3IEFA

Crystal structure of trna guanine-n1-methyltransferase from bartonella henselae using mpcs.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
Knots found
sequence length
229
structure length
224
Chain Sequence
KFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFASVDDTPAGGGAGMVMRADVLAAALDSCPNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLEHPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYALYNKNRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, rna binding protein
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA guanine-n1-methyltransferase from Bartonella henselae using MPCS.
rcsb
source organism Bartonella henselae
total genus 63
structure length 224
sequence length 229
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3iefA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3iefA01
4YVKA 3BBDA 3NK6A 4H3ZA 4YVHA 5GMBA 3DCMX 3AI9X 2QWVA 2CX8A 3KY7A 1X7OA 5GM8A 3KNUA 1P9PA 3BBEA 2Z0YA 4CNFA 3ILKA 3OINA 4H3YA 3E5YA 4YPZA 4YQKA 4YPXA 1OY5A 3IC6A 2EGWA 1ZJRA 3N4JA 4MCDA 4IG6A 1IPAA 3KW2A 3GYQA 4YVGA 4CNGA 4KDZA 2V3JA 4YQ3A 4YQ4A 1UAKA 1NS5A 3N4KA 4JAKA 3ONPA 3BBHA 2I6DA 4YQBA 5D9FA 1VHYA 4YQ1A 1K3RA 2EGVA 1UAMA 3O7BA 1UAJA 4YQ2A 4RG1A 1GZ0A 4L69A 4CNEA 1UALA 4YQPA 2YY8A 3QUVA 1J85A 4YQIA 1VHKA 2HA8A 4FAKA 4KGNA 4XBOA 4YQTA 4JALA 4CNDA 1TO0A 5GMCA 2QMMA 4YVJA 3IEFA 3AXZA 4YQGA 5FAIA 3KTYA 1V2XA 3NK7A 4YQ0A 1O6DA 4X3MA 3OIJA 4YQDA 3OIIA 1V6ZA 4YQLA 4MCBA 1X7PA 4YVIA 4YQ9A 2O3AA 4YQCA 4YQSA 3AIAA 4YQJA 4YQNA 1MXIA 1VH0A 4YQ5A 5CO4A 4MCCA 4YQ6A 4YPWA 4YPYA 4YQRA 4YQOA 1NXZA 4X3LA 4YQ7A 4J3CA 4YQ8A 3L8UA 4YQAA 4YQQA 4PZKA 1Z85A 4E8BA 2V3KA
chains in the Genus database with same CATH superfamily
1MI7R 4YVKA 3BBDA 3SSXN 3KORA 4H3ZA 3NK6A 4YVHA 5GMBA 3DCMX 3AI9X 2QWVA 2CX8A 3KY7A 1X7OA 5GM8A 1P9PA 3KNUA 1WRPR 2Z0YA 3BBEA 3ILKA 4CNFA 3OINA 4H3YA 3WRPA 1JHGA 3E5YA 4YPZA 4YQKA 4YPXA 1OY5A 4JWFA 3IC6A 2EGWA 1ZJRA 3N4JA 4MCDA 4IG6A 1IPAA 3KW2A 3GYQA 4YVGA 4CNGA 1TROA 2V3JA 4KDZA 4YQ3A 4YQ4A 1UAKA 1NS5A 3N4KA 4JAKA 3ONPA 3BBHA 2I6DA 4YQBA 5D9FA 1VHYA 4YQ1A 1K3RA 2EGVA 1UAMA 3O7BA 1UAJA 4YQ2A 1RCSA 4RG1A 1GZ0A 1WRTR 4L69A 4CNEA 1UALA 4YQPA 2YY8A 3QUVA 1J85A 4YQIA 1TRRA 2OZ9R 1WRSR 3FRWA 1VHKA 4JWHA 2HA8A 4FAKA 4KGNA 1CO0A 4XBOA 4YQTA 4JALA 4CNDA 1TO0A 5GMCA 2QMMA 3G1CA 4FMWA 4YVJA 3IEFA 2XDIA 3AXZA 4YQGA 5FAIA 4JWJA 3KTYA 1V2XA 3NK7A 4YQ0A 1O6DA 4X3MA 3OIJA 4YQDA 3OIIA 1V6ZA 4YQLA 4MCBA 1X7PA 4YVIA 4YQ9A 4YQCA 2O3AA 4YQSA 3AIAA 4YQJA 4YQNA 1MXIA 1VH0A 4YQ5A 5CO4A 4MCCA 3SSWN 1ZT9A 4YQ6A 4YPWA 4YPYA 4YQRA 4YQOA 1NXZA 4X3LA 4YQ7A 4J3CA 4YQ8A 3L8UA 4YQAA 4YQQA 4JWGA 4PZKA 1Z85A 4E8BA 2V3KA
chains in the Genus database with same CATH topology
4YVKA 3BBDA 3NK6A 4H3ZA 4YVHA 5GMBA 3DCMX 3AI9X 2QWVA 2CX8A 3KY7A 1X7OA 5GM8A 3KNUA 1P9PA 3BBEA 2Z0YA 4CNFA 3ILKA 3OINA 4H3YA 3E5YA 4YPZA 4YQKA 4YPXA 1OY5A 4JWFA 3IC6A 2EGWA 1ZJRA 3N4JA 4MCDA 4IG6A 1IPAA 3KW2A 3GYQA 4YVGA 4CNGA 4KDZA 2V3JA 4YQ3A 4YQ4A 1UAKA 1NS5A 3N4KA 4JAKA 3ONPA 3BBHA 2I6DA 4YQBA 5D9FA 1VHYA 4YQ1A 1K3RA 2EGVA 1UAMA 3O7BA 1UAJA 4YQ2A 4RG1A 1GZ0A 4L69A 4CNEA 1UALA 4YQPA 2YY8A 3QUVA 1J85A 4YQIA 1VHKA 4JWHA 2HA8A 4FAKA 4KGNA 4XBOA 4YQTA 4JALA 4CNDA 1TO0A 5GMCA 2QMMA 4FMWA 4YVJA 3IEFA 3AXZA 4YQGA 5FAIA 4JWJA 3KTYA 1V2XA 3NK7A 4YQ0A 1O6DA 4X3MA 3OIJA 4YQDA 3OIIA 1V6ZA 4YQLA 4MCBA 1X7PA 4YVIA 4YQ9A 2O3AA 4YQCA 4YQSA 3AIAA 4YQJA 4YQNA 1MXIA 1VH0A 4YQ5A 5CO4A 4MCCA 4YQ6A 4YPWA 4YPYA 4YQRA 4YQOA 1NXZA 4X3LA 4YQ7A 4J3CA 4YQ8A 3L8UA 4YQAA 4YQQA 4JWGA 4PZKA 1Z85A 4E8BA 2V3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVK A;  3BBD A;  3NK6 A;  4H3Z A;  4YVH A;  5GMB A;  3DCM X;  3AI9 X;  2QWV A;  2CX8 A;  3KY7 A;  1X7O A;  5GM8 A;  3KNU A;  1P9P A;  3BBE A;  2Z0Y A;  4CNF A;  3ILK A;  3OIN A;  4H3Y A;  3E5Y A;  4YPZ A;  4YQK A;  4YPX A;  1OY5 A;  3IC6 A;  2EGW A;  1ZJR A;  3N4J A;  4MCD A;  4IG6 A;  1IPA A;  3KW2 A;  3GYQ A;  4YVG A;  4CNG A;  4KDZ A;  2V3J A;  4YQ3 A;  4YQ4 A;  1UAK A;  1NS5 A;  3N4K A;  4JAK A;  3ONP A;  3BBH A;  2I6D A;  4YQB A;  5D9F A;  1VHY A;  4YQ1 A;  1K3R A;  2EGV A;  1UAM A;  3O7B A;  1UAJ A;  4YQ2 A;  4RG1 A;  1GZ0 A;  4L69 A;  4CNE A;  1UAL A;  4YQP A;  2YY8 A;  3QUV A;  1J85 A;  4YQI A;  1VHK A;  2HA8 A;  4FAK A;  4KGN A;  4XBO A;  4YQT A;  4JAL A;  4CND A;  1TO0 A;  5GMC A;  2QMM A;  4YVJ A;  3IEF A;  3AXZ A;  4YQG A;  5FAI A;  3KTY A;  1V2X A;  3NK7 A;  4YQ0 A;  1O6D A;  4X3M A;  3OIJ A;  4YQD A;  3OII A;  1V6Z A;  4YQL A;  4MCB A;  1X7P A;  4YVI A;  4YQ9 A;  2O3A A;  4YQC A;  4YQS A;  3AIA A;  4YQJ A;  4YQN A;  1MXI A;  1VH0 A;  4YQ5 A;  5CO4 A;  4MCC A;  4YQ6 A;  4YPW A;  4YPY A;  4YQR A;  4YQO A;  1NXZ A;  4X3L A;  4YQ7 A;  4J3C A;  4YQ8 A;  3L8U A;  4YQA A;  4YQQ A;  4PZK A;  1Z85 A;  4E8B A;  2V3K A; 
#chains in the Genus database with same CATH topology
 1MI7 R;  4YVK A;  3BBD A;  3SSX N;  3KOR A;  4H3Z A;  3NK6 A;  4YVH A;  5GMB A;  3DCM X;  3AI9 X;  2QWV A;  2CX8 A;  3KY7 A;  1X7O A;  5GM8 A;  1P9P A;  3KNU A;  1WRP R;  2Z0Y A;  3BBE A;  3ILK A;  4CNF A;  3OIN A;  4H3Y A;  3WRP A;  1JHG A;  3E5Y A;  4YPZ A;  4YQK A;  4YPX A;  1OY5 A;  4JWF A;  3IC6 A;  2EGW A;  1ZJR A;  3N4J A;  4MCD A;  4IG6 A;  1IPA A;  3KW2 A;  3GYQ A;  4YVG A;  4CNG A;  1TRO A;  2V3J A;  4KDZ A;  4YQ3 A;  4YQ4 A;  1UAK A;  1NS5 A;  3N4K A;  4JAK A;  3ONP A;  3BBH A;  2I6D A;  4YQB A;  5D9F A;  1VHY A;  4YQ1 A;  1K3R A;  2EGV A;  1UAM A;  3O7B A;  1UAJ A;  4YQ2 A;  1RCS A;  4RG1 A;  1GZ0 A;  1WRT R;  4L69 A;  4CNE A;  1UAL A;  4YQP A;  2YY8 A;  3QUV A;  1J85 A;  4YQI A;  1TRR A;  2OZ9 R;  1WRS R;  3FRW A;  1VHK A;  4JWH A;  2HA8 A;  4FAK A;  4KGN A;  1CO0 A;  4XBO A;  4YQT A;  4JAL A;  4CND A;  1TO0 A;  5GMC A;  2QMM A;  3G1C A;  4FMW A;  4YVJ A;  3IEF A;  2XDI A;  3AXZ A;  4YQG A;  5FAI A;  4JWJ A;  3KTY A;  1V2X A;  3NK7 A;  4YQ0 A;  1O6D A;  4X3M A;  3OIJ A;  4YQD A;  3OII A;  1V6Z A;  4YQL A;  4MCB A;  1X7P A;  4YVI A;  4YQ9 A;  4YQC A;  2O3A A;  4YQS A;  3AIA A;  4YQJ A;  4YQN A;  1MXI A;  1VH0 A;  4YQ5 A;  5CO4 A;  4MCC A;  3SSW N;  1ZT9 A;  4YQ6 A;  4YPW A;  4YPY A;  4YQR A;  4YQO A;  1NXZ A;  4X3L A;  4YQ7 A;  4J3C A;  4YQ8 A;  3L8U A;  4YQA A;  4YQQ A;  4JWG A;  4PZK A;  1Z85 A;  4E8B A;  2V3K A; 
#chains in the Genus database with same CATH homology
 4YVK A;  3BBD A;  3NK6 A;  4H3Z A;  4YVH A;  5GMB A;  3DCM X;  3AI9 X;  2QWV A;  2CX8 A;  3KY7 A;  1X7O A;  5GM8 A;  3KNU A;  1P9P A;  3BBE A;  2Z0Y A;  4CNF A;  3ILK A;  3OIN A;  4H3Y A;  3E5Y A;  4YPZ A;  4YQK A;  4YPX A;  1OY5 A;  4JWF A;  3IC6 A;  2EGW A;  1ZJR A;  3N4J A;  4MCD A;  4IG6 A;  1IPA A;  3KW2 A;  3GYQ A;  4YVG A;  4CNG A;  4KDZ A;  2V3J A;  4YQ3 A;  4YQ4 A;  1UAK A;  1NS5 A;  3N4K A;  4JAK A;  3ONP A;  3BBH A;  2I6D A;  4YQB A;  5D9F A;  1VHY A;  4YQ1 A;  1K3R A;  2EGV A;  1UAM A;  3O7B A;  1UAJ A;  4YQ2 A;  4RG1 A;  1GZ0 A;  4L69 A;  4CNE A;  1UAL A;  4YQP A;  2YY8 A;  3QUV A;  1J85 A;  4YQI A;  1VHK A;  4JWH A;  2HA8 A;  4FAK A;  4KGN A;  4XBO A;  4YQT A;  4JAL A;  4CND A;  1TO0 A;  5GMC A;  2QMM A;  4FMW A;  4YVJ A;  3IEF A;  3AXZ A;  4YQG A;  5FAI A;  4JWJ A;  3KTY A;  1V2X A;  3NK7 A;  4YQ0 A;  1O6D A;  4X3M A;  3OIJ A;  4YQD A;  3OII A;  1V6Z A;  4YQL A;  4MCB A;  1X7P A;  4YVI A;  4YQ9 A;  2O3A A;  4YQC A;  4YQS A;  3AIA A;  4YQJ A;  4YQN A;  1MXI A;  1VH0 A;  4YQ5 A;  5CO4 A;  4MCC A;  4YQ6 A;  4YPW A;  4YPY A;  4YQR A;  4YQO A;  1NXZ A;  4X3L A;  4YQ7 A;  4J3C A;  4YQ8 A;  3L8U A;  4YQA A;  4YQQ A;  4JWG A;  4PZK A;  1Z85 A;  4E8B A;  2V3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...