3KNUA

Crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
Knots found
sequence length
212
structure length
192
Chain Sequence
b'SMIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFATVDDTPYGGGPGMLLRADVLGRCIDEVLSLHPNTKLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFYKLQEVSIGDYVLSGGELAAMVIIDTCVRMVPGVIEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA (guanine-N1)-methyltransferase from Anaplasma phagocytophilum
rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 51
structure length 192
sequence length 212
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3knuA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3knuA01
5D9FA 4H3ZA 2V3KA 4L69A 3ONPA 4X3LA 4YQBA 4YQRA 4YVIA 3NK6A 4YQLA 3KY7A 3O7BA 1ZJRA 4CNDA 4RG1A 4CNEA 4JALA 4MCDA 3BBDA 4YQ6A 3KW2A 1X7PA 2QWVA 3IC6A 4CNFA 4YPYA 3KTYA 1GZ0A 1OY5A 4YQ1A 3N4KA 1Z85A 1O6DA 1UAJA 4MCBA 3AIAA 4JAKA 4IG6A 5GMCA 3BBHA 4YQ2A 3IEFA 4E8BA 3OIIA 4YVJA 4YQTA 5CO4A 4YQPA 1X7OA 4YQ0A 3GYQA 2Z0YA 4XBOA 4YQ3A 3L8UA 4J3CA 4KDZA 4YQIA 3N4JA 4H3YA 4YQOA 4YPZA 4PZKA 2EGVA 4X3MA 4YQ8A 1NS5A 1TO0A 1UAMA 1IPAA 4FAKA 4YQNA 3ILKA 3OIJA 4YPWA 4YQ4A 4YQKA 2I6DA 2QMMA 2V3JA 3BBEA 1V6ZA 4YVGA 2YY8A 1K3RA 4KGNA 3OINA 4YQJA 4YQAA 2O3AA 2HA8A 4YQDA 4YPXA 3E5YA 1P9PA 1J85A 4YQ5A 5FAIA 4CNGA 4YQGA 3NK7A 4YQCA 1VHKA 4MCCA 4YVKA 5GM8A 3QUVA 4YQ7A 2EGWA 4YQ9A 1NXZA 4YVHA 2CX8A 1VHYA 1VH0A 4YQQA 4YQSA 1UAKA 1MXIA 3DCMX 3KNUA 1UALA 3AI9X 5GMBA 3AXZA 1V2XA
chains in the Genus database with same CATH superfamily
1CO0A 5D9FA 4H3ZA 2V3KA 4L69A 1WRTR 3ONPA 4X3LA 1RCSA 4YQBA 4YQRA 4YVIA 3NK6A 4YQLA 3KY7A 2OZ9R 3O7BA 1ZJRA 4CNDA 4RG1A 4CNEA 4JALA 4MCDA 3BBDA 3FRWA 4YQ6A 3KW2A 1X7PA 2QWVA 3IC6A 4CNFA 4YPYA 1WRSR 1GZ0A 3KTYA 1OY5A 4YQ1A 3N4KA 1Z85A 1O6DA 4JWGA 1UAJA 4MCBA 3AIAA 4JAKA 4IG6A 5GMCA 3BBHA 2XDIA 4YQ2A 3IEFA 4E8BA 3OIIA 4YVJA 4YQTA 5CO4A 1MI7R 4YQPA 1X7OA 4YQ0A 1JHGA 3GYQA 2Z0YA 4XBOA 4YQ3A 3SSWN 3L8UA 4J3CA 4KDZA 4YQIA 3N4JA 4H3YA 1TROA 4YQOA 4YPZA 4PZKA 2EGVA 4X3MA 1TRRA 4YQ8A 3WRPA 1NS5A 1TO0A 1UAMA 1IPAA 4FAKA 4YQNA 3ILKA 3OIJA 4YPWA 4YQ4A 4JWFA 4FMWA 4YQKA 2I6DA 2QMMA 2V3JA 3BBEA 1V6ZA 4YVGA 2YY8A 3SSXN 1K3RA 4KGNA 3OINA 4YQJA 4YQAA 2O3AA 2HA8A 3KORA 4YQDA 4YPXA 3E5YA 1P9PA 1ZT9A 4JWJA 1J85A 4YQ5A 5FAIA 4CNGA 4YQGA 3NK7A 4YQCA 1VHKA 4MCCA 4YVKA 5GM8A 3QUVA 4YQ7A 2EGWA 4YQ9A 1NXZA 4YVHA 2CX8A 1VHYA 1VH0A 1WRPR 4YQQA 4JWHA 4YQSA 1UAKA 3G1CA 1MXIA 3DCMX 3KNUA 1UALA 3AI9X 5GMBA 3AXZA 1V2XA
chains in the Genus database with same CATH topology
5D9FA 4H3ZA 2V3KA 4L69A 3ONPA 4X3LA 4YQBA 4YQRA 4YVIA 3NK6A 4YQLA 3KY7A 3O7BA 1ZJRA 4CNDA 4RG1A 4CNEA 4JALA 4MCDA 3BBDA 4YQ6A 3KW2A 1X7PA 2QWVA 3IC6A 4CNFA 4YPYA 3KTYA 1GZ0A 1OY5A 4YQ1A 3N4KA 1Z85A 1O6DA 4JWGA 1UAJA 4MCBA 3AIAA 4JAKA 4IG6A 5GMCA 3BBHA 4YQ2A 3IEFA 4E8BA 3OIIA 4YVJA 4YQTA 5CO4A 4YQPA 1X7OA 4YQ0A 3GYQA 2Z0YA 4XBOA 4YQ3A 3L8UA 4J3CA 4KDZA 4YQIA 3N4JA 4H3YA 4YQOA 4YPZA 4PZKA 2EGVA 4X3MA 4YQ8A 1NS5A 1TO0A 1UAMA 1IPAA 4FAKA 4YQNA 3ILKA 3OIJA 4YPWA 4YQ4A 4JWFA 4FMWA 4YQKA 2I6DA 2QMMA 2V3JA 3BBEA 1V6ZA 4YVGA 2YY8A 1K3RA 4KGNA 3OINA 4YQJA 4YQAA 2O3AA 2HA8A 4YQDA 4YPXA 3E5YA 1P9PA 4JWJA 1J85A 4YQ5A 5FAIA 4CNGA 4YQGA 3NK7A 4YQCA 1VHKA 4MCCA 4YVKA 5GM8A 3QUVA 4YQ7A 2EGWA 4YQ9A 1NXZA 4YVHA 2CX8A 1VHYA 1VH0A 4YQQA 4JWHA 4YQSA 1UAKA 1MXIA 3DCMX 3KNUA 1UALA 3AI9X 5GMBA 3AXZA 1V2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9F A;  4H3Z A;  2V3K A;  4L69 A;  3ONP A;  4X3L A;  4YQB A;  4YQR A;  4YVI A;  3NK6 A;  4YQL A;  3KY7 A;  3O7B A;  1ZJR A;  4CND A;  4RG1 A;  4CNE A;  4JAL A;  4MCD A;  3BBD A;  4YQ6 A;  3KW2 A;  1X7P A;  2QWV A;  3IC6 A;  4CNF A;  4YPY A;  3KTY A;  1GZ0 A;  1OY5 A;  4YQ1 A;  3N4K A;  1Z85 A;  1O6D A;  1UAJ A;  4MCB A;  3AIA A;  4JAK A;  4IG6 A;  5GMC A;  3BBH A;  4YQ2 A;  3IEF A;  4E8B A;  3OII A;  4YVJ A;  4YQT A;  5CO4 A;  4YQP A;  1X7O A;  4YQ0 A;  3GYQ A;  2Z0Y A;  4XBO A;  4YQ3 A;  3L8U A;  4J3C A;  4KDZ A;  4YQI A;  3N4J A;  4H3Y A;  4YQO A;  4YPZ A;  4PZK A;  2EGV A;  4X3M A;  4YQ8 A;  1NS5 A;  1TO0 A;  1UAM A;  1IPA A;  4FAK A;  4YQN A;  3ILK A;  3OIJ A;  4YPW A;  4YQ4 A;  4YQK A;  2I6D A;  2QMM A;  2V3J A;  3BBE A;  1V6Z A;  4YVG A;  2YY8 A;  1K3R A;  4KGN A;  3OIN A;  4YQJ A;  4YQA A;  2O3A A;  2HA8 A;  4YQD A;  4YPX A;  3E5Y A;  1P9P A;  1J85 A;  4YQ5 A;  5FAI A;  4CNG A;  4YQG A;  3NK7 A;  4YQC A;  1VHK A;  4MCC A;  4YVK A;  5GM8 A;  3QUV A;  4YQ7 A;  2EGW A;  4YQ9 A;  1NXZ A;  4YVH A;  2CX8 A;  1VHY A;  1VH0 A;  4YQQ A;  4YQS A;  1UAK A;  1MXI A;  3DCM X;  3KNU A;  1UAL A;  3AI9 X;  5GMB A;  3AXZ A;  1V2X A; 
#chains in the Genus database with same CATH topology
 1CO0 A;  5D9F A;  4H3Z A;  2V3K A;  4L69 A;  1WRT R;  3ONP A;  4X3L A;  1RCS A;  4YQB A;  4YQR A;  4YVI A;  3NK6 A;  4YQL A;  3KY7 A;  2OZ9 R;  3O7B A;  1ZJR A;  4CND A;  4RG1 A;  4CNE A;  4JAL A;  4MCD A;  3BBD A;  3FRW A;  4YQ6 A;  3KW2 A;  1X7P A;  2QWV A;  3IC6 A;  4CNF A;  4YPY A;  1WRS R;  1GZ0 A;  3KTY A;  1OY5 A;  4YQ1 A;  3N4K A;  1Z85 A;  1O6D A;  4JWG A;  1UAJ A;  4MCB A;  3AIA A;  4JAK A;  4IG6 A;  5GMC A;  3BBH A;  2XDI A;  4YQ2 A;  3IEF A;  4E8B A;  3OII A;  4YVJ A;  4YQT A;  5CO4 A;  1MI7 R;  4YQP A;  1X7O A;  4YQ0 A;  1JHG A;  3GYQ A;  2Z0Y A;  4XBO A;  4YQ3 A;  3SSW N;  3L8U A;  4J3C A;  4KDZ A;  4YQI A;  3N4J A;  4H3Y A;  1TRO A;  4YQO A;  4YPZ A;  4PZK A;  2EGV A;  4X3M A;  1TRR A;  4YQ8 A;  3WRP A;  1NS5 A;  1TO0 A;  1UAM A;  1IPA A;  4FAK A;  4YQN A;  3ILK A;  3OIJ A;  4YPW A;  4YQ4 A;  4JWF A;  4FMW A;  4YQK A;  2I6D A;  2QMM A;  2V3J A;  3BBE A;  1V6Z A;  4YVG A;  2YY8 A;  3SSX N;  1K3R A;  4KGN A;  3OIN A;  4YQJ A;  4YQA A;  2O3A A;  2HA8 A;  3KOR A;  4YQD A;  4YPX A;  3E5Y A;  1P9P A;  1ZT9 A;  4JWJ A;  1J85 A;  4YQ5 A;  5FAI A;  4CNG A;  4YQG A;  3NK7 A;  4YQC A;  1VHK A;  4MCC A;  4YVK A;  5GM8 A;  3QUV A;  4YQ7 A;  2EGW A;  4YQ9 A;  1NXZ A;  4YVH A;  2CX8 A;  1VHY A;  1VH0 A;  1WRP R;  4YQQ A;  4JWH A;  4YQS A;  1UAK A;  3G1C A;  1MXI A;  3DCM X;  3KNU A;  1UAL A;  3AI9 X;  5GMB A;  3AXZ A;  1V2X A; 
#chains in the Genus database with same CATH homology
 5D9F A;  4H3Z A;  2V3K A;  4L69 A;  3ONP A;  4X3L A;  4YQB A;  4YQR A;  4YVI A;  3NK6 A;  4YQL A;  3KY7 A;  3O7B A;  1ZJR A;  4CND A;  4RG1 A;  4CNE A;  4JAL A;  4MCD A;  3BBD A;  4YQ6 A;  3KW2 A;  1X7P A;  2QWV A;  3IC6 A;  4CNF A;  4YPY A;  3KTY A;  1GZ0 A;  1OY5 A;  4YQ1 A;  3N4K A;  1Z85 A;  1O6D A;  4JWG A;  1UAJ A;  4MCB A;  3AIA A;  4JAK A;  4IG6 A;  5GMC A;  3BBH A;  4YQ2 A;  3IEF A;  4E8B A;  3OII A;  4YVJ A;  4YQT A;  5CO4 A;  4YQP A;  1X7O A;  4YQ0 A;  3GYQ A;  2Z0Y A;  4XBO A;  4YQ3 A;  3L8U A;  4J3C A;  4KDZ A;  4YQI A;  3N4J A;  4H3Y A;  4YQO A;  4YPZ A;  4PZK A;  2EGV A;  4X3M A;  4YQ8 A;  1NS5 A;  1TO0 A;  1UAM A;  1IPA A;  4FAK A;  4YQN A;  3ILK A;  3OIJ A;  4YPW A;  4YQ4 A;  4JWF A;  4FMW A;  4YQK A;  2I6D A;  2QMM A;  2V3J A;  3BBE A;  1V6Z A;  4YVG A;  2YY8 A;  1K3R A;  4KGN A;  3OIN A;  4YQJ A;  4YQA A;  2O3A A;  2HA8 A;  4YQD A;  4YPX A;  3E5Y A;  1P9P A;  4JWJ A;  1J85 A;  4YQ5 A;  5FAI A;  4CNG A;  4YQG A;  3NK7 A;  4YQC A;  1VHK A;  4MCC A;  4YVK A;  5GM8 A;  3QUV A;  4YQ7 A;  2EGW A;  4YQ9 A;  1NXZ A;  4YVH A;  2CX8 A;  1VHY A;  1VH0 A;  4YQQ A;  4JWH A;  4YQS A;  1UAK A;  1MXI A;  3DCM X;  3KNU A;  1UAL A;  3AI9 X;  5GMB A;  3AXZ A;  1V2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...