3KNUA

Crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
Knots found
sequence length
212
structure length
192
Chain Sequence
SMIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFATVDDTPYGGGPGMLLRADVLGRCIDEVLSLHPNTKLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFYKLQEVSIGDYVLSGGELAAMVIIDTCVRMVPGVIEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA (guanine-N1)-methyltransferase from Anaplasma phagocytophilum
rcsb
source organism Anaplasma phagocytophilum
total genus 51
structure length 192
sequence length 212
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3knuA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3knuA01
1TO0A 4YVGA 4YQ6A 4YQDA 1NS5A 4H3YA 3ONPA 1X7OA 3L8UA 1UALA 4CNDA 4YQLA 4YQPA 4IG6A 3NK6A 5CO4A 3OINA 4J3CA 4YVHA 4YQ1A 5GMCA 1VH0A 4YQ0A 3KW2A 4YPYA 4YQ4A 3DCMX 2HA8A 4YQ5A 4XBOA 2EGWA 3N4JA 2V3JA 4YPZA 4YQNA 4YQAA 3BBHA 4KGNA 3QUVA 1O6DA 1V2XA 3BBEA 1UAKA 4YQ8A 3N4KA 1NXZA 4RG1A 2QMMA 4YPWA 4E8BA 4YQSA 3KY7A 3NK7A 3KTYA 4YQ7A 2V3KA 4JAKA 4CNFA 4FAKA 4YPXA 1V6ZA 3AIAA 4YQOA 3IC6A 2I6DA 3ILKA 4YQRA 2EGVA 1J85A 3GYQA 4YQCA 4YVIA 2QWVA 2CX8A 3AXZA 5D9FA 4CNGA 4MCBA 1ZJRA 1OY5A 1VHYA 1X7PA 4JALA 4YQQA 4CNEA 4YQIA 1P9PA 3KNUA 1IPAA 4KDZA 4YQ3A 5GMBA 1Z85A 3BBDA 4L69A 4PZKA 3OIIA 1VHKA 2Z0YA 2O3AA 4MCDA 2YY8A 4X3LA 4YQGA 5FAIA 4YQ9A 1UAMA 4YVJA 3O7BA 4X3MA 4YQTA 3E5YA 1GZ0A 3AI9X 4MCCA 1UAJA 4YQBA 4YVKA 4YQJA 1K3RA 3OIJA 5GM8A 4H3ZA 4YQ2A 3IEFA 4YQKA 1MXIA
chains in the Genus database with same CATH superfamily
1TO0A 4YVGA 4YQ6A 4YQDA 1NS5A 4H3YA 3ONPA 1X7OA 3L8UA 3G1CA 1UALA 4CNDA 4YQLA 4YQPA 3SSWN 4IG6A 3NK6A 5CO4A 3OINA 4J3CA 4YVHA 4YQ1A 5GMCA 1VH0A 4YQ0A 3KW2A 4YPYA 4YQ4A 3DCMX 2HA8A 4YQ5A 4XBOA 2EGWA 3N4JA 2V3JA 1WRTR 4YPZA 4YQNA 4YQAA 3BBHA 1JHGA 4KGNA 3QUVA 1O6DA 1V2XA 3BBEA 1UAKA 4YQ8A 3N4KA 1NXZA 4RG1A 2QMMA 4YPWA 4E8BA 4YQSA 3FRWA 3KY7A 3NK7A 3KTYA 4YQ7A 2V3KA 4JAKA 4CNFA 4FAKA 4YPXA 2OZ9R 1V6ZA 3AIAA 4YQOA 3IC6A 1WRPR 2I6DA 3ILKA 4YQRA 2EGVA 1J85A 3GYQA 4YQCA 4YVIA 2QWVA 1WRSR 2CX8A 3AXZA 5D9FA 4CNGA 1CO0A 4MCBA 1ZJRA 1OY5A 1VHYA 1X7PA 4JALA 1ZT9A 4FMWA 4YQQA 4JWJA 4CNEA 4YQIA 4JWFA 1P9PA 3KNUA 1IPAA 4KDZA 4YQ3A 5GMBA 1TROA 1Z85A 1MI7R 3BBDA 4L69A 4PZKA 3OIIA 1VHKA 2Z0YA 2O3AA 4MCDA 2YY8A 1TRRA 4X3LA 4YQGA 5FAIA 3WRPA 4YQ9A 4JWGA 1UAMA 4YVJA 3O7BA 4X3MA 4YQTA 3E5YA 1GZ0A 2XDIA 3AI9X 4MCCA 3KORA 1UAJA 4YQBA 4YVKA 4YQJA 1K3RA 3OIJA 4JWHA 3SSXN 5GM8A 4H3ZA 1RCSA 4YQ2A 3IEFA 4YQKA 1MXIA
chains in the Genus database with same CATH topology
1TO0A 4YVGA 4YQ6A 4YQDA 1NS5A 4H3YA 3ONPA 1X7OA 3L8UA 1UALA 4CNDA 4YQLA 4YQPA 4IG6A 3NK6A 5CO4A 3OINA 4J3CA 4YVHA 4YQ1A 5GMCA 1VH0A 4YQ0A 3KW2A 4YPYA 4YQ4A 3DCMX 2HA8A 4YQ5A 4XBOA 2EGWA 3N4JA 2V3JA 4YPZA 4YQNA 4YQAA 3BBHA 4KGNA 3QUVA 1O6DA 1V2XA 3BBEA 1UAKA 4YQ8A 3N4KA 1NXZA 4RG1A 2QMMA 4YPWA 4E8BA 4YQSA 3KY7A 3NK7A 3KTYA 4YQ7A 2V3KA 4JAKA 4CNFA 4FAKA 4YPXA 1V6ZA 3AIAA 4YQOA 3IC6A 2I6DA 3ILKA 4YQRA 2EGVA 1J85A 3GYQA 4YQCA 4YVIA 2QWVA 2CX8A 3AXZA 5D9FA 4CNGA 4MCBA 1ZJRA 1OY5A 1VHYA 1X7PA 4JALA 4FMWA 4JWJA 4YQQA 4CNEA 4YQIA 4JWFA 1P9PA 3KNUA 1IPAA 4KDZA 4YQ3A 5GMBA 1Z85A 3BBDA 4L69A 4PZKA 3OIIA 1VHKA 2Z0YA 2O3AA 4MCDA 2YY8A 4X3LA 4YQGA 5FAIA 4YQ9A 4JWGA 1UAMA 4YVJA 3O7BA 4X3MA 4YQTA 3E5YA 1GZ0A 3AI9X 4MCCA 1UAJA 4YQBA 4YVKA 4YQJA 1K3RA 3OIJA 4JWHA 5GM8A 4H3ZA 4YQ2A 3IEFA 4YQKA 1MXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TO0 A;  4YVG A;  4YQ6 A;  4YQD A;  1NS5 A;  4H3Y A;  3ONP A;  1X7O A;  3L8U A;  1UAL A;  4CND A;  4YQL A;  4YQP A;  4IG6 A;  3NK6 A;  5CO4 A;  3OIN A;  4J3C A;  4YVH A;  4YQ1 A;  5GMC A;  1VH0 A;  4YQ0 A;  3KW2 A;  4YPY A;  4YQ4 A;  3DCM X;  2HA8 A;  4YQ5 A;  4XBO A;  2EGW A;  3N4J A;  2V3J A;  4YPZ A;  4YQN A;  4YQA A;  3BBH A;  4KGN A;  3QUV A;  1O6D A;  1V2X A;  3BBE A;  1UAK A;  4YQ8 A;  3N4K A;  1NXZ A;  4RG1 A;  2QMM A;  4YPW A;  4E8B A;  4YQS A;  3KY7 A;  3NK7 A;  3KTY A;  4YQ7 A;  2V3K A;  4JAK A;  4CNF A;  4FAK A;  4YPX A;  1V6Z A;  3AIA A;  4YQO A;  3IC6 A;  2I6D A;  3ILK A;  4YQR A;  2EGV A;  1J85 A;  3GYQ A;  4YQC A;  4YVI A;  2QWV A;  2CX8 A;  3AXZ A;  5D9F A;  4CNG A;  4MCB A;  1ZJR A;  1OY5 A;  1VHY A;  1X7P A;  4JAL A;  4YQQ A;  4CNE A;  4YQI A;  1P9P A;  3KNU A;  1IPA A;  4KDZ A;  4YQ3 A;  5GMB A;  1Z85 A;  3BBD A;  4L69 A;  4PZK A;  3OII A;  1VHK A;  2Z0Y A;  2O3A A;  4MCD A;  2YY8 A;  4X3L A;  4YQG A;  5FAI A;  4YQ9 A;  1UAM A;  4YVJ A;  3O7B A;  4X3M A;  4YQT A;  3E5Y A;  1GZ0 A;  3AI9 X;  4MCC A;  1UAJ A;  4YQB A;  4YVK A;  4YQJ A;  1K3R A;  3OIJ A;  5GM8 A;  4H3Z A;  4YQ2 A;  3IEF A;  4YQK A;  1MXI A; 
#chains in the Genus database with same CATH topology
 1TO0 A;  4YVG A;  4YQ6 A;  4YQD A;  1NS5 A;  4H3Y A;  3ONP A;  1X7O A;  3L8U A;  3G1C A;  1UAL A;  4CND A;  4YQL A;  4YQP A;  3SSW N;  4IG6 A;  3NK6 A;  5CO4 A;  3OIN A;  4J3C A;  4YVH A;  4YQ1 A;  5GMC A;  1VH0 A;  4YQ0 A;  3KW2 A;  4YPY A;  4YQ4 A;  3DCM X;  2HA8 A;  4YQ5 A;  4XBO A;  2EGW A;  3N4J A;  2V3J A;  1WRT R;  4YPZ A;  4YQN A;  4YQA A;  3BBH A;  1JHG A;  4KGN A;  3QUV A;  1O6D A;  1V2X A;  3BBE A;  1UAK A;  4YQ8 A;  3N4K A;  1NXZ A;  4RG1 A;  2QMM A;  4YPW A;  4E8B A;  4YQS A;  3FRW A;  3KY7 A;  3NK7 A;  3KTY A;  4YQ7 A;  2V3K A;  4JAK A;  4CNF A;  4FAK A;  4YPX A;  2OZ9 R;  1V6Z A;  3AIA A;  4YQO A;  3IC6 A;  1WRP R;  2I6D A;  3ILK A;  4YQR A;  2EGV A;  1J85 A;  3GYQ A;  4YQC A;  4YVI A;  2QWV A;  1WRS R;  2CX8 A;  3AXZ A;  5D9F A;  4CNG A;  1CO0 A;  4MCB A;  1ZJR A;  1OY5 A;  1VHY A;  1X7P A;  4JAL A;  1ZT9 A;  4FMW A;  4YQQ A;  4JWJ A;  4CNE A;  4YQI A;  4JWF A;  1P9P A;  3KNU A;  1IPA A;  4KDZ A;  4YQ3 A;  5GMB A;  1TRO A;  1Z85 A;  1MI7 R;  3BBD A;  4L69 A;  4PZK A;  3OII A;  1VHK A;  2Z0Y A;  2O3A A;  4MCD A;  2YY8 A;  1TRR A;  4X3L A;  4YQG A;  5FAI A;  3WRP A;  4YQ9 A;  4JWG A;  1UAM A;  4YVJ A;  3O7B A;  4X3M A;  4YQT A;  3E5Y A;  1GZ0 A;  2XDI A;  3AI9 X;  4MCC A;  3KOR A;  1UAJ A;  4YQB A;  4YVK A;  4YQJ A;  1K3R A;  3OIJ A;  4JWH A;  3SSX N;  5GM8 A;  4H3Z A;  1RCS A;  4YQ2 A;  3IEF A;  4YQK A;  1MXI A; 
#chains in the Genus database with same CATH homology
 1TO0 A;  4YVG A;  4YQ6 A;  4YQD A;  1NS5 A;  4H3Y A;  3ONP A;  1X7O A;  3L8U A;  1UAL A;  4CND A;  4YQL A;  4YQP A;  4IG6 A;  3NK6 A;  5CO4 A;  3OIN A;  4J3C A;  4YVH A;  4YQ1 A;  5GMC A;  1VH0 A;  4YQ0 A;  3KW2 A;  4YPY A;  4YQ4 A;  3DCM X;  2HA8 A;  4YQ5 A;  4XBO A;  2EGW A;  3N4J A;  2V3J A;  4YPZ A;  4YQN A;  4YQA A;  3BBH A;  4KGN A;  3QUV A;  1O6D A;  1V2X A;  3BBE A;  1UAK A;  4YQ8 A;  3N4K A;  1NXZ A;  4RG1 A;  2QMM A;  4YPW A;  4E8B A;  4YQS A;  3KY7 A;  3NK7 A;  3KTY A;  4YQ7 A;  2V3K A;  4JAK A;  4CNF A;  4FAK A;  4YPX A;  1V6Z A;  3AIA A;  4YQO A;  3IC6 A;  2I6D A;  3ILK A;  4YQR A;  2EGV A;  1J85 A;  3GYQ A;  4YQC A;  4YVI A;  2QWV A;  2CX8 A;  3AXZ A;  5D9F A;  4CNG A;  4MCB A;  1ZJR A;  1OY5 A;  1VHY A;  1X7P A;  4JAL A;  4FMW A;  4JWJ A;  4YQQ A;  4CNE A;  4YQI A;  4JWF A;  1P9P A;  3KNU A;  1IPA A;  4KDZ A;  4YQ3 A;  5GMB A;  1Z85 A;  3BBD A;  4L69 A;  4PZK A;  3OII A;  1VHK A;  2Z0Y A;  2O3A A;  4MCD A;  2YY8 A;  4X3L A;  4YQG A;  5FAI A;  4YQ9 A;  4JWG A;  1UAM A;  4YVJ A;  3O7B A;  4X3M A;  4YQT A;  3E5Y A;  1GZ0 A;  3AI9 X;  4MCC A;  1UAJ A;  4YQB A;  4YVK A;  4YQJ A;  1K3R A;  3OIJ A;  4JWH A;  5GM8 A;  4H3Z A;  4YQ2 A;  3IEF A;  4YQK A;  1MXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...