4YQAA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
237
Chain Sequence
b'SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqaA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqaA01
4RG1A 5GM8A 4YQIA 4J3CA 2QWVA 1IPAA 3O7BA 3IEFA 3OINA 4YQOA 4YPZA 1P9PA 4YQ2A 1J85A 1V2XA 1VHYA 1NXZA 2HA8A 4MCBA 4JAKA 4L69A 3AIAA 4YVGA 3DCMX 4XBOA 3N4KA 3L8UA 4CNEA 4FAKA 1V6ZA 3AXZA 4YQSA 4YQ8A 3KW2A 4YVKA 4H3ZA 4CNDA 1VHKA 4KGNA 1GZ0A 1O6DA 2I6DA 1UALA 4YVIA 3ONPA 3E5YA 3AI9X 3QUVA 4YVHA 3NK7A 5FAIA 4YQKA 1X7PA 4PZKA 4YPXA 1OY5A 4YQ1A 2CX8A 4YQDA 4YQLA 3ILKA 4YQ7A 3OIIA 4MCCA 1TO0A 1UAJA 4YQQA 4YQRA 4IG6A 4YQ4A 1Z85A 1UAMA 4MCDA 3NK6A 4YQTA 4YQ3A 3BBDA 3GYQA 4YQ0A 3KNUA 1VH0A 2YY8A 4YPWA 2V3JA 5D9FA 4YQ9A 3BBEA 1UAKA 4CNFA 4YQCA 5GMBA 5CO4A 4YQBA 3BBHA 2Z0YA 3KTYA 2EGWA 4YQPA 3N4JA 1ZJRA 4YQ6A 4YVJA 4JALA 4X3MA 4YQGA 3IC6A 4KDZA 4E8BA 2EGVA 2V3KA 4CNGA 4YQ5A 4YPYA 3KY7A 5GMCA 1K3RA 1X7OA 4YQNA 4YQAA 4H3YA 1MXIA 4YQJA 2QMMA 2O3AA 4X3LA 3OIJA 1NS5A
chains in the Genus database with same CATH superfamily
4RG1A 5GM8A 4YQIA 4J3CA 2QWVA 1IPAA 3O7BA 3IEFA 3OINA 4YQOA 4YPZA 1P9PA 4YQ2A 1J85A 3G1CA 1RCSA 1V2XA 1VHYA 3WRPA 1NXZA 2HA8A 4MCBA 4JAKA 4L69A 3AIAA 4YVGA 3DCMX 2OZ9R 4XBOA 1MI7R 3N4KA 1TRRA 3L8UA 4CNEA 4FAKA 1CO0A 1V6ZA 3AXZA 4YQSA 4YQ8A 3KW2A 4YVKA 4H3ZA 4CNDA 1VHKA 4KGNA 1GZ0A 1ZT9A 1O6DA 2I6DA 1UALA 1JHGA 4YVIA 3ONPA 1TROA 3E5YA 3AI9X 3QUVA 4YVHA 3NK7A 5FAIA 4YQKA 1X7PA 4PZKA 4YPXA 1OY5A 4YQ1A 2CX8A 4YQDA 4YQLA 1WRTR 3ILKA 4YQ7A 3OIIA 3KORA 4MCCA 1TO0A 1UAJA 4YQQA 4YQRA 4IG6A 4YQ4A 3SSXN 1Z85A 1UAMA 4MCDA 3NK6A 4YQTA 4YQ3A 3BBDA 3GYQA 3FRWA 4YQ0A 3KNUA 1VH0A 4JWJA 2YY8A 4YPWA 2V3JA 3SSWN 5D9FA 4YQ9A 1WRPR 3BBEA 1UAKA 4CNFA 4YQCA 5GMBA 5CO4A 4YQBA 3BBHA 2Z0YA 3KTYA 2EGWA 4YQPA 3N4JA 1ZJRA 4YQ6A 4YVJA 4JWHA 4JALA 4X3MA 4YQGA 3IC6A 4KDZA 2XDIA 1WRSR 4E8BA 2EGVA 2V3KA 4CNGA 4YQ5A 4YPYA 3KY7A 4JWGA 5GMCA 1K3RA 4FMWA 1X7OA 4YQNA 4YQAA 4H3YA 1MXIA 4JWFA 4YQJA 2QMMA 2O3AA 4X3LA 3OIJA 1NS5A
chains in the Genus database with same CATH topology
4RG1A 5GM8A 4YQIA 4J3CA 2QWVA 1IPAA 3O7BA 3IEFA 3OINA 4YQOA 4YPZA 1P9PA 4YQ2A 1J85A 1V2XA 1VHYA 1NXZA 2HA8A 4MCBA 4JAKA 4L69A 3AIAA 4YVGA 3DCMX 4XBOA 3N4KA 3L8UA 4CNEA 4FAKA 1V6ZA 3AXZA 4YQSA 4YQ8A 3KW2A 4YVKA 4H3ZA 4CNDA 1VHKA 4KGNA 1GZ0A 1O6DA 2I6DA 1UALA 4YVIA 3ONPA 3E5YA 3AI9X 3QUVA 4YVHA 3NK7A 5FAIA 4YQKA 1X7PA 4PZKA 4YPXA 1OY5A 4YQ1A 2CX8A 4YQDA 4YQLA 3ILKA 4YQ7A 3OIIA 4MCCA 1TO0A 1UAJA 4YQQA 4YQRA 4IG6A 4YQ4A 1Z85A 1UAMA 4MCDA 3NK6A 4YQTA 4YQ3A 3BBDA 3GYQA 4YQ0A 3KNUA 1VH0A 4JWJA 2YY8A 4YPWA 2V3JA 5D9FA 4YQ9A 3BBEA 1UAKA 4CNFA 4YQCA 5GMBA 5CO4A 4YQBA 3BBHA 2Z0YA 3KTYA 2EGWA 4YQPA 3N4JA 1ZJRA 4YQ6A 4YVJA 4JWHA 4JALA 4X3MA 4YQGA 3IC6A 4KDZA 4E8BA 2EGVA 2V3KA 4CNGA 4YQ5A 4YPYA 3KY7A 4JWGA 5GMCA 1K3RA 4FMWA 1X7OA 4YQNA 4YQAA 4H3YA 1MXIA 4JWFA 4YQJA 2QMMA 2O3AA 4X3LA 3OIJA 1NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG1 A;  5GM8 A;  4YQI A;  4J3C A;  2QWV A;  1IPA A;  3O7B A;  3IEF A;  3OIN A;  4YQO A;  4YPZ A;  1P9P A;  4YQ2 A;  1J85 A;  1V2X A;  1VHY A;  1NXZ A;  2HA8 A;  4MCB A;  4JAK A;  4L69 A;  3AIA A;  4YVG A;  3DCM X;  4XBO A;  3N4K A;  3L8U A;  4CNE A;  4FAK A;  1V6Z A;  3AXZ A;  4YQS A;  4YQ8 A;  3KW2 A;  4YVK A;  4H3Z A;  4CND A;  1VHK A;  4KGN A;  1GZ0 A;  1O6D A;  2I6D A;  1UAL A;  4YVI A;  3ONP A;  3E5Y A;  3AI9 X;  3QUV A;  4YVH A;  3NK7 A;  5FAI A;  4YQK A;  1X7P A;  4PZK A;  4YPX A;  1OY5 A;  4YQ1 A;  2CX8 A;  4YQD A;  4YQL A;  3ILK A;  4YQ7 A;  3OII A;  4MCC A;  1TO0 A;  1UAJ A;  4YQQ A;  4YQR A;  4IG6 A;  4YQ4 A;  1Z85 A;  1UAM A;  4MCD A;  3NK6 A;  4YQT A;  4YQ3 A;  3BBD A;  3GYQ A;  4YQ0 A;  3KNU A;  1VH0 A;  2YY8 A;  4YPW A;  2V3J A;  5D9F A;  4YQ9 A;  3BBE A;  1UAK A;  4CNF A;  4YQC A;  5GMB A;  5CO4 A;  4YQB A;  3BBH A;  2Z0Y A;  3KTY A;  2EGW A;  4YQP A;  3N4J A;  1ZJR A;  4YQ6 A;  4YVJ A;  4JAL A;  4X3M A;  4YQG A;  3IC6 A;  4KDZ A;  4E8B A;  2EGV A;  2V3K A;  4CNG A;  4YQ5 A;  4YPY A;  3KY7 A;  5GMC A;  1K3R A;  1X7O A;  4YQN A;  4YQA A;  4H3Y A;  1MXI A;  4YQJ A;  2QMM A;  2O3A A;  4X3L A;  3OIJ A;  1NS5 A; 
#chains in the Genus database with same CATH topology
 4RG1 A;  5GM8 A;  4YQI A;  4J3C A;  2QWV A;  1IPA A;  3O7B A;  3IEF A;  3OIN A;  4YQO A;  4YPZ A;  1P9P A;  4YQ2 A;  1J85 A;  3G1C A;  1RCS A;  1V2X A;  1VHY A;  3WRP A;  1NXZ A;  2HA8 A;  4MCB A;  4JAK A;  4L69 A;  3AIA A;  4YVG A;  3DCM X;  2OZ9 R;  4XBO A;  1MI7 R;  3N4K A;  1TRR A;  3L8U A;  4CNE A;  4FAK A;  1CO0 A;  1V6Z A;  3AXZ A;  4YQS A;  4YQ8 A;  3KW2 A;  4YVK A;  4H3Z A;  4CND A;  1VHK A;  4KGN A;  1GZ0 A;  1ZT9 A;  1O6D A;  2I6D A;  1UAL A;  1JHG A;  4YVI A;  3ONP A;  1TRO A;  3E5Y A;  3AI9 X;  3QUV A;  4YVH A;  3NK7 A;  5FAI A;  4YQK A;  1X7P A;  4PZK A;  4YPX A;  1OY5 A;  4YQ1 A;  2CX8 A;  4YQD A;  4YQL A;  1WRT R;  3ILK A;  4YQ7 A;  3OII A;  3KOR A;  4MCC A;  1TO0 A;  1UAJ A;  4YQQ A;  4YQR A;  4IG6 A;  4YQ4 A;  3SSX N;  1Z85 A;  1UAM A;  4MCD A;  3NK6 A;  4YQT A;  4YQ3 A;  3BBD A;  3GYQ A;  3FRW A;  4YQ0 A;  3KNU A;  1VH0 A;  4JWJ A;  2YY8 A;  4YPW A;  2V3J A;  3SSW N;  5D9F A;  4YQ9 A;  1WRP R;  3BBE A;  1UAK A;  4CNF A;  4YQC A;  5GMB A;  5CO4 A;  4YQB A;  3BBH A;  2Z0Y A;  3KTY A;  2EGW A;  4YQP A;  3N4J A;  1ZJR A;  4YQ6 A;  4YVJ A;  4JWH A;  4JAL A;  4X3M A;  4YQG A;  3IC6 A;  4KDZ A;  2XDI A;  1WRS R;  4E8B A;  2EGV A;  2V3K A;  4CNG A;  4YQ5 A;  4YPY A;  3KY7 A;  4JWG A;  5GMC A;  1K3R A;  4FMW A;  1X7O A;  4YQN A;  4YQA A;  4H3Y A;  1MXI A;  4JWF A;  4YQJ A;  2QMM A;  2O3A A;  4X3L A;  3OIJ A;  1NS5 A; 
#chains in the Genus database with same CATH homology
 4RG1 A;  5GM8 A;  4YQI A;  4J3C A;  2QWV A;  1IPA A;  3O7B A;  3IEF A;  3OIN A;  4YQO A;  4YPZ A;  1P9P A;  4YQ2 A;  1J85 A;  1V2X A;  1VHY A;  1NXZ A;  2HA8 A;  4MCB A;  4JAK A;  4L69 A;  3AIA A;  4YVG A;  3DCM X;  4XBO A;  3N4K A;  3L8U A;  4CNE A;  4FAK A;  1V6Z A;  3AXZ A;  4YQS A;  4YQ8 A;  3KW2 A;  4YVK A;  4H3Z A;  4CND A;  1VHK A;  4KGN A;  1GZ0 A;  1O6D A;  2I6D A;  1UAL A;  4YVI A;  3ONP A;  3E5Y A;  3AI9 X;  3QUV A;  4YVH A;  3NK7 A;  5FAI A;  4YQK A;  1X7P A;  4PZK A;  4YPX A;  1OY5 A;  4YQ1 A;  2CX8 A;  4YQD A;  4YQL A;  3ILK A;  4YQ7 A;  3OII A;  4MCC A;  1TO0 A;  1UAJ A;  4YQQ A;  4YQR A;  4IG6 A;  4YQ4 A;  1Z85 A;  1UAM A;  4MCD A;  3NK6 A;  4YQT A;  4YQ3 A;  3BBD A;  3GYQ A;  4YQ0 A;  3KNU A;  1VH0 A;  4JWJ A;  2YY8 A;  4YPW A;  2V3J A;  5D9F A;  4YQ9 A;  3BBE A;  1UAK A;  4CNF A;  4YQC A;  5GMB A;  5CO4 A;  4YQB A;  3BBH A;  2Z0Y A;  3KTY A;  2EGW A;  4YQP A;  3N4J A;  1ZJR A;  4YQ6 A;  4YVJ A;  4JWH A;  4JAL A;  4X3M A;  4YQG A;  3IC6 A;  4KDZ A;  4E8B A;  2EGV A;  2V3K A;  4CNG A;  4YQ5 A;  4YPY A;  3KY7 A;  4JWG A;  5GMC A;  1K3R A;  4FMW A;  1X7O A;  4YQN A;  4YQA A;  4H3Y A;  1MXI A;  4JWF A;  4YQJ A;  2QMM A;  2O3A A;  4X3L A;  3OIJ A;  1NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...