3IEFA

Crystal structure of trna guanine-n1-methyltransferase from bartonella henselae using mpcs.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
Knots found
sequence length
229
structure length
224
Chain Sequence
b'KFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFASVDDTPAGGGAGMVMRADVLAAALDSCPNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLEHPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYALYNKNRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA guanine-n1-methyltransferase from Bartonella henselae using MPCS.
rcsb
source organism Bartonella henselae
molecule tags Transferase, rna binding protein
total genus 63
structure length 224
sequence length 229
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3iefA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3iefA01
4YPWA 3ILKA 1NS5A 1J85A 3L8UA 4KGNA 3KY7A 4YPZA 1GZ0A 1IPAA 4YQKA 4YVIA 1O6DA 4CNDA 3GYQA 5D9FA 4YQTA 4IG6A 1VHYA 3OIJA 1VH0A 5GM8A 1UAMA 4RG1A 2CX8A 3BBHA 1ZJRA 4YVJA 1OY5A 3AI9X 5GMCA 4YQDA 2V3KA 4L69A 3ONPA 4YVHA 1Z85A 2Z0YA 4YQ5A 2O3AA 4MCDA 4YQ2A 4YQ8A 2V3JA 4YQ9A 4YPXA 4YQGA 4YQ7A 3DCMX 4XBOA 3KNUA 1K3RA 4YQ6A 3OIIA 5CO4A 1NXZA 1MXIA 4FAKA 4CNGA 3AXZA 3IEFA 1X7OA 4CNFA 3KW2A 4H3YA 2EGWA 2QMMA 4KDZA 4MCCA 3BBDA 3E5YA 4JALA 1UAKA 4YQIA 2HA8A 5GMBA 3QUVA 4YQRA 4YPYA 4E8BA 3N4KA 3N4JA 4YQAA 4YQ0A 1TO0A 4YQJA 4YQ1A 4JAKA 4X3MA 5FAIA 1P9PA 2EGVA 4YQCA 4J3CA 1X7PA 4YQLA 4YQ3A 2I6DA 1VHKA 3NK6A 4PZKA 3NK7A 4MCBA 4YVGA 4YQ4A 2QWVA 3IC6A 3OINA 3O7BA 3BBEA 1UAJA 3KTYA 1UALA 2YY8A 4YQQA 3AIAA 4YVKA 1V6ZA 4YQPA 4YQBA 1V2XA 4X3LA 4H3ZA 4CNEA 4YQSA 4YQNA 4YQOA
chains in the Genus database with same CATH superfamily
4YPWA 3ILKA 1CO0A 1NS5A 1J85A 3L8UA 4KGNA 3KY7A 4YPZA 1GZ0A 1WRTR 1IPAA 4YQKA 4YVIA 1O6DA 4CNDA 3GYQA 5D9FA 3WRPA 4YQTA 3G1CA 4IG6A 1VHYA 3OIJA 1VH0A 5GM8A 1UAMA 4RG1A 2CX8A 3BBHA 1ZJRA 4YVJA 1OY5A 3AI9X 5GMCA 4YQDA 2V3KA 4L69A 3ONPA 4YVHA 1Z85A 1WRSR 4YQ5A 2Z0YA 2O3AA 4MCDA 4JWHA 4YQ2A 4YQ8A 2V3JA 4YQ9A 4YPXA 4YQGA 4YQ7A 3DCMX 4XBOA 3KNUA 1K3RA 4YQ6A 3OIIA 5CO4A 1NXZA 1MXIA 4FAKA 4CNGA 3AXZA 3IEFA 1X7OA 1MI7R 4CNFA 3SSWN 3KW2A 4H3YA 2EGWA 1TRRA 4JWGA 2QMMA 4KDZA 4MCCA 3BBDA 3E5YA 4JALA 1UAKA 4YQIA 2HA8A 5GMBA 3QUVA 4YQRA 2XDIA 4YPYA 4E8BA 3N4KA 3N4JA 4YQAA 4YQ0A 1TO0A 2OZ9R 4YQJA 4YQ1A 4JAKA 4X3MA 5FAIA 1P9PA 1JHGA 2EGVA 4YQCA 4J3CA 1X7PA 1ZT9A 4YQLA 4YQ3A 1VHKA 2I6DA 3NK6A 4PZKA 1WRPR 3NK7A 4MCBA 4YVGA 4YQ4A 4JWJA 4FMWA 2QWVA 3IC6A 3OINA 3O7BA 3KORA 3BBEA 1UAJA 3SSXN 3KTYA 1UALA 1TROA 2YY8A 3FRWA 4YQQA 3AIAA 4YVKA 1RCSA 1V6ZA 4YQPA 4YQBA 4JWFA 1V2XA 4X3LA 4H3ZA 4CNEA 4YQSA 4YQNA 4YQOA
chains in the Genus database with same CATH topology
4YPWA 3ILKA 1NS5A 1J85A 3L8UA 4KGNA 3KY7A 4YPZA 1GZ0A 1IPAA 4YQKA 4YVIA 1O6DA 4CNDA 3GYQA 5D9FA 4YQTA 4IG6A 1VHYA 3OIJA 1VH0A 5GM8A 1UAMA 4RG1A 2CX8A 3BBHA 1ZJRA 4YVJA 1OY5A 3AI9X 5GMCA 4YQDA 2V3KA 4L69A 3ONPA 4YVHA 1Z85A 2Z0YA 4YQ5A 2O3AA 4MCDA 4JWHA 4YQ2A 4YQ8A 2V3JA 4YQ9A 4YPXA 4YQGA 4YQ7A 3DCMX 4XBOA 3KNUA 1K3RA 4YQ6A 3OIIA 5CO4A 1NXZA 1MXIA 4FAKA 4CNGA 3AXZA 3IEFA 1X7OA 4CNFA 3KW2A 4H3YA 2EGWA 4JWGA 2QMMA 4KDZA 4MCCA 3BBDA 3E5YA 4JALA 1UAKA 4YQIA 2HA8A 5GMBA 3QUVA 4YQRA 4YPYA 4E8BA 3N4KA 3N4JA 4YQAA 4YQ0A 1TO0A 4YQJA 4YQ1A 4JAKA 4X3MA 5FAIA 1P9PA 2EGVA 4YQCA 4J3CA 1X7PA 4YQLA 4YQ3A 2I6DA 1VHKA 3NK6A 4PZKA 3NK7A 4MCBA 4YVGA 4YQ4A 4JWJA 4FMWA 2QWVA 3IC6A 3OINA 3O7BA 3BBEA 1UAJA 3KTYA 1UALA 2YY8A 4YQQA 3AIAA 4YVKA 1V6ZA 4YQPA 4YQBA 4JWFA 1V2XA 4X3LA 4H3ZA 4CNEA 4YQSA 4YQNA 4YQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPW A;  3ILK A;  1NS5 A;  1J85 A;  3L8U A;  4KGN A;  3KY7 A;  4YPZ A;  1GZ0 A;  1IPA A;  4YQK A;  4YVI A;  1O6D A;  4CND A;  3GYQ A;  5D9F A;  4YQT A;  4IG6 A;  1VHY A;  3OIJ A;  1VH0 A;  5GM8 A;  1UAM A;  4RG1 A;  2CX8 A;  3BBH A;  1ZJR A;  4YVJ A;  1OY5 A;  3AI9 X;  5GMC A;  4YQD A;  2V3K A;  4L69 A;  3ONP A;  4YVH A;  1Z85 A;  2Z0Y A;  4YQ5 A;  2O3A A;  4MCD A;  4YQ2 A;  4YQ8 A;  2V3J A;  4YQ9 A;  4YPX A;  4YQG A;  4YQ7 A;  3DCM X;  4XBO A;  3KNU A;  1K3R A;  4YQ6 A;  3OII A;  5CO4 A;  1NXZ A;  1MXI A;  4FAK A;  4CNG A;  3AXZ A;  3IEF A;  1X7O A;  4CNF A;  3KW2 A;  4H3Y A;  2EGW A;  2QMM A;  4KDZ A;  4MCC A;  3BBD A;  3E5Y A;  4JAL A;  1UAK A;  4YQI A;  2HA8 A;  5GMB A;  3QUV A;  4YQR A;  4YPY A;  4E8B A;  3N4K A;  3N4J A;  4YQA A;  4YQ0 A;  1TO0 A;  4YQJ A;  4YQ1 A;  4JAK A;  4X3M A;  5FAI A;  1P9P A;  2EGV A;  4YQC A;  4J3C A;  1X7P A;  4YQL A;  4YQ3 A;  2I6D A;  1VHK A;  3NK6 A;  4PZK A;  3NK7 A;  4MCB A;  4YVG A;  4YQ4 A;  2QWV A;  3IC6 A;  3OIN A;  3O7B A;  3BBE A;  1UAJ A;  3KTY A;  1UAL A;  2YY8 A;  4YQQ A;  3AIA A;  4YVK A;  1V6Z A;  4YQP A;  4YQB A;  1V2X A;  4X3L A;  4H3Z A;  4CNE A;  4YQS A;  4YQN A;  4YQO A; 
#chains in the Genus database with same CATH topology
 4YPW A;  3ILK A;  1CO0 A;  1NS5 A;  1J85 A;  3L8U A;  4KGN A;  3KY7 A;  4YPZ A;  1GZ0 A;  1WRT R;  1IPA A;  4YQK A;  4YVI A;  1O6D A;  4CND A;  3GYQ A;  5D9F A;  3WRP A;  4YQT A;  3G1C A;  4IG6 A;  1VHY A;  3OIJ A;  1VH0 A;  5GM8 A;  1UAM A;  4RG1 A;  2CX8 A;  3BBH A;  1ZJR A;  4YVJ A;  1OY5 A;  3AI9 X;  5GMC A;  4YQD A;  2V3K A;  4L69 A;  3ONP A;  4YVH A;  1Z85 A;  1WRS R;  4YQ5 A;  2Z0Y A;  2O3A A;  4MCD A;  4JWH A;  4YQ2 A;  4YQ8 A;  2V3J A;  4YQ9 A;  4YPX A;  4YQG A;  4YQ7 A;  3DCM X;  4XBO A;  3KNU A;  1K3R A;  4YQ6 A;  3OII A;  5CO4 A;  1NXZ A;  1MXI A;  4FAK A;  4CNG A;  3AXZ A;  3IEF A;  1X7O A;  1MI7 R;  4CNF A;  3SSW N;  3KW2 A;  4H3Y A;  2EGW A;  1TRR A;  4JWG A;  2QMM A;  4KDZ A;  4MCC A;  3BBD A;  3E5Y A;  4JAL A;  1UAK A;  4YQI A;  2HA8 A;  5GMB A;  3QUV A;  4YQR A;  2XDI A;  4YPY A;  4E8B A;  3N4K A;  3N4J A;  4YQA A;  4YQ0 A;  1TO0 A;  2OZ9 R;  4YQJ A;  4YQ1 A;  4JAK A;  4X3M A;  5FAI A;  1P9P A;  1JHG A;  2EGV A;  4YQC A;  4J3C A;  1X7P A;  1ZT9 A;  4YQL A;  4YQ3 A;  1VHK A;  2I6D A;  3NK6 A;  4PZK A;  1WRP R;  3NK7 A;  4MCB A;  4YVG A;  4YQ4 A;  4JWJ A;  4FMW A;  2QWV A;  3IC6 A;  3OIN A;  3O7B A;  3KOR A;  3BBE A;  1UAJ A;  3SSX N;  3KTY A;  1UAL A;  1TRO A;  2YY8 A;  3FRW A;  4YQQ A;  3AIA A;  4YVK A;  1RCS A;  1V6Z A;  4YQP A;  4YQB A;  4JWF A;  1V2X A;  4X3L A;  4H3Z A;  4CNE A;  4YQS A;  4YQN A;  4YQO A; 
#chains in the Genus database with same CATH homology
 4YPW A;  3ILK A;  1NS5 A;  1J85 A;  3L8U A;  4KGN A;  3KY7 A;  4YPZ A;  1GZ0 A;  1IPA A;  4YQK A;  4YVI A;  1O6D A;  4CND A;  3GYQ A;  5D9F A;  4YQT A;  4IG6 A;  1VHY A;  3OIJ A;  1VH0 A;  5GM8 A;  1UAM A;  4RG1 A;  2CX8 A;  3BBH A;  1ZJR A;  4YVJ A;  1OY5 A;  3AI9 X;  5GMC A;  4YQD A;  2V3K A;  4L69 A;  3ONP A;  4YVH A;  1Z85 A;  2Z0Y A;  4YQ5 A;  2O3A A;  4MCD A;  4JWH A;  4YQ2 A;  4YQ8 A;  2V3J A;  4YQ9 A;  4YPX A;  4YQG A;  4YQ7 A;  3DCM X;  4XBO A;  3KNU A;  1K3R A;  4YQ6 A;  3OII A;  5CO4 A;  1NXZ A;  1MXI A;  4FAK A;  4CNG A;  3AXZ A;  3IEF A;  1X7O A;  4CNF A;  3KW2 A;  4H3Y A;  2EGW A;  4JWG A;  2QMM A;  4KDZ A;  4MCC A;  3BBD A;  3E5Y A;  4JAL A;  1UAK A;  4YQI A;  2HA8 A;  5GMB A;  3QUV A;  4YQR A;  4YPY A;  4E8B A;  3N4K A;  3N4J A;  4YQA A;  4YQ0 A;  1TO0 A;  4YQJ A;  4YQ1 A;  4JAK A;  4X3M A;  5FAI A;  1P9P A;  2EGV A;  4YQC A;  4J3C A;  1X7P A;  4YQL A;  4YQ3 A;  2I6D A;  1VHK A;  3NK6 A;  4PZK A;  3NK7 A;  4MCB A;  4YVG A;  4YQ4 A;  4JWJ A;  4FMW A;  2QWV A;  3IC6 A;  3OIN A;  3O7B A;  3BBE A;  1UAJ A;  3KTY A;  1UAL A;  2YY8 A;  4YQQ A;  3AIA A;  4YVK A;  1V6Z A;  4YQP A;  4YQB A;  4JWF A;  1V2X A;  4X3L A;  4H3Z A;  4CNE A;  4YQS A;  4YQN A;  4YQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...