4YQAA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
237
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqaA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqaA01
4MCBA 3NK7A 4KDZA 4YQJA 3AIAA 1O6DA 4YQGA 3KTYA 5GMCA 4X3LA 4MCCA 2Z0YA 3ILKA 1P9PA 4YPXA 3QUVA 3KY7A 4YQ6A 4YQ1A 4YVKA 1X7PA 2EGWA 5GM8A 2O3AA 2YY8A 4JAKA 3IEFA 1VHKA 4YQCA 4CNGA 4YPZA 3AXZA 3O7BA 4YVJA 2I6DA 4YQSA 4YQNA 4L69A 4YVIA 3BBHA 3BBDA 3N4JA 4PZKA 4YQKA 4YQ5A 4YQ8A 1UAJA 1ZJRA 2EGVA 4CNEA 4YQQA 1GZ0A 2V3KA 1Z85A 4YQRA 4YQ2A 4YQ3A 4YQLA 1IPAA 3OIJA 5CO4A 3KW2A 4FAKA 2CX8A 1UALA 3NK6A 4KGNA 1NXZA 1OY5A 4YQTA 2HA8A 4X3MA 4YQPA 1K3RA 1NS5A 4YQIA 4CNDA 3ONPA 4YQAA 3DCMX 1TO0A 1J85A 4E8BA 4YVHA 2QWVA 4J3CA 4YVGA 4YQBA 3L8UA 3OIIA 4YPWA 4YQDA 4YPYA 1V2XA 3KNUA 3OINA 4YQ7A 1X7OA 1UAKA 4H3YA 3GYQA 4RG1A 5GMBA 5D9FA 2QMMA 3AI9X 1UAMA 4YQ4A 4XBOA 4YQ0A 4IG6A 3IC6A 4YQOA 5FAIA 4CNFA 3BBEA 3E5YA 4YQ9A 1VHYA 3N4KA 1VH0A 4MCDA 1V6ZA 4H3ZA 4JALA 1MXIA 2V3JA
chains in the Genus database with same CATH superfamily
4MCBA 3NK7A 4KDZA 4YQJA 3AIAA 1O6DA 2OZ9R 4JWGA 4YQGA 3KTYA 5GMCA 4X3LA 4JWHA 4MCCA 2Z0YA 3ILKA 1P9PA 4YPXA 3QUVA 3KY7A 4YQ6A 4YQ1A 4YVKA 1X7PA 2EGWA 5GM8A 2O3AA 2YY8A 4JAKA 4JWJA 3IEFA 1VHKA 4YQCA 4CNGA 4YPZA 3AXZA 3O7BA 4YVJA 3SSWN 2I6DA 4YQSA 2XDIA 4YQNA 4L69A 4YVIA 3BBHA 3BBDA 3N4JA 4PZKA 4YQKA 4YQ5A 4YQ8A 1UAJA 1WRTR 1ZJRA 2EGVA 4CNEA 4YQQA 1GZ0A 2V3KA 4YQRA 1Z85A 4YQ2A 4YQ3A 4YQLA 3WRPA 1TRRA 1IPAA 3OIJA 5CO4A 1WRSR 1MI7R 3KW2A 4FAKA 2CX8A 1UALA 3NK6A 4KGNA 1NXZA 1OY5A 4YQTA 2HA8A 4X3MA 4YQPA 1K3RA 1NS5A 4YQIA 4CNDA 3ONPA 4YQAA 3DCMX 1TO0A 1J85A 4E8BA 1TROA 4YVHA 2QWVA 4J3CA 4YVGA 3FRWA 4YQBA 3L8UA 3OIIA 4YPWA 4YQDA 4YPYA 1V2XA 3KNUA 3OINA 4YQ7A 1UAKA 4H3YA 1X7OA 3GYQA 4FMWA 4RG1A 5GMBA 1WRPR 5D9FA 1RCSA 2QMMA 3AI9X 1UAMA 4YQ4A 4XBOA 4YQ0A 1ZT9A 4IG6A 3IC6A 3KORA 4YQOA 5FAIA 4CNFA 3BBEA 3E5YA 4YQ9A 1VHYA 3G1CA 3N4KA 3SSXN 4JWFA 1VH0A 1CO0A 4MCDA 1JHGA 1V6ZA 4H3ZA 4JALA 1MXIA 2V3JA
chains in the Genus database with same CATH topology
4MCBA 3NK7A 4KDZA 4YQJA 3AIAA 1O6DA 4JWGA 4YQGA 3KTYA 5GMCA 4X3LA 4JWHA 4MCCA 2Z0YA 3ILKA 1P9PA 4YPXA 3QUVA 3KY7A 4YQ6A 4YQ1A 4YVKA 1X7PA 2EGWA 5GM8A 2O3AA 2YY8A 4JAKA 4JWJA 3IEFA 1VHKA 4YQCA 4CNGA 4YPZA 3AXZA 3O7BA 4YVJA 2I6DA 4YQSA 4YQNA 4L69A 4YVIA 3BBHA 3BBDA 3N4JA 4PZKA 4YQKA 4YQ5A 4YQ8A 1UAJA 1ZJRA 2EGVA 4CNEA 4YQQA 1GZ0A 2V3KA 1Z85A 4YQRA 4YQ2A 4YQ3A 4YQLA 1IPAA 3OIJA 5CO4A 3KW2A 4FAKA 2CX8A 1UALA 3NK6A 4KGNA 1NXZA 1OY5A 4YQTA 2HA8A 4X3MA 4YQPA 1K3RA 1NS5A 4YQIA 4CNDA 3ONPA 4YQAA 3DCMX 1TO0A 1J85A 4E8BA 4YVHA 2QWVA 4J3CA 4YVGA 4YQBA 3L8UA 3OIIA 4YPWA 4YQDA 4YPYA 1V2XA 3KNUA 3OINA 4YQ7A 1X7OA 1UAKA 4H3YA 3GYQA 4FMWA 4RG1A 5GMBA 5D9FA 2QMMA 3AI9X 1UAMA 4YQ4A 4XBOA 4YQ0A 4IG6A 3IC6A 4YQOA 5FAIA 4CNFA 3BBEA 3E5YA 4YQ9A 1VHYA 3N4KA 4JWFA 1VH0A 4MCDA 1V6ZA 4H3ZA 4JALA 1MXIA 2V3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCB A;  3NK7 A;  4KDZ A;  4YQJ A;  3AIA A;  1O6D A;  4YQG A;  3KTY A;  5GMC A;  4X3L A;  4MCC A;  2Z0Y A;  3ILK A;  1P9P A;  4YPX A;  3QUV A;  3KY7 A;  4YQ6 A;  4YQ1 A;  4YVK A;  1X7P A;  2EGW A;  5GM8 A;  2O3A A;  2YY8 A;  4JAK A;  3IEF A;  1VHK A;  4YQC A;  4CNG A;  4YPZ A;  3AXZ A;  3O7B A;  4YVJ A;  2I6D A;  4YQS A;  4YQN A;  4L69 A;  4YVI A;  3BBH A;  3BBD A;  3N4J A;  4PZK A;  4YQK A;  4YQ5 A;  4YQ8 A;  1UAJ A;  1ZJR A;  2EGV A;  4CNE A;  4YQQ A;  1GZ0 A;  2V3K A;  1Z85 A;  4YQR A;  4YQ2 A;  4YQ3 A;  4YQL A;  1IPA A;  3OIJ A;  5CO4 A;  3KW2 A;  4FAK A;  2CX8 A;  1UAL A;  3NK6 A;  4KGN A;  1NXZ A;  1OY5 A;  4YQT A;  2HA8 A;  4X3M A;  4YQP A;  1K3R A;  1NS5 A;  4YQI A;  4CND A;  3ONP A;  4YQA A;  3DCM X;  1TO0 A;  1J85 A;  4E8B A;  4YVH A;  2QWV A;  4J3C A;  4YVG A;  4YQB A;  3L8U A;  3OII A;  4YPW A;  4YQD A;  4YPY A;  1V2X A;  3KNU A;  3OIN A;  4YQ7 A;  1X7O A;  1UAK A;  4H3Y A;  3GYQ A;  4RG1 A;  5GMB A;  5D9F A;  2QMM A;  3AI9 X;  1UAM A;  4YQ4 A;  4XBO A;  4YQ0 A;  4IG6 A;  3IC6 A;  4YQO A;  5FAI A;  4CNF A;  3BBE A;  3E5Y A;  4YQ9 A;  1VHY A;  3N4K A;  1VH0 A;  4MCD A;  1V6Z A;  4H3Z A;  4JAL A;  1MXI A;  2V3J A; 
#chains in the Genus database with same CATH topology
 4MCB A;  3NK7 A;  4KDZ A;  4YQJ A;  3AIA A;  1O6D A;  2OZ9 R;  4JWG A;  4YQG A;  3KTY A;  5GMC A;  4X3L A;  4JWH A;  4MCC A;  2Z0Y A;  3ILK A;  1P9P A;  4YPX A;  3QUV A;  3KY7 A;  4YQ6 A;  4YQ1 A;  4YVK A;  1X7P A;  2EGW A;  5GM8 A;  2O3A A;  2YY8 A;  4JAK A;  4JWJ A;  3IEF A;  1VHK A;  4YQC A;  4CNG A;  4YPZ A;  3AXZ A;  3O7B A;  4YVJ A;  3SSW N;  2I6D A;  4YQS A;  2XDI A;  4YQN A;  4L69 A;  4YVI A;  3BBH A;  3BBD A;  3N4J A;  4PZK A;  4YQK A;  4YQ5 A;  4YQ8 A;  1UAJ A;  1WRT R;  1ZJR A;  2EGV A;  4CNE A;  4YQQ A;  1GZ0 A;  2V3K A;  4YQR A;  1Z85 A;  4YQ2 A;  4YQ3 A;  4YQL A;  3WRP A;  1TRR A;  1IPA A;  3OIJ A;  5CO4 A;  1WRS R;  1MI7 R;  3KW2 A;  4FAK A;  2CX8 A;  1UAL A;  3NK6 A;  4KGN A;  1NXZ A;  1OY5 A;  4YQT A;  2HA8 A;  4X3M A;  4YQP A;  1K3R A;  1NS5 A;  4YQI A;  4CND A;  3ONP A;  4YQA A;  3DCM X;  1TO0 A;  1J85 A;  4E8B A;  1TRO A;  4YVH A;  2QWV A;  4J3C A;  4YVG A;  3FRW A;  4YQB A;  3L8U A;  3OII A;  4YPW A;  4YQD A;  4YPY A;  1V2X A;  3KNU A;  3OIN A;  4YQ7 A;  1UAK A;  4H3Y A;  1X7O A;  3GYQ A;  4FMW A;  4RG1 A;  5GMB A;  1WRP R;  5D9F A;  1RCS A;  2QMM A;  3AI9 X;  1UAM A;  4YQ4 A;  4XBO A;  4YQ0 A;  1ZT9 A;  4IG6 A;  3IC6 A;  3KOR A;  4YQO A;  5FAI A;  4CNF A;  3BBE A;  3E5Y A;  4YQ9 A;  1VHY A;  3G1C A;  3N4K A;  3SSX N;  4JWF A;  1VH0 A;  1CO0 A;  4MCD A;  1JHG A;  1V6Z A;  4H3Z A;  4JAL A;  1MXI A;  2V3J A; 
#chains in the Genus database with same CATH homology
 4MCB A;  3NK7 A;  4KDZ A;  4YQJ A;  3AIA A;  1O6D A;  4JWG A;  4YQG A;  3KTY A;  5GMC A;  4X3L A;  4JWH A;  4MCC A;  2Z0Y A;  3ILK A;  1P9P A;  4YPX A;  3QUV A;  3KY7 A;  4YQ6 A;  4YQ1 A;  4YVK A;  1X7P A;  2EGW A;  5GM8 A;  2O3A A;  2YY8 A;  4JAK A;  4JWJ A;  3IEF A;  1VHK A;  4YQC A;  4CNG A;  4YPZ A;  3AXZ A;  3O7B A;  4YVJ A;  2I6D A;  4YQS A;  4YQN A;  4L69 A;  4YVI A;  3BBH A;  3BBD A;  3N4J A;  4PZK A;  4YQK A;  4YQ5 A;  4YQ8 A;  1UAJ A;  1ZJR A;  2EGV A;  4CNE A;  4YQQ A;  1GZ0 A;  2V3K A;  1Z85 A;  4YQR A;  4YQ2 A;  4YQ3 A;  4YQL A;  1IPA A;  3OIJ A;  5CO4 A;  3KW2 A;  4FAK A;  2CX8 A;  1UAL A;  3NK6 A;  4KGN A;  1NXZ A;  1OY5 A;  4YQT A;  2HA8 A;  4X3M A;  4YQP A;  1K3R A;  1NS5 A;  4YQI A;  4CND A;  3ONP A;  4YQA A;  3DCM X;  1TO0 A;  1J85 A;  4E8B A;  4YVH A;  2QWV A;  4J3C A;  4YVG A;  4YQB A;  3L8U A;  3OII A;  4YPW A;  4YQD A;  4YPY A;  1V2X A;  3KNU A;  3OIN A;  4YQ7 A;  1X7O A;  1UAK A;  4H3Y A;  3GYQ A;  4FMW A;  4RG1 A;  5GMB A;  5D9F A;  2QMM A;  3AI9 X;  1UAM A;  4YQ4 A;  4XBO A;  4YQ0 A;  4IG6 A;  3IC6 A;  4YQO A;  5FAI A;  4CNF A;  3BBE A;  3E5Y A;  4YQ9 A;  1VHY A;  3N4K A;  4JWF A;  1VH0 A;  4MCD A;  1V6Z A;  4H3Z A;  4JAL A;  1MXI A;  2V3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...