4YQAA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
237
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 72
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqaA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqaA01
3E5YA 1UAKA 4YQTA 1X7PA 4YVKA 4YQ8A 2EGVA 2CX8A 1UAJA 3OIIA 4CNGA 2V3KA 4E8BA 4X3MA 4MCDA 5GMCA 1Z85A 4YVJA 4H3ZA 3NK6A 1VH0A 4YPYA 4YQ1A 4YQQA 4YQJA 4YVIA 3BBDA 4YPZA 1MXIA 4IG6A 2EGWA 3KW2A 4YQ9A 1UAMA 4YQOA 4KGNA 3N4JA 3OIJA 4H3YA 3N4KA 3GYQA 1X7OA 1GZ0A 1J85A 2I6DA 4YQNA 3L8UA 3NK7A 4YPWA 2QWVA 4YQ4A 4YQIA 4YQ7A 4YVHA 1VHKA 5FAIA 4YQ2A 2O3AA 4YQPA 1V2XA 1ZJRA 4YQGA 1K3RA 4YQ3A 3KY7A 1NXZA 1UALA 3KNUA 4MCCA 4FAKA 2YY8A 3IC6A 4YQBA 3ONPA 4YQ6A 4YQLA 1IPAA 4YQCA 4JAKA 4YQSA 4YPXA 1P9PA 4YQAA 1V6ZA 3ILKA 3KTYA 4CNFA 4KDZA 5D9FA 1VHYA 4YQDA 3DCMX 4CNDA 2QMMA 5CO4A 3AI9X 4YVGA 2Z0YA 4YQRA 4RG1A 3AXZA 2HA8A 4MCBA 1NS5A 3BBHA 2V3JA 4X3LA 3AIAA 1TO0A 4PZKA 3QUVA 3OINA 4J3CA 4CNEA 5GM8A 5GMBA 4JALA 1O6DA 4YQ5A 4L69A 4YQKA 3IEFA 4XBOA 4YQ0A 3O7BA 3BBEA 1OY5A
chains in the Genus database with same CATH superfamily
3G1CA 3E5YA 1UAKA 4YQTA 3WRPA 3FRWA 1TRRA 1X7PA 1ZT9A 4YVKA 4YQ8A 2EGVA 2CX8A 1UAJA 3OIIA 1CO0A 2V3KA 4CNGA 4E8BA 4X3MA 4MCDA 5GMCA 1Z85A 1WRSR 4YVJA 4H3ZA 3NK6A 1VH0A 4YPYA 3SSWN 4YQ1A 4YQQA 4YQJA 4YVIA 3BBDA 4YPZA 1MXIA 2XDIA 3KORA 4IG6A 2EGWA 3KW2A 4YQ9A 1UAMA 4YQOA 4KGNA 3N4JA 3OIJA 4H3YA 3N4KA 3GYQA 1X7OA 4JWHA 1GZ0A 1J85A 2I6DA 4YQNA 3L8UA 3NK7A 4YPWA 2QWVA 4YQ4A 4YQIA 1WRTR 4YQ7A 4YVHA 1VHKA 5FAIA 4YQ2A 2O3AA 4YQPA 1V2XA 1ZJRA 4YQGA 1K3RA 4YQ3A 3KY7A 1UALA 1NXZA 3KNUA 4MCCA 4FAKA 2YY8A 3IC6A 4YQBA 1WRPR 3ONPA 4YQ6A 4YQLA 1IPAA 1TROA 1MI7R 4YQCA 4JAKA 4YQSA 4YPXA 1P9PA 4YQAA 1V6ZA 3ILKA 3KTYA 4FMWA 4CNFA 4KDZA 5D9FA 1VHYA 2OZ9R 1JHGA 4YQDA 3DCMX 4CNDA 1RCSA 2QMMA 4JWFA 5CO4A 3AI9X 4YVGA 2Z0YA 4YQRA 4RG1A 3AXZA 2HA8A 4MCBA 1NS5A 3BBHA 2V3JA 4JWGA 3AIAA 4X3LA 1TO0A 4PZKA 3SSXN 3QUVA 3OINA 4J3CA 4CNEA 5GM8A 5GMBA 4JALA 4JWJA 1O6DA 4YQ5A 4L69A 4YQKA 3IEFA 4XBOA 4YQ0A 3O7BA 3BBEA 1OY5A
chains in the Genus database with same CATH topology
3E5YA 1UAKA 4YQTA 1X7PA 4YVKA 4YQ8A 2EGVA 2CX8A 1UAJA 3OIIA 4CNGA 2V3KA 4E8BA 4X3MA 4MCDA 5GMCA 1Z85A 4YVJA 4H3ZA 3NK6A 1VH0A 4YPYA 4YQ1A 4YQQA 4YQJA 4YVIA 3BBDA 4YPZA 1MXIA 4IG6A 2EGWA 3KW2A 4YQ9A 1UAMA 4YQOA 4KGNA 3N4JA 3OIJA 4H3YA 3N4KA 3GYQA 1X7OA 4JWHA 1GZ0A 1J85A 2I6DA 4YQNA 3L8UA 3NK7A 4YPWA 2QWVA 4YQ4A 4YQIA 4YQ7A 4YVHA 1VHKA 5FAIA 4YQ2A 2O3AA 4YQPA 1V2XA 1ZJRA 4YQGA 1K3RA 4YQ3A 3KY7A 1NXZA 1UALA 3KNUA 4MCCA 4FAKA 2YY8A 3IC6A 4YQBA 3ONPA 4YQ6A 4YQLA 1IPAA 4YQCA 4JAKA 4YQSA 4YPXA 1P9PA 4YQAA 1V6ZA 3ILKA 3KTYA 4FMWA 4CNFA 4KDZA 5D9FA 1VHYA 4YQDA 3DCMX 4CNDA 2QMMA 4JWFA 5CO4A 3AI9X 4YVGA 2Z0YA 4YQRA 4RG1A 3AXZA 2HA8A 4MCBA 1NS5A 3BBHA 2V3JA 4JWGA 3AIAA 4X3LA 1TO0A 4PZKA 3QUVA 3OINA 4J3CA 4CNEA 5GM8A 5GMBA 4JALA 4JWJA 1O6DA 4YQ5A 4L69A 4YQKA 3IEFA 4XBOA 4YQ0A 3O7BA 3BBEA 1OY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5Y A;  1UAK A;  4YQT A;  1X7P A;  4YVK A;  4YQ8 A;  2EGV A;  2CX8 A;  1UAJ A;  3OII A;  4CNG A;  2V3K A;  4E8B A;  4X3M A;  4MCD A;  5GMC A;  1Z85 A;  4YVJ A;  4H3Z A;  3NK6 A;  1VH0 A;  4YPY A;  4YQ1 A;  4YQQ A;  4YQJ A;  4YVI A;  3BBD A;  4YPZ A;  1MXI A;  4IG6 A;  2EGW A;  3KW2 A;  4YQ9 A;  1UAM A;  4YQO A;  4KGN A;  3N4J A;  3OIJ A;  4H3Y A;  3N4K A;  3GYQ A;  1X7O A;  1GZ0 A;  1J85 A;  2I6D A;  4YQN A;  3L8U A;  3NK7 A;  4YPW A;  2QWV A;  4YQ4 A;  4YQI A;  4YQ7 A;  4YVH A;  1VHK A;  5FAI A;  4YQ2 A;  2O3A A;  4YQP A;  1V2X A;  1ZJR A;  4YQG A;  1K3R A;  4YQ3 A;  3KY7 A;  1NXZ A;  1UAL A;  3KNU A;  4MCC A;  4FAK A;  2YY8 A;  3IC6 A;  4YQB A;  3ONP A;  4YQ6 A;  4YQL A;  1IPA A;  4YQC A;  4JAK A;  4YQS A;  4YPX A;  1P9P A;  4YQA A;  1V6Z A;  3ILK A;  3KTY A;  4CNF A;  4KDZ A;  5D9F A;  1VHY A;  4YQD A;  3DCM X;  4CND A;  2QMM A;  5CO4 A;  3AI9 X;  4YVG A;  2Z0Y A;  4YQR A;  4RG1 A;  3AXZ A;  2HA8 A;  4MCB A;  1NS5 A;  3BBH A;  2V3J A;  4X3L A;  3AIA A;  1TO0 A;  4PZK A;  3QUV A;  3OIN A;  4J3C A;  4CNE A;  5GM8 A;  5GMB A;  4JAL A;  1O6D A;  4YQ5 A;  4L69 A;  4YQK A;  3IEF A;  4XBO A;  4YQ0 A;  3O7B A;  3BBE A;  1OY5 A; 
#chains in the Genus database with same CATH topology
 3G1C A;  3E5Y A;  1UAK A;  4YQT A;  3WRP A;  3FRW A;  1TRR A;  1X7P A;  1ZT9 A;  4YVK A;  4YQ8 A;  2EGV A;  2CX8 A;  1UAJ A;  3OII A;  1CO0 A;  2V3K A;  4CNG A;  4E8B A;  4X3M A;  4MCD A;  5GMC A;  1Z85 A;  1WRS R;  4YVJ A;  4H3Z A;  3NK6 A;  1VH0 A;  4YPY A;  3SSW N;  4YQ1 A;  4YQQ A;  4YQJ A;  4YVI A;  3BBD A;  4YPZ A;  1MXI A;  2XDI A;  3KOR A;  4IG6 A;  2EGW A;  3KW2 A;  4YQ9 A;  1UAM A;  4YQO A;  4KGN A;  3N4J A;  3OIJ A;  4H3Y A;  3N4K A;  3GYQ A;  1X7O A;  4JWH A;  1GZ0 A;  1J85 A;  2I6D A;  4YQN A;  3L8U A;  3NK7 A;  4YPW A;  2QWV A;  4YQ4 A;  4YQI A;  1WRT R;  4YQ7 A;  4YVH A;  1VHK A;  5FAI A;  4YQ2 A;  2O3A A;  4YQP A;  1V2X A;  1ZJR A;  4YQG A;  1K3R A;  4YQ3 A;  3KY7 A;  1UAL A;  1NXZ A;  3KNU A;  4MCC A;  4FAK A;  2YY8 A;  3IC6 A;  4YQB A;  1WRP R;  3ONP A;  4YQ6 A;  4YQL A;  1IPA A;  1TRO A;  1MI7 R;  4YQC A;  4JAK A;  4YQS A;  4YPX A;  1P9P A;  4YQA A;  1V6Z A;  3ILK A;  3KTY A;  4FMW A;  4CNF A;  4KDZ A;  5D9F A;  1VHY A;  2OZ9 R;  1JHG A;  4YQD A;  3DCM X;  4CND A;  1RCS A;  2QMM A;  4JWF A;  5CO4 A;  3AI9 X;  4YVG A;  2Z0Y A;  4YQR A;  4RG1 A;  3AXZ A;  2HA8 A;  4MCB A;  1NS5 A;  3BBH A;  2V3J A;  4JWG A;  3AIA A;  4X3L A;  1TO0 A;  4PZK A;  3SSX N;  3QUV A;  3OIN A;  4J3C A;  4CNE A;  5GM8 A;  5GMB A;  4JAL A;  4JWJ A;  1O6D A;  4YQ5 A;  4L69 A;  4YQK A;  3IEF A;  4XBO A;  4YQ0 A;  3O7B A;  3BBE A;  1OY5 A; 
#chains in the Genus database with same CATH homology
 3E5Y A;  1UAK A;  4YQT A;  1X7P A;  4YVK A;  4YQ8 A;  2EGV A;  2CX8 A;  1UAJ A;  3OII A;  4CNG A;  2V3K A;  4E8B A;  4X3M A;  4MCD A;  5GMC A;  1Z85 A;  4YVJ A;  4H3Z A;  3NK6 A;  1VH0 A;  4YPY A;  4YQ1 A;  4YQQ A;  4YQJ A;  4YVI A;  3BBD A;  4YPZ A;  1MXI A;  4IG6 A;  2EGW A;  3KW2 A;  4YQ9 A;  1UAM A;  4YQO A;  4KGN A;  3N4J A;  3OIJ A;  4H3Y A;  3N4K A;  3GYQ A;  1X7O A;  4JWH A;  1GZ0 A;  1J85 A;  2I6D A;  4YQN A;  3L8U A;  3NK7 A;  4YPW A;  2QWV A;  4YQ4 A;  4YQI A;  4YQ7 A;  4YVH A;  1VHK A;  5FAI A;  4YQ2 A;  2O3A A;  4YQP A;  1V2X A;  1ZJR A;  4YQG A;  1K3R A;  4YQ3 A;  3KY7 A;  1NXZ A;  1UAL A;  3KNU A;  4MCC A;  4FAK A;  2YY8 A;  3IC6 A;  4YQB A;  3ONP A;  4YQ6 A;  4YQL A;  1IPA A;  4YQC A;  4JAK A;  4YQS A;  4YPX A;  1P9P A;  4YQA A;  1V6Z A;  3ILK A;  3KTY A;  4FMW A;  4CNF A;  4KDZ A;  5D9F A;  1VHY A;  4YQD A;  3DCM X;  4CND A;  2QMM A;  4JWF A;  5CO4 A;  3AI9 X;  4YVG A;  2Z0Y A;  4YQR A;  4RG1 A;  3AXZ A;  2HA8 A;  4MCB A;  1NS5 A;  3BBH A;  2V3J A;  4JWG A;  3AIA A;  4X3L A;  1TO0 A;  4PZK A;  3QUV A;  3OIN A;  4J3C A;  4CNE A;  5GM8 A;  5GMB A;  4JAL A;  4JWJ A;  1O6D A;  4YQ5 A;  4L69 A;  4YQK A;  3IEF A;  4XBO A;  4YQ0 A;  3O7B A;  3BBE A;  1OY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...