4YQ4A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
249
structure length
242
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 74
structure length 242
sequence length 249
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq4A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq4A01
4RG1A 3N4JA 3NK6A 1X7PA 2V3KA 4KGNA 2EGWA 1OY5A 4YQ6A 4PZKA 3E5YA 1ZJRA 4YQLA 1UAMA 3L8UA 3IEFA 3ONPA 3AI9X 1O6DA 2V3JA 3O7BA 4CNDA 2CX8A 2QMMA 4MCBA 4KDZA 4YQ3A 4YVHA 4YVIA 3NK7A 1VHYA 4L69A 3OINA 4J3CA 1NS5A 4YQ4A 1MXIA 3DCMX 4FAKA 5FAIA 2O3AA 4YQQA 1NXZA 1X7OA 4YPYA 1J85A 1TO0A 1UALA 2EGVA 3OIIA 4YQSA 4YQ8A 5CO4A 4YQAA 1VH0A 3IC6A 2HA8A 4YQGA 4YQDA 5GMCA 4H3YA 5GMBA 3ILKA 4YPWA 2YY8A 3BBDA 4X3LA 1UAJA 4YQ0A 4CNFA 4MCDA 3QUVA 5GM8A 4YQCA 4YQ5A 4JALA 1UAKA 1K3RA 1IPAA 2QWVA 1V2XA 3N4KA 3KTYA 3KNUA 4CNEA 1V6ZA 2I6DA 4XBOA 4YPZA 4YQTA 4YQNA 3GYQA 1P9PA 3KY7A 4YQ2A 4YQIA 4YVJA 4MCCA 4YQPA 4YVGA 1Z85A 4CNGA 4X3MA 4JAKA 1GZ0A 3OIJA 4YQOA 3AIAA 3AXZA 4YQKA 4YVKA 4YQRA 4YQBA 4YQ1A 3BBHA 5D9FA 4YPXA 4H3ZA 4YQ7A 4E8BA 4YQ9A 1VHKA 3BBEA 2Z0YA 4YQJA 4IG6A 3KW2A
chains in the Genus database with same CATH superfamily
4RG1A 3N4JA 3NK6A 1X7PA 2V3KA 4KGNA 2EGWA 1OY5A 4YQ6A 4PZKA 1WRTR 3E5YA 1ZJRA 4YQLA 1TRRA 1UAMA 3L8UA 3IEFA 3ONPA 1RCSA 3AI9X 1O6DA 2V3JA 3O7BA 4CNDA 2CX8A 2QMMA 4MCBA 4KDZA 4YQ3A 4YVHA 4YVIA 1WRSR 3NK7A 1VHYA 4L69A 3OINA 4J3CA 1NS5A 4YQ4A 1MXIA 3DCMX 4FAKA 5FAIA 2O3AA 4JWJA 4YQQA 1NXZA 1X7OA 4YPYA 1J85A 4JWGA 1TO0A 1UALA 2EGVA 3OIIA 4YQSA 4JWHA 4YQ8A 5CO4A 4YQAA 1VH0A 3IC6A 2XDIA 4YQGA 2HA8A 4YQDA 5GMCA 4H3YA 5GMBA 3SSWN 3ILKA 3FRWA 4JWFA 2OZ9R 4YPWA 2YY8A 3BBDA 1UAJA 4YQ0A 4X3LA 4CNFA 4MCDA 3WRPA 3QUVA 3SSXN 5GM8A 4YQCA 4FMWA 4YQ5A 4JALA 1UAKA 1WRPR 1K3RA 1IPAA 2QWVA 1V2XA 3N4KA 3KTYA 3KNUA 4CNEA 3KORA 1V6ZA 2I6DA 4XBOA 4YPZA 4YQTA 4YQNA 3G1CA 1TROA 1P9PA 3KY7A 4YQ2A 3GYQA 4YQIA 4YVJA 4MCCA 4YQPA 4YVGA 1Z85A 4CNGA 4X3MA 4JAKA 1GZ0A 3OIJA 4YQOA 3AIAA 3AXZA 4YQKA 4YVKA 4YQRA 1CO0A 4YQBA 4YQ1A 3BBHA 5D9FA 1MI7R 4YPXA 4H3ZA 4YQ7A 4E8BA 4YQ9A 1VHKA 1ZT9A 1JHGA 3BBEA 2Z0YA 4YQJA 4IG6A 3KW2A
chains in the Genus database with same CATH topology
4RG1A 3N4JA 3NK6A 1X7PA 2V3KA 4KGNA 2EGWA 1OY5A 4YQ6A 4PZKA 3E5YA 1ZJRA 4YQLA 1UAMA 3L8UA 3IEFA 3ONPA 3AI9X 1O6DA 2V3JA 3O7BA 4CNDA 2CX8A 2QMMA 4MCBA 4KDZA 4YQ3A 4YVHA 4YVIA 3NK7A 1VHYA 4L69A 3OINA 4J3CA 1NS5A 4YQ4A 1MXIA 3DCMX 4FAKA 5FAIA 2O3AA 4JWJA 4YQQA 1NXZA 1X7OA 4YPYA 1J85A 4JWGA 1TO0A 1UALA 2EGVA 3OIIA 4YQSA 4JWHA 4YQ8A 5CO4A 4YQAA 1VH0A 3IC6A 2HA8A 4YQGA 4YQDA 5GMCA 4H3YA 5GMBA 3ILKA 4JWFA 4YPWA 2YY8A 3BBDA 4X3LA 1UAJA 4YQ0A 4CNFA 4MCDA 3QUVA 5GM8A 4YQCA 4FMWA 4YQ5A 4JALA 1UAKA 1K3RA 1IPAA 2QWVA 1V2XA 3N4KA 3KTYA 3KNUA 4CNEA 1V6ZA 2I6DA 4XBOA 4YPZA 4YQTA 4YQNA 3GYQA 1P9PA 3KY7A 4YQ2A 4YQIA 4YVJA 4MCCA 4YQPA 4YVGA 1Z85A 4CNGA 4X3MA 4JAKA 1GZ0A 3OIJA 4YQOA 3AIAA 3AXZA 4YQKA 4YVKA 4YQRA 4YQBA 4YQ1A 3BBHA 5D9FA 4YPXA 4H3ZA 4YQ7A 4E8BA 4YQ9A 1VHKA 3BBEA 2Z0YA 4YQJA 4IG6A 3KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG1 A;  3N4J A;  3NK6 A;  1X7P A;  2V3K A;  4KGN A;  2EGW A;  1OY5 A;  4YQ6 A;  4PZK A;  3E5Y A;  1ZJR A;  4YQL A;  1UAM A;  3L8U A;  3IEF A;  3ONP A;  3AI9 X;  1O6D A;  2V3J A;  3O7B A;  4CND A;  2CX8 A;  2QMM A;  4MCB A;  4KDZ A;  4YQ3 A;  4YVH A;  4YVI A;  3NK7 A;  1VHY A;  4L69 A;  3OIN A;  4J3C A;  1NS5 A;  4YQ4 A;  1MXI A;  3DCM X;  4FAK A;  5FAI A;  2O3A A;  4YQQ A;  1NXZ A;  1X7O A;  4YPY A;  1J85 A;  1TO0 A;  1UAL A;  2EGV A;  3OII A;  4YQS A;  4YQ8 A;  5CO4 A;  4YQA A;  1VH0 A;  3IC6 A;  2HA8 A;  4YQG A;  4YQD A;  5GMC A;  4H3Y A;  5GMB A;  3ILK A;  4YPW A;  2YY8 A;  3BBD A;  4X3L A;  1UAJ A;  4YQ0 A;  4CNF A;  4MCD A;  3QUV A;  5GM8 A;  4YQC A;  4YQ5 A;  4JAL A;  1UAK A;  1K3R A;  1IPA A;  2QWV A;  1V2X A;  3N4K A;  3KTY A;  3KNU A;  4CNE A;  1V6Z A;  2I6D A;  4XBO A;  4YPZ A;  4YQT A;  4YQN A;  3GYQ A;  1P9P A;  3KY7 A;  4YQ2 A;  4YQI A;  4YVJ A;  4MCC A;  4YQP A;  4YVG A;  1Z85 A;  4CNG A;  4X3M A;  4JAK A;  1GZ0 A;  3OIJ A;  4YQO A;  3AIA A;  3AXZ A;  4YQK A;  4YVK A;  4YQR A;  4YQB A;  4YQ1 A;  3BBH A;  5D9F A;  4YPX A;  4H3Z A;  4YQ7 A;  4E8B A;  4YQ9 A;  1VHK A;  3BBE A;  2Z0Y A;  4YQJ A;  4IG6 A;  3KW2 A; 
#chains in the Genus database with same CATH topology
 4RG1 A;  3N4J A;  3NK6 A;  1X7P A;  2V3K A;  4KGN A;  2EGW A;  1OY5 A;  4YQ6 A;  4PZK A;  1WRT R;  3E5Y A;  1ZJR A;  4YQL A;  1TRR A;  1UAM A;  3L8U A;  3IEF A;  3ONP A;  1RCS A;  3AI9 X;  1O6D A;  2V3J A;  3O7B A;  4CND A;  2CX8 A;  2QMM A;  4MCB A;  4KDZ A;  4YQ3 A;  4YVH A;  4YVI A;  1WRS R;  3NK7 A;  1VHY A;  4L69 A;  3OIN A;  4J3C A;  1NS5 A;  4YQ4 A;  1MXI A;  3DCM X;  4FAK A;  5FAI A;  2O3A A;  4JWJ A;  4YQQ A;  1NXZ A;  1X7O A;  4YPY A;  1J85 A;  4JWG A;  1TO0 A;  1UAL A;  2EGV A;  3OII A;  4YQS A;  4JWH A;  4YQ8 A;  5CO4 A;  4YQA A;  1VH0 A;  3IC6 A;  2XDI A;  4YQG A;  2HA8 A;  4YQD A;  5GMC A;  4H3Y A;  5GMB A;  3SSW N;  3ILK A;  3FRW A;  4JWF A;  2OZ9 R;  4YPW A;  2YY8 A;  3BBD A;  1UAJ A;  4YQ0 A;  4X3L A;  4CNF A;  4MCD A;  3WRP A;  3QUV A;  3SSX N;  5GM8 A;  4YQC A;  4FMW A;  4YQ5 A;  4JAL A;  1UAK A;  1WRP R;  1K3R A;  1IPA A;  2QWV A;  1V2X A;  3N4K A;  3KTY A;  3KNU A;  4CNE A;  3KOR A;  1V6Z A;  2I6D A;  4XBO A;  4YPZ A;  4YQT A;  4YQN A;  3G1C A;  1TRO A;  1P9P A;  3KY7 A;  4YQ2 A;  3GYQ A;  4YQI A;  4YVJ A;  4MCC A;  4YQP A;  4YVG A;  1Z85 A;  4CNG A;  4X3M A;  4JAK A;  1GZ0 A;  3OIJ A;  4YQO A;  3AIA A;  3AXZ A;  4YQK A;  4YVK A;  4YQR A;  1CO0 A;  4YQB A;  4YQ1 A;  3BBH A;  5D9F A;  1MI7 R;  4YPX A;  4H3Z A;  4YQ7 A;  4E8B A;  4YQ9 A;  1VHK A;  1ZT9 A;  1JHG A;  3BBE A;  2Z0Y A;  4YQJ A;  4IG6 A;  3KW2 A; 
#chains in the Genus database with same CATH homology
 4RG1 A;  3N4J A;  3NK6 A;  1X7P A;  2V3K A;  4KGN A;  2EGW A;  1OY5 A;  4YQ6 A;  4PZK A;  3E5Y A;  1ZJR A;  4YQL A;  1UAM A;  3L8U A;  3IEF A;  3ONP A;  3AI9 X;  1O6D A;  2V3J A;  3O7B A;  4CND A;  2CX8 A;  2QMM A;  4MCB A;  4KDZ A;  4YQ3 A;  4YVH A;  4YVI A;  3NK7 A;  1VHY A;  4L69 A;  3OIN A;  4J3C A;  1NS5 A;  4YQ4 A;  1MXI A;  3DCM X;  4FAK A;  5FAI A;  2O3A A;  4JWJ A;  4YQQ A;  1NXZ A;  1X7O A;  4YPY A;  1J85 A;  4JWG A;  1TO0 A;  1UAL A;  2EGV A;  3OII A;  4YQS A;  4JWH A;  4YQ8 A;  5CO4 A;  4YQA A;  1VH0 A;  3IC6 A;  2HA8 A;  4YQG A;  4YQD A;  5GMC A;  4H3Y A;  5GMB A;  3ILK A;  4JWF A;  4YPW A;  2YY8 A;  3BBD A;  4X3L A;  1UAJ A;  4YQ0 A;  4CNF A;  4MCD A;  3QUV A;  5GM8 A;  4YQC A;  4FMW A;  4YQ5 A;  4JAL A;  1UAK A;  1K3R A;  1IPA A;  2QWV A;  1V2X A;  3N4K A;  3KTY A;  3KNU A;  4CNE A;  1V6Z A;  2I6D A;  4XBO A;  4YPZ A;  4YQT A;  4YQN A;  3GYQ A;  1P9P A;  3KY7 A;  4YQ2 A;  4YQI A;  4YVJ A;  4MCC A;  4YQP A;  4YVG A;  1Z85 A;  4CNG A;  4X3M A;  4JAK A;  1GZ0 A;  3OIJ A;  4YQO A;  3AIA A;  3AXZ A;  4YQK A;  4YVK A;  4YQR A;  4YQB A;  4YQ1 A;  3BBH A;  5D9F A;  4YPX A;  4H3Z A;  4YQ7 A;  4E8B A;  4YQ9 A;  1VHK A;  3BBE A;  2Z0Y A;  4YQJ A;  4IG6 A;  3KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...