5D9FA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
248
structure length
237
Chain Sequence
b'GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae
molecule tags Transferase/transferase inhibitor
total genus 69
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 5d9fA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 5d9fA01
1VHKA 3KW2A 4YQ4A 4JAKA 5GMCA 2QWVA 4E8BA 3AIAA 3ONPA 2YY8A 1ZJRA 3E5YA 1UAKA 1NS5A 4YVGA 4YQ6A 1O6DA 4CNGA 3AXZA 3OIIA 4YQKA 4YPWA 3IC6A 3BBDA 2Z0YA 1TO0A 2V3JA 4KDZA 1OY5A 4YQQA 4YVJA 4L69A 1X7PA 2HA8A 4CNEA 2EGVA 4YQ2A 1IPAA 1P9PA 4YQIA 1J85A 4YQOA 1V6ZA 3NK6A 3KTYA 4PZKA 3KY7A 4YQGA 5GM8A 4X3MA 1K3RA 4H3YA 4FAKA 5D9FA 3IEFA 4YQSA 2I6DA 2QMMA 3L8UA 4YVKA 4MCCA 4YQ5A 4X3LA 1UAJA 4YQ3A 4IG6A 2O3AA 4JALA 4CNFA 3BBHA 1V2XA 4YPXA 5GMBA 2V3KA 4H3ZA 4YVHA 3N4KA 4YQ8A 4RG1A 4YQ1A 4YQCA 3BBEA 4YQDA 3ILKA 3OIJA 3OINA 2CX8A 3QUVA 4YQBA 3DCMX 4XBOA 4YQ7A 1Z85A 3GYQA 4YQAA 4YQJA 1X7OA 5FAIA 1NXZA 3KNUA 4YVIA 3N4JA 4CNDA 4YPYA 4YQ0A 1GZ0A 1MXIA 4KGNA 1VHYA 4YQLA 4YQ9A 3NK7A 4YPZA 4MCBA 4YQPA 5CO4A 4J3CA 4YQTA 3AI9X 1VH0A 3O7BA 4MCDA 1UALA 1UAMA 4YQRA 4YQNA 2EGWA
chains in the Genus database with same CATH superfamily
3SSXN 1VHKA 3KW2A 4YQ4A 4JAKA 5GMCA 1RCSA 2QWVA 4E8BA 3AIAA 3ONPA 2YY8A 1ZJRA 3E5YA 1UAKA 1NS5A 4YVGA 4JWFA 4YQ6A 1O6DA 4CNGA 4FMWA 3AXZA 3OIIA 4YQKA 4YPWA 1TROA 3IC6A 3BBDA 2Z0YA 1TO0A 2V3JA 4KDZA 1OY5A 4YQQA 4YVJA 4L69A 1X7PA 2HA8A 4CNEA 2EGVA 4YQ2A 1IPAA 1P9PA 4YQIA 3KORA 1J85A 4YQOA 1V6ZA 3NK6A 3KTYA 3WRPA 3KY7A 4PZKA 4YQGA 1CO0A 5GM8A 4X3MA 1K3RA 4H3YA 4FAKA 5D9FA 3IEFA 4YQSA 2I6DA 2QMMA 3L8UA 4JWGA 4YVKA 4MCCA 4YQ5A 1JHGA 1WRTR 1UAJA 4X3LA 4YQ3A 1WRPR 4IG6A 2XDIA 2O3AA 4JALA 4CNFA 3BBHA 1V2XA 4YPXA 5GMBA 2V3KA 4H3ZA 2OZ9R 4YVHA 3N4KA 4YQ8A 1TRRA 4RG1A 3G1CA 4YQ1A 4YQCA 3BBEA 4YQDA 3ILKA 3OIJA 3OINA 2CX8A 1WRSR 3QUVA 4YQBA 3DCMX 4XBOA 4YQ7A 1Z85A 3GYQA 4YQAA 4YQJA 1X7OA 5FAIA 1NXZA 3KNUA 4YVIA 3N4JA 4CNDA 4YPYA 4YQ0A 1GZ0A 1MXIA 4KGNA 1VHYA 4YQLA 4YQ9A 3NK7A 3SSWN 4YPZA 4MCBA 4YQPA 5CO4A 4J3CA 4YQTA 4JWJA 3AI9X 1VH0A 1MI7R 4JWHA 1ZT9A 3O7BA 4MCDA 1UALA 1UAMA 4YQRA 4YQNA 2EGWA 3FRWA
chains in the Genus database with same CATH topology
1VHKA 3KW2A 4YQ4A 4JAKA 5GMCA 2QWVA 4E8BA 3AIAA 3ONPA 2YY8A 1ZJRA 3E5YA 1UAKA 1NS5A 4YVGA 4JWFA 4YQ6A 1O6DA 4CNGA 4FMWA 3AXZA 3OIIA 4YQKA 4YPWA 3IC6A 3BBDA 2Z0YA 1TO0A 2V3JA 4KDZA 1OY5A 4YQQA 4YVJA 4L69A 1X7PA 2HA8A 4CNEA 2EGVA 4YQ2A 1IPAA 1P9PA 4YQIA 1J85A 4YQOA 1V6ZA 3NK6A 3KTYA 4PZKA 3KY7A 4YQGA 5GM8A 4X3MA 1K3RA 4H3YA 4FAKA 5D9FA 3IEFA 4YQSA 2I6DA 2QMMA 3L8UA 4JWGA 4YVKA 4MCCA 4YQ5A 4X3LA 1UAJA 4YQ3A 4IG6A 2O3AA 4JALA 4CNFA 3BBHA 1V2XA 4YPXA 5GMBA 2V3KA 4H3ZA 4YVHA 3N4KA 4YQ8A 4RG1A 4YQ1A 4YQCA 3BBEA 4YQDA 3ILKA 3OIJA 3OINA 2CX8A 3QUVA 4YQBA 3DCMX 4XBOA 4YQ7A 1Z85A 3GYQA 4YQAA 4YQJA 1X7OA 5FAIA 1NXZA 3KNUA 4YVIA 3N4JA 4CNDA 4YPYA 4YQ0A 1GZ0A 1MXIA 4KGNA 1VHYA 4YQLA 4YQ9A 3NK7A 4YPZA 4MCBA 4YQPA 5CO4A 4J3CA 4YQTA 4JWJA 3AI9X 1VH0A 4JWHA 3O7BA 4MCDA 1UALA 1UAMA 4YQRA 4YQNA 2EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHK A;  3KW2 A;  4YQ4 A;  4JAK A;  5GMC A;  2QWV A;  4E8B A;  3AIA A;  3ONP A;  2YY8 A;  1ZJR A;  3E5Y A;  1UAK A;  1NS5 A;  4YVG A;  4YQ6 A;  1O6D A;  4CNG A;  3AXZ A;  3OII A;  4YQK A;  4YPW A;  3IC6 A;  3BBD A;  2Z0Y A;  1TO0 A;  2V3J A;  4KDZ A;  1OY5 A;  4YQQ A;  4YVJ A;  4L69 A;  1X7P A;  2HA8 A;  4CNE A;  2EGV A;  4YQ2 A;  1IPA A;  1P9P A;  4YQI A;  1J85 A;  4YQO A;  1V6Z A;  3NK6 A;  3KTY A;  4PZK A;  3KY7 A;  4YQG A;  5GM8 A;  4X3M A;  1K3R A;  4H3Y A;  4FAK A;  5D9F A;  3IEF A;  4YQS A;  2I6D A;  2QMM A;  3L8U A;  4YVK A;  4MCC A;  4YQ5 A;  4X3L A;  1UAJ A;  4YQ3 A;  4IG6 A;  2O3A A;  4JAL A;  4CNF A;  3BBH A;  1V2X A;  4YPX A;  5GMB A;  2V3K A;  4H3Z A;  4YVH A;  3N4K A;  4YQ8 A;  4RG1 A;  4YQ1 A;  4YQC A;  3BBE A;  4YQD A;  3ILK A;  3OIJ A;  3OIN A;  2CX8 A;  3QUV A;  4YQB A;  3DCM X;  4XBO A;  4YQ7 A;  1Z85 A;  3GYQ A;  4YQA A;  4YQJ A;  1X7O A;  5FAI A;  1NXZ A;  3KNU A;  4YVI A;  3N4J A;  4CND A;  4YPY A;  4YQ0 A;  1GZ0 A;  1MXI A;  4KGN A;  1VHY A;  4YQL A;  4YQ9 A;  3NK7 A;  4YPZ A;  4MCB A;  4YQP A;  5CO4 A;  4J3C A;  4YQT A;  3AI9 X;  1VH0 A;  3O7B A;  4MCD A;  1UAL A;  1UAM A;  4YQR A;  4YQN A;  2EGW A; 
#chains in the Genus database with same CATH topology
 3SSX N;  1VHK A;  3KW2 A;  4YQ4 A;  4JAK A;  5GMC A;  1RCS A;  2QWV A;  4E8B A;  3AIA A;  3ONP A;  2YY8 A;  1ZJR A;  3E5Y A;  1UAK A;  1NS5 A;  4YVG A;  4JWF A;  4YQ6 A;  1O6D A;  4CNG A;  4FMW A;  3AXZ A;  3OII A;  4YQK A;  4YPW A;  1TRO A;  3IC6 A;  3BBD A;  2Z0Y A;  1TO0 A;  2V3J A;  4KDZ A;  1OY5 A;  4YQQ A;  4YVJ A;  4L69 A;  1X7P A;  2HA8 A;  4CNE A;  2EGV A;  4YQ2 A;  1IPA A;  1P9P A;  4YQI A;  3KOR A;  1J85 A;  4YQO A;  1V6Z A;  3NK6 A;  3KTY A;  3WRP A;  3KY7 A;  4PZK A;  4YQG A;  1CO0 A;  5GM8 A;  4X3M A;  1K3R A;  4H3Y A;  4FAK A;  5D9F A;  3IEF A;  4YQS A;  2I6D A;  2QMM A;  3L8U A;  4JWG A;  4YVK A;  4MCC A;  4YQ5 A;  1JHG A;  1WRT R;  1UAJ A;  4X3L A;  4YQ3 A;  1WRP R;  4IG6 A;  2XDI A;  2O3A A;  4JAL A;  4CNF A;  3BBH A;  1V2X A;  4YPX A;  5GMB A;  2V3K A;  4H3Z A;  2OZ9 R;  4YVH A;  3N4K A;  4YQ8 A;  1TRR A;  4RG1 A;  3G1C A;  4YQ1 A;  4YQC A;  3BBE A;  4YQD A;  3ILK A;  3OIJ A;  3OIN A;  2CX8 A;  1WRS R;  3QUV A;  4YQB A;  3DCM X;  4XBO A;  4YQ7 A;  1Z85 A;  3GYQ A;  4YQA A;  4YQJ A;  1X7O A;  5FAI A;  1NXZ A;  3KNU A;  4YVI A;  3N4J A;  4CND A;  4YPY A;  4YQ0 A;  1GZ0 A;  1MXI A;  4KGN A;  1VHY A;  4YQL A;  4YQ9 A;  3NK7 A;  3SSW N;  4YPZ A;  4MCB A;  4YQP A;  5CO4 A;  4J3C A;  4YQT A;  4JWJ A;  3AI9 X;  1VH0 A;  1MI7 R;  4JWH A;  1ZT9 A;  3O7B A;  4MCD A;  1UAL A;  1UAM A;  4YQR A;  4YQN A;  2EGW A;  3FRW A; 
#chains in the Genus database with same CATH homology
 1VHK A;  3KW2 A;  4YQ4 A;  4JAK A;  5GMC A;  2QWV A;  4E8B A;  3AIA A;  3ONP A;  2YY8 A;  1ZJR A;  3E5Y A;  1UAK A;  1NS5 A;  4YVG A;  4JWF A;  4YQ6 A;  1O6D A;  4CNG A;  4FMW A;  3AXZ A;  3OII A;  4YQK A;  4YPW A;  3IC6 A;  3BBD A;  2Z0Y A;  1TO0 A;  2V3J A;  4KDZ A;  1OY5 A;  4YQQ A;  4YVJ A;  4L69 A;  1X7P A;  2HA8 A;  4CNE A;  2EGV A;  4YQ2 A;  1IPA A;  1P9P A;  4YQI A;  1J85 A;  4YQO A;  1V6Z A;  3NK6 A;  3KTY A;  4PZK A;  3KY7 A;  4YQG A;  5GM8 A;  4X3M A;  1K3R A;  4H3Y A;  4FAK A;  5D9F A;  3IEF A;  4YQS A;  2I6D A;  2QMM A;  3L8U A;  4JWG A;  4YVK A;  4MCC A;  4YQ5 A;  4X3L A;  1UAJ A;  4YQ3 A;  4IG6 A;  2O3A A;  4JAL A;  4CNF A;  3BBH A;  1V2X A;  4YPX A;  5GMB A;  2V3K A;  4H3Z A;  4YVH A;  3N4K A;  4YQ8 A;  4RG1 A;  4YQ1 A;  4YQC A;  3BBE A;  4YQD A;  3ILK A;  3OIJ A;  3OIN A;  2CX8 A;  3QUV A;  4YQB A;  3DCM X;  4XBO A;  4YQ7 A;  1Z85 A;  3GYQ A;  4YQA A;  4YQJ A;  1X7O A;  5FAI A;  1NXZ A;  3KNU A;  4YVI A;  3N4J A;  4CND A;  4YPY A;  4YQ0 A;  1GZ0 A;  1MXI A;  4KGN A;  1VHY A;  4YQL A;  4YQ9 A;  3NK7 A;  4YPZ A;  4MCB A;  4YQP A;  5CO4 A;  4J3C A;  4YQT A;  4JWJ A;  3AI9 X;  1VH0 A;  4JWH A;  3O7B A;  4MCD A;  1UAL A;  1UAM A;  4YQR A;  4YQN A;  2EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...