQB A;  4YQK A;  3AI9 X;  4IG6 A;  3KW2 A;  4YQ7 A;  4J3C A;  4CNE A;  3NK6 A;  4YQL A;  3BBD A;  5D9F A;  4YVG A;  3KY7 A;  3QUV A;  1V6Z A;  4YQG A;  3GYQ A;  1VHY A;  5GM8 A;  4H3Z A;  1UAL A;  5GMC A;  1ZJR A;  4MCB A; 
#chains in the Genus database with same CATH topology
 4YPZ A;  4YQP A;  4JWJ A;  4YQR A;  4RG1 A;  4YQS A;  4YQN A;  4KDZ A;  4JAK A;  1V2X A;  4YPY A;  2V3J A;  4YQJ A;  2YY8 A;  4JAL A;  2CX8 A;  4XBO A;  3KOR A;  1ZJR A;  3ONP A;  4YQ4 A;  3ILK A;  1MXI A;  1UAM A;  1RCS A;  4CNG A;  4YQO A;  4L69 A;  2QWV A;  4FAK A;  1Z85 A;  4YQ6 A;  1O6D A;  4E8B A;  4YVH A;  4YPW A;  4YQ5 A;  3NK7 A;  3KTY A;  5GMB A;  1MI7 R;  1IPA A;  1OY5 A;  4FMW A;  1X7O A;  3OIN A;  4CND A;  4KGN A;  3IEF A;  4YQ9 A;  3E5Y A;  1X7P A;  4MCD A;  4YQ2 A;  4X3L A;  1UAK A;  2QMM A;  5CO4 A;  1GZ0 A;  5FAI A;  3G1C A;  1NS5 A;  2O3A A;  3O7B A;  3L8U A;  2OZ9 R;  4YQ8 A;  4YVJ A;  4CNF A;  3BBE A;  1VHK A;  4YQI A;  1TO0 A;  4JWG A;  4X3M A;  1VH0 A;  1NXZ A;  3BBH A;  3KNU A;  2V3K A;  3N4J A;  2XDI A;  3AIA A;  2HA8 A;  4YVI A;  4YQD A;  3WRP A;  4YQQ A;  2I6D A;  4YQ0 A;  4PZK A;  2EGW A;  3IC6 A;  4YPX A;  4YQA A;  4YVK A;  4YQ3 A;  4H3Y A;  3N4K A;  3OII A;  3SSW N;  4MCC A;  3DCM X;  3OIJ A;  1TRR A;  1P9P A;  2EGV A;  2Z0Y A;  4YQ1 A;  3AXZ A;  4YQT A;  1K3R A;  1UAJ A;  1J85 A;  4JWF A;  4YQB A;  4YQK A;  3AI9 X;  4IG6 A;  3KW2 A;  4YQ7 A;  4J3C A;  4CNE A;  3NK6 A;  1ZT9 A;  4YQL A;  1WRS R;  3BBD A;  5D9F A;  3FRW A;  4YVG A;  3KY7 A;  3QUV A;  1V6Z A;  4YQG A;  1CO0 A;  1WRT R;  1VHY A;  3GYQ A;  5GM8 A;  4H3Z A;  1JHG A;  1WRP R;  1UAL A;  3SSX N;  5GMC A;  4JWH A;  4YQC A;  1TRO A;  4MCB A; 
#chains in the Genus database with same CATH homology
 4YPZ A;  4YQP A;  4JWJ A;  4YQR A;  4RG1 A;  4YQS A;  4YQN A;  4KDZ A;  4JAK A;  1V2X A;  4YPY A;  2V3J A;  4YQJ A;  2YY8 A;  4JAL A;  2CX8 A;  4XBO A;  3ONP A;  4YQ4 A;  3ILK A;  1MXI A;  1UAM A;  4CNG A;  4YQO A;  4YQC A;  4L69 A;  2QWV A;  4FAK A;  1Z85 A;  4YQ6 A;  1O6D A;  4E8B A;  4YVH A;  4YPW A;  4YQ5 A;  3NK7 A;  3KTY A;  5GMB A;  1IPA A;  1OY5 A;  4FMW A;  1X7O A;  3OIN A;  4CND A;  4KGN A;  3IEF A;  4YQ9 A;  3E5Y A;  1X7P A;  4MCD A;  4YQ2 A;  4X3L A;  1UAK A;  2QMM A;  5CO4 A;  1GZ0 A;  5FAI A;  2O3A A;  1NS5 A;  3O7B A;  3L8U A;  4CNF A;  4YQ8 A;  4YVJ A;  3BBE A;  1VHK A;  4YQI A;  1TO0 A;  4JWG A;  4X3M A;  1VH0 A;  1NXZ A;  3BBH A;  3KNU A;  2V3K A;  3N4J A;  3AIA A;  2HA8 A;  4YVI A;  4YQD A;  4YQQ A;  2I6D A;  4YQ0 A;  4PZK A;  2EGW A;  3IC6 A;  4YPX A;  4YQA A;  4YVK A;  4YQ3 A;  4H3Y A;  3N4K A;  3OII A;  4MCC A;  3DCM X;  3OIJ A;  1P9P A;  2EGV A;  2Z0Y A;  4YQ1 A;  3AXZ A;  4YQT A;  1K3R A;  1UAJ A;  1J85 A;  4JWF A;  4YQB A;  4YQK A;  3AI9 X;  4IG6 A;  3KW2 A;  4YQ7 A;  4J3C A;  4CNE A;  3NK6 A;  4YQL A;  3BBD A;  5D9F A;  4YVG A;  3KY7 A;  3QUV A;  1V6Z A;  4YQG A;  3GYQ A;  1VHY A;  5GM8 A;  4H3Z A;  1UAL A;  5GMC A;  4JWH A;  1ZJR A;  4MCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...