3IEFA

Crystal structure of trna guanine-n1-methyltransferase from bartonella henselae using mpcs.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
Knots found
sequence length
229
structure length
224
Chain Sequence
KFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFASVDDTPAGGGAGMVMRADVLAAALDSCPNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLEHPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYALYNKNRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA guanine-n1-methyltransferase from Bartonella henselae using MPCS.
rcsb
source organism Bartonella henselae
molecule tags Transferase, rna binding protein
total genus 63
structure length 224
sequence length 229
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3iefA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3iefA01
1K3RA 4J3CA 5GMCA 4YQ3A 2EGWA 4X3LA 4H3ZA 4YQKA 4L69A 4YQBA 3OIJA 4JAKA 4YQNA 4YQJA 4YQ7A 3GYQA 3KW2A 2I6DA 4JALA 4XBOA 1VHYA 3IEFA 4MCBA 4YQCA 4MCDA 4YQ5A 1X7PA 4KGNA 3BBHA 4YPXA 1V2XA 3ONPA 4YQ0A 4YPZA 4YQOA 1NXZA 5FAIA 2V3JA 1V6ZA 4YVGA 4YQ4A 4FAKA 4YQ6A 4YPYA 3BBEA 2QWVA 2CX8A 4YQ9A 5CO4A 3IC6A 4H3YA 1MXIA 4YQGA 2O3AA 3BBDA 4X3MA 1P9PA 4YVKA 4E8BA 1O6DA 3OIIA 3L8UA 3OINA 4YQ1A 4YQTA 3E5YA 4YQPA 4RG1A 5GM8A 1UAKA 4YVJA 1OY5A 4IG6A 3ILKA 3N4JA 2V3KA 3KNUA 2QMMA 1GZ0A 3NK6A 4YQ8A 4YQ2A 1IPAA 4YQRA 4YQQA 4YQAA 1VH0A 2Z0YA 3NK7A 3DCMX 3KTYA 2EGVA 3AI9X 1UAJA 3KY7A 4PZKA 4MCCA 1UALA 4YQLA 2HA8A 4YQSA 5D9FA 5GMBA 4CNGA 1VHKA 4CNFA 4CNEA 4KDZA 1Z85A 4YVIA 1ZJRA 3QUVA 4YQDA 1UAMA 1NS5A 4YQIA 2YY8A 1J85A 1TO0A 4YVHA 4YPWA 3AXZA 1X7OA 3O7BA 3AIAA 4CNDA 3N4KA
chains in the Genus database with same CATH superfamily
1K3RA 4J3CA 2OZ9R 5GMCA 4YQ3A 2EGWA 4JWJA 4X3LA 4H3ZA 4YQKA 4L69A 4YQBA 3SSXN 3OIJA 4JAKA 4YQNA 4YQJA 4YQ7A 3GYQA 3KW2A 2I6DA 4JALA 4XBOA 1VHYA 1WRPR 3IEFA 4MCBA 4YQCA 4MCDA 4YQ5A 1X7PA 4KGNA 1TRRA 3BBHA 4YPXA 1V2XA 3ONPA 4YQ0A 1WRSR 4YPZA 4YQOA 1NXZA 5FAIA 1TROA 2V3JA 2XDIA 1V6ZA 4YVGA 4YQ4A 3WRPA 4YQ6A 4FAKA 4YPYA 3BBEA 3G1CA 2QWVA 2CX8A 4JWGA 4YQ9A 3SSWN 5CO4A 3IC6A 4H3YA 1MXIA 4YQGA 2O3AA 3BBDA 4X3MA 4JWHA 1CO0A 1P9PA 4YVKA 1MI7R 4E8BA 1O6DA 3OIIA 3L8UA 3OINA 4YQ1A 4YQTA 3E5YA 4YQPA 4RG1A 5GM8A 1UAKA 4YVJA 1OY5A 3FRWA 1WRTR 4IG6A 3ILKA 3N4JA 2V3KA 3KNUA 2QMMA 1GZ0A 3NK6A 4YQ8A 4YQ2A 1IPAA 1RCSA 4YQRA 4YQQA 4YQAA 1VH0A 2Z0YA 3NK7A 3DCMX 3KTYA 2EGVA 3KORA 1UAJA 3AI9X 3KY7A 4PZKA 1JHGA 4MCCA 1UALA 4YQLA 2HA8A 4YQSA 5D9FA 4JWFA 5GMBA 4CNGA 1ZT9A 1VHKA 4CNFA 4CNEA 4KDZA 1Z85A 4FMWA 4YVIA 1ZJRA 3QUVA 4YQDA 1UAMA 1NS5A 4YQIA 2YY8A 1J85A 1TO0A 4YVHA 4YPWA 3AXZA 1X7OA 3O7BA 3AIAA 4CNDA 3N4KA
chains in the Genus database with same CATH topology
1K3RA 4J3CA 5GMCA 4YQ3A 2EGWA 4JWJA 4X3LA 4H3ZA 4YQKA 4L69A 4YQBA 3OIJA 4JAKA 4YQNA 4YQJA 4YQ7A 3GYQA 3KW2A 2I6DA 4JALA 4XBOA 1VHYA 3IEFA 4MCBA 4YQCA 4MCDA 4YQ5A 1X7PA 4KGNA 3BBHA 4YPXA 1V2XA 3ONPA 4YQ0A 4YPZA 4YQOA 1NXZA 5FAIA 2V3JA 1V6ZA 4YVGA 4YQ4A 4FAKA 4YQ6A 4YPYA 3BBEA 2QWVA 2CX8A 4JWGA 4YQ9A 5CO4A 3IC6A 4H3YA 1MXIA 4YQGA 2O3AA 3BBDA 4X3MA 4JWHA 1P9PA 4YVKA 4E8BA 1O6DA 3OIIA 3L8UA 3OINA 4YQ1A 4YQTA 3E5YA 4YQPA 4RG1A 5GM8A 1UAKA 4YVJA 1OY5A 4IG6A 3ILKA 3N4JA 2V3KA 3KNUA 2QMMA 1GZ0A 3NK6A 4YQ8A 4YQ2A 1IPAA 4YQRA 4YQQA 4YQAA 1VH0A 2Z0YA 3NK7A 3DCMX 3KTYA 2EGVA 3AI9X 1UAJA 3KY7A 4PZKA 4MCCA 1UALA 4YQLA 2HA8A 4YQSA 5D9FA 4JWFA 5GMBA 4CNGA 1VHKA 4CNFA 4CNEA 4KDZA 1Z85A 4FMWA 4YVIA 1ZJRA 3QUVA 4YQDA 1UAMA 1NS5A 4YQIA 2YY8A 1J85A 1TO0A 4YVHA 4YPWA 3AXZA 1X7OA 3O7BA 3AIAA 4CNDA 3N4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  4J3C A;  5GMC A;  4YQ3 A;  2EGW A;  4X3L A;  4H3Z A;  4YQK A;  4L69 A;  4YQB A;  3OIJ A;  4JAK A;  4YQN A;  4YQJ A;  4YQ7 A;  3GYQ A;  3KW2 A;  2I6D A;  4JAL A;  4XBO A;  1VHY A;  3IEF A;  4MCB A;  4YQC A;  4MCD A;  4YQ5 A;  1X7P A;  4KGN A;  3BBH A;  4YPX A;  1V2X A;  3ONP A;  4YQ0 A;  4YPZ A;  4YQO A;  1NXZ A;  5FAI A;  2V3J A;  1V6Z A;  4YVG A;  4YQ4 A;  4FAK A;  4YQ6 A;  4YPY A;  3BBE A;  2QWV A;  2CX8 A;  4YQ9 A;  5CO4 A;  3IC6 A;  4H3Y A;  1MXI A;  4YQG A;  2O3A A;  3BBD A;  4X3M A;  1P9P A;  4YVK A;  4E8B A;  1O6D A;  3OII A;  3L8U A;  3OIN A;  4YQ1 A;  4YQT A;  3E5Y A;  4YQP A;  4RG1 A;  5GM8 A;  1UAK A;  4YVJ A;  1OY5 A;  4IG6 A;  3ILK A;  3N4J A;  2V3K A;  3KNU A;  2QMM A;  1GZ0 A;  3NK6 A;  4YQ8 A;  4YQ2 A;  1IPA A;  4YQR A;  4YQQ A;  4YQA A;  1VH0 A;  2Z0Y A;  3NK7 A;  3DCM X;  3KTY A;  2EGV A;  3AI9 X;  1UAJ A;  3KY7 A;  4PZK A;  4MCC A;  1UAL A;  4YQL A;  2HA8 A;  4YQS A;  5D9F A;  5GMB A;  4CNG A;  1VHK A;  4CNF A;  4CNE A;  4KDZ A;  1Z85 A;  4YVI A;  1ZJR A;  3QUV A;  4YQD A;  1UAM A;  1NS5 A;  4YQI A;  2YY8 A;  1J85 A;  1TO0 A;  4YVH A;  4YPW A;  3AXZ A;  1X7O A;  3O7B A;  3AIA A;  4CND A;  3N4K A; 
#chains in the Genus database with same CATH topology
 1K3R A;  4J3C A;  2OZ9 R;  5GMC A;  4YQ3 A;  2EGW A;  4JWJ A;  4X3L A;  4H3Z A;  4YQK A;  4L69 A;  4YQB A;  3SSX N;  3OIJ A;  4JAK A;  4YQN A;  4YQJ A;  4YQ7 A;  3GYQ A;  3KW2 A;  2I6D A;  4JAL A;  4XBO A;  1VHY A;  1WRP R;  3IEF A;  4MCB A;  4YQC A;  4MCD A;  4YQ5 A;  1X7P A;  4KGN A;  1TRR A;  3BBH A;  4YPX A;  1V2X A;  3ONP A;  4YQ0 A;  1WRS R;  4YPZ A;  4YQO A;  1NXZ A;  5FAI A;  1TRO A;  2V3J A;  2XDI A;  1V6Z A;  4YVG A;  4YQ4 A;  3WRP A;  4YQ6 A;  4FAK A;  4YPY A;  3BBE A;  3G1C A;  2QWV A;  2CX8 A;  4JWG A;  4YQ9 A;  3SSW N;  5CO4 A;  3IC6 A;  4H3Y A;  1MXI A;  4YQG A;  2O3A A;  3BBD A;  4X3M A;  4JWH A;  1CO0 A;  1P9P A;  4YVK A;  1MI7 R;  4E8B A;  1O6D A;  3OII A;  3L8U A;  3OIN A;  4YQ1 A;  4YQT A;  3E5Y A;  4YQP A;  4RG1 A;  5GM8 A;  1UAK A;  4YVJ A;  1OY5 A;  3FRW A;  1WRT R;  4IG6 A;  3ILK A;  3N4J A;  2V3K A;  3KNU A;  2QMM A;  1GZ0 A;  3NK6 A;  4YQ8 A;  4YQ2 A;  1IPA A;  1RCS A;  4YQR A;  4YQQ A;  4YQA A;  1VH0 A;  2Z0Y A;  3NK7 A;  3DCM X;  3KTY A;  2EGV A;  3KOR A;  1UAJ A;  3AI9 X;  3KY7 A;  4PZK A;  1JHG A;  4MCC A;  1UAL A;  4YQL A;  2HA8 A;  4YQS A;  5D9F A;  4JWF A;  5GMB A;  4CNG A;  1ZT9 A;  1VHK A;  4CNF A;  4CNE A;  4KDZ A;  1Z85 A;  4FMW A;  4YVI A;  1ZJR A;  3QUV A;  4YQD A;  1UAM A;  1NS5 A;  4YQI A;  2YY8 A;  1J85 A;  1TO0 A;  4YVH A;  4YPW A;  3AXZ A;  1X7O A;  3O7B A;  3AIA A;  4CND A;  3N4K A; 
#chains in the Genus database with same CATH homology
 1K3R A;  4J3C A;  5GMC A;  4YQ3 A;  2EGW A;  4JWJ A;  4X3L A;  4H3Z A;  4YQK A;  4L69 A;  4YQB A;  3OIJ A;  4JAK A;  4YQN A;  4YQJ A;  4YQ7 A;  3GYQ A;  3KW2 A;  2I6D A;  4JAL A;  4XBO A;  1VHY A;  3IEF A;  4MCB A;  4YQC A;  4MCD A;  4YQ5 A;  1X7P A;  4KGN A;  3BBH A;  4YPX A;  1V2X A;  3ONP A;  4YQ0 A;  4YPZ A;  4YQO A;  1NXZ A;  5FAI A;  2V3J A;  1V6Z A;  4YVG A;  4YQ4 A;  4FAK A;  4YQ6 A;  4YPY A;  3BBE A;  2QWV A;  2CX8 A;  4JWG A;  4YQ9 A;  5CO4 A;  3IC6 A;  4H3Y A;  1MXI A;  4YQG A;  2O3A A;  3BBD A;  4X3M A;  4JWH A;  1P9P A;  4YVK A;  4E8B A;  1O6D A;  3OII A;  3L8U A;  3OIN A;  4YQ1 A;  4YQT A;  3E5Y A;  4YQP A;  4RG1 A;  5GM8 A;  1UAK A;  4YVJ A;  1OY5 A;  4IG6 A;  3ILK A;  3N4J A;  2V3K A;  3KNU A;  2QMM A;  1GZ0 A;  3NK6 A;  4YQ8 A;  4YQ2 A;  1IPA A;  4YQR A;  4YQQ A;  4YQA A;  1VH0 A;  2Z0Y A;  3NK7 A;  3DCM X;  3KTY A;  2EGV A;  3AI9 X;  1UAJ A;  3KY7 A;  4PZK A;  4MCC A;  1UAL A;  4YQL A;  2HA8 A;  4YQS A;  5D9F A;  4JWF A;  5GMB A;  4CNG A;  1VHK A;  4CNF A;  4CNE A;  4KDZ A;  1Z85 A;  4FMW A;  4YVI A;  1ZJR A;  3QUV A;  4YQD A;  1UAM A;  1NS5 A;  4YQI A;  2YY8 A;  1J85 A;  1TO0 A;  4YVH A;  4YPW A;  3AXZ A;  1X7O A;  3O7B A;  3AIA A;  4CND A;  3N4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...