4YQJA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
237
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 72
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqjA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqjA01
2EGVA 4X3MA 4YQRA 1V2XA 3BBEA 2V3JA 4YVHA 3QUVA 4YQ4A 1J85A 4RG1A 1UAJA 5FAIA 2O3AA 4YQ2A 4KGNA 3BBDA 4YVGA 2Z0YA 1OY5A 3E5YA 4XBOA 2CX8A 5D9FA 1K3RA 1P9PA 1GZ0A 4CNFA 1IPAA 2EGWA 3IEFA 4YQ1A 1UAMA 4YQ0A 3IC6A 4YVJA 4KDZA 3KY7A 4YQBA 3NK7A 4YQ7A 4YQNA 4E8BA 3AXZA 2HA8A 4MCDA 1V6ZA 1ZJRA 4X3LA 1UAKA 4YVKA 3AIAA 1VHKA 3OIJA 4H3YA 3KW2A 3KNUA 1NS5A 1O6DA 2YY8A 1VH0A 3AI9X 3BBHA 4YPYA 3OINA 4YPWA 4YQ5A 3L8UA 3NK6A 4YVIA 4J3CA 2QMMA 4YQ6A 4YQIA 5CO4A 4YQTA 5GMCA 3DCMX 4YQJA 4YQ9A 4IG6A 4PZKA 1Z85A 1VHYA 3N4KA 4YQCA 2I6DA 4YQGA 3ILKA 2V3KA 4YQOA 4YQAA 4YQKA 1NXZA 3KTYA 3ONPA 4JAKA 4YQPA 4CNEA 1X7PA 1X7OA 5GMBA 4YQQA 4YPXA 2QWVA 1UALA 4YQ8A 4YQSA 1TO0A 4CNDA 4MCBA 4YQLA 4YQDA 4CNGA 1MXIA 3GYQA 4YQ3A 4MCCA 4H3ZA 4YPZA 4JALA 5GM8A 4L69A 3O7BA 4FAKA 3N4JA 3OIIA
chains in the Genus database with same CATH superfamily
2EGVA 4X3MA 4YQRA 1V2XA 3BBEA 2V3JA 4YVHA 3QUVA 4YQ4A 1J85A 4RG1A 1UAJA 5FAIA 4JWGA 2O3AA 4YQ2A 4KGNA 3BBDA 3KORA 4YVGA 2Z0YA 1OY5A 3E5YA 4XBOA 2CX8A 5D9FA 1K3RA 3G1CA 1P9PA 1GZ0A 4CNFA 1IPAA 2EGWA 3IEFA 4YQ1A 1UAMA 4YQ0A 3IC6A 4YVJA 1WRTR 4FMWA 4KDZA 3KY7A 4YQBA 3NK7A 4YQ7A 4YQNA 4E8BA 3AXZA 2HA8A 4MCDA 1V6ZA 1ZJRA 4X3LA 1UAKA 4YVKA 3AIAA 1VHKA 3OIJA 4H3YA 3FRWA 3KW2A 3KNUA 1RCSA 1MI7R 1NS5A 1CO0A 1O6DA 2YY8A 1VH0A 3AI9X 3BBHA 4YPYA 3OINA 3SSXN 4YPWA 4YQ5A 3L8UA 3NK6A 1WRSR 4YVIA 4J3CA 1ZT9A 2QMMA 4YQ6A 4YQIA 5CO4A 4YQTA 5GMCA 4JWHA 3DCMX 4YQJA 1TRRA 4YQ9A 4IG6A 4PZKA 1JHGA 1Z85A 1VHYA 3N4KA 2XDIA 4YQCA 4YQGA 2I6DA 3ILKA 1WRPR 2V3KA 4YQOA 4YQAA 4YQKA 4JWJA 1NXZA 3KTYA 3ONPA 4JAKA 4YQPA 4CNEA 1X7PA 3WRPA 1X7OA 5GMBA 4YQQA 4YPXA 2QWVA 1UALA 4YQ8A 4YQSA 1TO0A 4CNDA 4MCBA 1TROA 2OZ9R 4YQLA 4YQDA 4CNGA 1MXIA 3GYQA 4YQ3A 4MCCA 4H3ZA 4YPZA 4JALA 5GM8A 4L69A 3SSWN 3O7BA 4FAKA 3N4JA 4JWFA 3OIIA
chains in the Genus database with same CATH topology
2EGVA 4X3MA 4YQRA 1V2XA 3BBEA 2V3JA 4YVHA 3QUVA 4YQ4A 1J85A 4RG1A 1UAJA 5FAIA 4JWGA 2O3AA 4YQ2A 4KGNA 3BBDA 4YVGA 2Z0YA 1OY5A 3E5YA 4XBOA 2CX8A 5D9FA 1K3RA 1P9PA 1GZ0A 4CNFA 1IPAA 2EGWA 3IEFA 4YQ1A 1UAMA 4YQ0A 3IC6A 4YVJA 4FMWA 4KDZA 3KY7A 4YQBA 3NK7A 4YQ7A 4YQNA 4E8BA 3AXZA 2HA8A 4MCDA 1V6ZA 1ZJRA 4X3LA 1UAKA 4YVKA 3AIAA 1VHKA 3OIJA 4H3YA 3KW2A 3KNUA 1NS5A 1O6DA 2YY8A 1VH0A 3AI9X 3BBHA 4YPYA 3OINA 4YPWA 4YQ5A 3L8UA 3NK6A 4YVIA 4J3CA 2QMMA 4YQ6A 4YQIA 5CO4A 4YQTA 5GMCA 4JWHA 3DCMX 4YQJA 4YQ9A 4IG6A 4PZKA 1Z85A 1VHYA 3N4KA 4YQCA 2I6DA 4YQGA 3ILKA 2V3KA 4YQOA 4YQAA 4YQKA 4JWJA 1NXZA 3KTYA 3ONPA 4JAKA 4YQPA 4CNEA 1X7PA 1X7OA 5GMBA 4YQQA 4YPXA 2QWVA 1UALA 4YQ8A 4YQSA 1TO0A 4CNDA 4MCBA 4YQLA 4YQDA 4CNGA 1MXIA 3GYQA 4YQ3A 4MCCA 4H3ZA 4YPZA 4JALA 5GM8A 4L69A 3O7BA 4FAKA 3N4JA 4JWFA 3OIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGV A;  4X3M A;  4YQR A;  1V2X A;  3BBE A;  2V3J A;  4YVH A;  3QUV A;  4YQ4 A;  1J85 A;  4RG1 A;  1UAJ A;  5FAI A;  2O3A A;  4YQ2 A;  4KGN A;  3BBD A;  4YVG A;  2Z0Y A;  1OY5 A;  3E5Y A;  4XBO A;  2CX8 A;  5D9F A;  1K3R A;  1P9P A;  1GZ0 A;  4CNF A;  1IPA A;  2EGW A;  3IEF A;  4YQ1 A;  1UAM A;  4YQ0 A;  3IC6 A;  4YVJ A;  4KDZ A;  3KY7 A;  4YQB A;  3NK7 A;  4YQ7 A;  4YQN A;  4E8B A;  3AXZ A;  2HA8 A;  4MCD A;  1V6Z A;  1ZJR A;  4X3L A;  1UAK A;  4YVK A;  3AIA A;  1VHK A;  3OIJ A;  4H3Y A;  3KW2 A;  3KNU A;  1NS5 A;  1O6D A;  2YY8 A;  1VH0 A;  3AI9 X;  3BBH A;  4YPY A;  3OIN A;  4YPW A;  4YQ5 A;  3L8U A;  3NK6 A;  4YVI A;  4J3C A;  2QMM A;  4YQ6 A;  4YQI A;  5CO4 A;  4YQT A;  5GMC A;  3DCM X;  4YQJ A;  4YQ9 A;  4IG6 A;  4PZK A;  1Z85 A;  1VHY A;  3N4K A;  4YQC A;  2I6D A;  4YQG A;  3ILK A;  2V3K A;  4YQO A;  4YQA A;  4YQK A;  1NXZ A;  3KTY A;  3ONP A;  4JAK A;  4YQP A;  4CNE A;  1X7P A;  1X7O A;  5GMB A;  4YQQ A;  4YPX A;  2QWV A;  1UAL A;  4YQ8 A;  4YQS A;  1TO0 A;  4CND A;  4MCB A;  4YQL A;  4YQD A;  4CNG A;  1MXI A;  3GYQ A;  4YQ3 A;  4MCC A;  4H3Z A;  4YPZ A;  4JAL A;  5GM8 A;  4L69 A;  3O7B A;  4FAK A;  3N4J A;  3OII A; 
#chains in the Genus database with same CATH topology
 2EGV A;  4X3M A;  4YQR A;  1V2X A;  3BBE A;  2V3J A;  4YVH A;  3QUV A;  4YQ4 A;  1J85 A;  4RG1 A;  1UAJ A;  5FAI A;  4JWG A;  2O3A A;  4YQ2 A;  4KGN A;  3BBD A;  3KOR A;  4YVG A;  2Z0Y A;  1OY5 A;  3E5Y A;  4XBO A;  2CX8 A;  5D9F A;  1K3R A;  3G1C A;  1P9P A;  1GZ0 A;  4CNF A;  1IPA A;  2EGW A;  3IEF A;  4YQ1 A;  1UAM A;  4YQ0 A;  3IC6 A;  4YVJ A;  1WRT R;  4FMW A;  4KDZ A;  3KY7 A;  4YQB A;  3NK7 A;  4YQ7 A;  4YQN A;  4E8B A;  3AXZ A;  2HA8 A;  4MCD A;  1V6Z A;  1ZJR A;  4X3L A;  1UAK A;  4YVK A;  3AIA A;  1VHK A;  3OIJ A;  4H3Y A;  3FRW A;  3KW2 A;  3KNU A;  1RCS A;  1MI7 R;  1NS5 A;  1CO0 A;  1O6D A;  2YY8 A;  1VH0 A;  3AI9 X;  3BBH A;  4YPY A;  3OIN A;  3SSX N;  4YPW A;  4YQ5 A;  3L8U A;  3NK6 A;  1WRS R;  4YVI A;  4J3C A;  1ZT9 A;  2QMM A;  4YQ6 A;  4YQI A;  5CO4 A;  4YQT A;  5GMC A;  4JWH A;  3DCM X;  4YQJ A;  1TRR A;  4YQ9 A;  4IG6 A;  4PZK A;  1JHG A;  1Z85 A;  1VHY A;  3N4K A;  2XDI A;  4YQC A;  4YQG A;  2I6D A;  3ILK A;  1WRP R;  2V3K A;  4YQO A;  4YQA A;  4YQK A;  4JWJ A;  1NXZ A;  3KTY A;  3ONP A;  4JAK A;  4YQP A;  4CNE A;  1X7P A;  3WRP A;  1X7O A;  5GMB A;  4YQQ A;  4YPX A;  2QWV A;  1UAL A;  4YQ8 A;  4YQS A;  1TO0 A;  4CND A;  4MCB A;  1TRO A;  2OZ9 R;  4YQL A;  4YQD A;  4CNG A;  1MXI A;  3GYQ A;  4YQ3 A;  4MCC A;  4H3Z A;  4YPZ A;  4JAL A;  5GM8 A;  4L69 A;  3SSW N;  3O7B A;  4FAK A;  3N4J A;  4JWF A;  3OII A; 
#chains in the Genus database with same CATH homology
 2EGV A;  4X3M A;  4YQR A;  1V2X A;  3BBE A;  2V3J A;  4YVH A;  3QUV A;  4YQ4 A;  1J85 A;  4RG1 A;  1UAJ A;  5FAI A;  4JWG A;  2O3A A;  4YQ2 A;  4KGN A;  3BBD A;  4YVG A;  2Z0Y A;  1OY5 A;  3E5Y A;  4XBO A;  2CX8 A;  5D9F A;  1K3R A;  1P9P A;  1GZ0 A;  4CNF A;  1IPA A;  2EGW A;  3IEF A;  4YQ1 A;  1UAM A;  4YQ0 A;  3IC6 A;  4YVJ A;  4FMW A;  4KDZ A;  3KY7 A;  4YQB A;  3NK7 A;  4YQ7 A;  4YQN A;  4E8B A;  3AXZ A;  2HA8 A;  4MCD A;  1V6Z A;  1ZJR A;  4X3L A;  1UAK A;  4YVK A;  3AIA A;  1VHK A;  3OIJ A;  4H3Y A;  3KW2 A;  3KNU A;  1NS5 A;  1O6D A;  2YY8 A;  1VH0 A;  3AI9 X;  3BBH A;  4YPY A;  3OIN A;  4YPW A;  4YQ5 A;  3L8U A;  3NK6 A;  4YVI A;  4J3C A;  2QMM A;  4YQ6 A;  4YQI A;  5CO4 A;  4YQT A;  5GMC A;  4JWH A;  3DCM X;  4YQJ A;  4YQ9 A;  4IG6 A;  4PZK A;  1Z85 A;  1VHY A;  3N4K A;  4YQC A;  2I6D A;  4YQG A;  3ILK A;  2V3K A;  4YQO A;  4YQA A;  4YQK A;  4JWJ A;  1NXZ A;  3KTY A;  3ONP A;  4JAK A;  4YQP A;  4CNE A;  1X7P A;  1X7O A;  5GMB A;  4YQQ A;  4YPX A;  2QWV A;  1UAL A;  4YQ8 A;  4YQS A;  1TO0 A;  4CND A;  4MCB A;  4YQL A;  4YQD A;  4CNG A;  1MXI A;  3GYQ A;  4YQ3 A;  4MCC A;  4H3Z A;  4YPZ A;  4JAL A;  5GM8 A;  4L69 A;  3O7B A;  4FAK A;  3N4J A;  4JWF A;  3OII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...