4YQ4A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
249
structure length
242
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 242
sequence length 249
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq4A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq4A01
1V6ZA 4FAKA 3GYQA 2CX8A 3KY7A 1K3RA 3KTYA 4MCBA 4YQ5A 5FAIA 1VHYA 4YQ8A 4JAKA 4YQ6A 4L69A 3ONPA 5D9FA 4YVIA 1VH0A 4YQSA 4YQ3A 4YQ1A 4YQ4A 4YPZA 1O6DA 4YQNA 2I6DA 3ILKA 4YQ9A 5CO4A 4X3MA 1UAJA 3E5YA 2QWVA 2YY8A 4YQTA 3KW2A 4YQ2A 2QMMA 4CNEA 1TO0A 3OIIA 2HA8A 4RG1A 2V3KA 4H3ZA 4XBOA 3IEFA 4YQPA 4YQCA 1ZJRA 4CNDA 4YQOA 3KNUA 5GMCA 2Z0YA 1IPAA 3AXZA 3IC6A 4CNGA 4YQJA 3NK7A 3O7BA 1UALA 4KDZA 3BBEA 4KGNA 4H3YA 4YQIA 4J3CA 1X7PA 1OY5A 4YPWA 3BBHA 1P9PA 4YVHA 4YPXA 1UAKA 4JALA 4YQDA 1J85A 1NXZA 4YVKA 4YQBA 3N4KA 4YQ7A 3AI9X 1UAMA 4YQRA 1VHKA 3DCMX 1MXIA 4YQGA 3OIJA 4YPYA 4YVGA 4X3LA 2EGVA 4YQ0A 3OINA 2V3JA 4CNFA 4YVJA 4YQLA 1X7OA 3QUVA 3AIAA 1Z85A 4YQAA 5GM8A 5GMBA 4YQKA 2EGWA 4MCCA 4IG6A 4PZKA 3NK6A 1NS5A 4MCDA 4YQQA 3N4JA 1V2XA 1GZ0A 2O3AA 3BBDA 4E8BA 3L8UA
chains in the Genus database with same CATH superfamily
1V6ZA 4FAKA 3GYQA 2CX8A 3KY7A 1K3RA 1MI7R 3KTYA 4MCBA 4YQ5A 5FAIA 1VHYA 1WRTR 4YQ8A 4JAKA 4YQ6A 4L69A 3ONPA 5D9FA 4FMWA 4YVIA 1VH0A 4YQSA 4YQ3A 4YQ1A 4YQ4A 4YPZA 1O6DA 4YQNA 2I6DA 3ILKA 4YQ9A 3WRPA 5CO4A 4X3MA 1UAJA 3E5YA 2QWVA 1TRRA 2YY8A 4YQTA 3KW2A 2OZ9R 4YQ2A 2QMMA 4CNEA 1TO0A 3OIIA 2HA8A 4RG1A 2XDIA 4JWJA 2V3KA 4H3ZA 4XBOA 3IEFA 4YQPA 4YQCA 1ZJRA 4CNDA 4YQOA 3KNUA 5GMCA 2Z0YA 3FRWA 1IPAA 1RCSA 3AXZA 3IC6A 4JWFA 4CNGA 3G1CA 4YQJA 3NK7A 3O7BA 1UALA 4KDZA 3BBEA 4KGNA 4H3YA 4YQIA 4J3CA 1ZT9A 1X7PA 1OY5A 4YPWA 3BBHA 1P9PA 4YVHA 4YPXA 3SSXN 1UAKA 4JALA 1JHGA 4YQDA 1J85A 1NXZA 4YVKA 4YQBA 3N4KA 4YQ7A 1TROA 3AI9X 1UAMA 4YQRA 4JWGA 1VHKA 3DCMX 1MXIA 4YQGA 3OIJA 1CO0A 4YPYA 4YVGA 4X3LA 3SSWN 2EGVA 4YQ0A 3OINA 2V3JA 4CNFA 4YVJA 1WRPR 4YQLA 1X7OA 3QUVA 1WRSR 3AIAA 1Z85A 4YQAA 5GM8A 5GMBA 4YQKA 2EGWA 4MCCA 4IG6A 4PZKA 3NK6A 1NS5A 4MCDA 4YQQA 3N4JA 4JWHA 1V2XA 1GZ0A 2O3AA 3BBDA 4E8BA 3KORA 3L8UA
chains in the Genus database with same CATH topology
1V6ZA 4FAKA 3GYQA 2CX8A 3KY7A 1K3RA 3KTYA 4MCBA 4YQ5A 5FAIA 1VHYA 4YQ8A 4JAKA 4YQ6A 4L69A 3ONPA 5D9FA 4FMWA 4YVIA 1VH0A 4YQSA 4YQ3A 4YQ1A 4YQ4A 4YPZA 1O6DA 4YQNA 2I6DA 3ILKA 4YQ9A 5CO4A 4X3MA 1UAJA 3E5YA 2QWVA 2YY8A 4YQTA 3KW2A 4YQ2A 2QMMA 4CNEA 1TO0A 3OIIA 2HA8A 4RG1A 4JWJA 2V3KA 4H3ZA 4XBOA 3IEFA 4YQPA 4YQCA 1ZJRA 4CNDA 4YQOA 3KNUA 5GMCA 2Z0YA 1IPAA 3AXZA 3IC6A 4JWFA 4CNGA 4YQJA 3NK7A 3O7BA 1UALA 4KDZA 3BBEA 4KGNA 4H3YA 4YQIA 4J3CA 1X7PA 1OY5A 4YPWA 3BBHA 1P9PA 4YVHA 4YPXA 1UAKA 4JALA 4YQDA 1J85A 1NXZA 4YVKA 4YQBA 3N4KA 4YQ7A 3AI9X 1UAMA 4YQRA 4JWGA 1VHKA 3DCMX 1MXIA 4YQGA 3OIJA 4YPYA 4YVGA 4X3LA 2EGVA 4YQ0A 3OINA 2V3JA 4CNFA 4YVJA 4YQLA 1X7OA 3QUVA 3AIAA 1Z85A 4YQAA 5GM8A 5GMBA 4YQKA 2EGWA 4MCCA 4IG6A 4PZKA 3NK6A 1NS5A 4MCDA 4YQQA 3N4JA 4JWHA 1V2XA 1GZ0A 2O3AA 3BBDA 4E8BA 3L8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6Z A;  4FAK A;  3GYQ A;  2CX8 A;  3KY7 A;  1K3R A;  3KTY A;  4MCB A;  4YQ5 A;  5FAI A;  1VHY A;  4YQ8 A;  4JAK A;  4YQ6 A;  4L69 A;  3ONP A;  5D9F A;  4YVI A;  1VH0 A;  4YQS A;  4YQ3 A;  4YQ1 A;  4YQ4 A;  4YPZ A;  1O6D A;  4YQN A;  2I6D A;  3ILK A;  4YQ9 A;  5CO4 A;  4X3M A;  1UAJ A;  3E5Y A;  2QWV A;  2YY8 A;  4YQT A;  3KW2 A;  4YQ2 A;  2QMM A;  4CNE A;  1TO0 A;  3OII A;  2HA8 A;  4RG1 A;  2V3K A;  4H3Z A;  4XBO A;  3IEF A;  4YQP A;  4YQC A;  1ZJR A;  4CND A;  4YQO A;  3KNU A;  5GMC A;  2Z0Y A;  1IPA A;  3AXZ A;  3IC6 A;  4CNG A;  4YQJ A;  3NK7 A;  3O7B A;  1UAL A;  4KDZ A;  3BBE A;  4KGN A;  4H3Y A;  4YQI A;  4J3C A;  1X7P A;  1OY5 A;  4YPW A;  3BBH A;  1P9P A;  4YVH A;  4YPX A;  1UAK A;  4JAL A;  4YQD A;  1J85 A;  1NXZ A;  4YVK A;  4YQB A;  3N4K A;  4YQ7 A;  3AI9 X;  1UAM A;  4YQR A;  1VHK A;  3DCM X;  1MXI A;  4YQG A;  3OIJ A;  4YPY A;  4YVG A;  4X3L A;  2EGV A;  4YQ0 A;  3OIN A;  2V3J A;  4CNF A;  4YVJ A;  4YQL A;  1X7O A;  3QUV A;  3AIA A;  1Z85 A;  4YQA A;  5GM8 A;  5GMB A;  4YQK A;  2EGW A;  4MCC A;  4IG6 A;  4PZK A;  3NK6 A;  1NS5 A;  4MCD A;  4YQQ A;  3N4J A;  1V2X A;  1GZ0 A;  2O3A A;  3BBD A;  4E8B A;  3L8U A; 
#chains in the Genus database with same CATH topology
 1V6Z A;  4FAK A;  3GYQ A;  2CX8 A;  3KY7 A;  1K3R A;  1MI7 R;  3KTY A;  4MCB A;  4YQ5 A;  5FAI A;  1VHY A;  1WRT R;  4YQ8 A;  4JAK A;  4YQ6 A;  4L69 A;  3ONP A;  5D9F A;  4FMW A;  4YVI A;  1VH0 A;  4YQS A;  4YQ3 A;  4YQ1 A;  4YQ4 A;  4YPZ A;  1O6D A;  4YQN A;  2I6D A;  3ILK A;  4YQ9 A;  3WRP A;  5CO4 A;  4X3M A;  1UAJ A;  3E5Y A;  2QWV A;  1TRR A;  2YY8 A;  4YQT A;  3KW2 A;  2OZ9 R;  4YQ2 A;  2QMM A;  4CNE A;  1TO0 A;  3OII A;  2HA8 A;  4RG1 A;  2XDI A;  4JWJ A;  2V3K A;  4H3Z A;  4XBO A;  3IEF A;  4YQP A;  4YQC A;  1ZJR A;  4CND A;  4YQO A;  3KNU A;  5GMC A;  2Z0Y A;  3FRW A;  1IPA A;  1RCS A;  3AXZ A;  3IC6 A;  4JWF A;  4CNG A;  3G1C A;  4YQJ A;  3NK7 A;  3O7B A;  1UAL A;  4KDZ A;  3BBE A;  4KGN A;  4H3Y A;  4YQI A;  4J3C A;  1ZT9 A;  1X7P A;  1OY5 A;  4YPW A;  3BBH A;  1P9P A;  4YVH A;  4YPX A;  3SSX N;  1UAK A;  4JAL A;  1JHG A;  4YQD A;  1J85 A;  1NXZ A;  4YVK A;  4YQB A;  3N4K A;  4YQ7 A;  1TRO A;  3AI9 X;  1UAM A;  4YQR A;  4JWG A;  1VHK A;  3DCM X;  1MXI A;  4YQG A;  3OIJ A;  1CO0 A;  4YPY A;  4YVG A;  4X3L A;  3SSW N;  2EGV A;  4YQ0 A;  3OIN A;  2V3J A;  4CNF A;  4YVJ A;  1WRP R;  4YQL A;  1X7O A;  3QUV A;  1WRS R;  3AIA A;  1Z85 A;  4YQA A;  5GM8 A;  5GMB A;  4YQK A;  2EGW A;  4MCC A;  4IG6 A;  4PZK A;  3NK6 A;  1NS5 A;  4MCD A;  4YQQ A;  3N4J A;  4JWH A;  1V2X A;  1GZ0 A;  2O3A A;  3BBD A;  4E8B A;  3KOR A;  3L8U A; 
#chains in the Genus database with same CATH homology
 1V6Z A;  4FAK A;  3GYQ A;  2CX8 A;  3KY7 A;  1K3R A;  3KTY A;  4MCB A;  4YQ5 A;  5FAI A;  1VHY A;  4YQ8 A;  4JAK A;  4YQ6 A;  4L69 A;  3ONP A;  5D9F A;  4FMW A;  4YVI A;  1VH0 A;  4YQS A;  4YQ3 A;  4YQ1 A;  4YQ4 A;  4YPZ A;  1O6D A;  4YQN A;  2I6D A;  3ILK A;  4YQ9 A;  5CO4 A;  4X3M A;  1UAJ A;  3E5Y A;  2QWV A;  2YY8 A;  4YQT A;  3KW2 A;  4YQ2 A;  2QMM A;  4CNE A;  1TO0 A;  3OII A;  2HA8 A;  4RG1 A;  4JWJ A;  2V3K A;  4H3Z A;  4XBO A;  3IEF A;  4YQP A;  4YQC A;  1ZJR A;  4CND A;  4YQO A;  3KNU A;  5GMC A;  2Z0Y A;  1IPA A;  3AXZ A;  3IC6 A;  4JWF A;  4CNG A;  4YQJ A;  3NK7 A;  3O7B A;  1UAL A;  4KDZ A;  3BBE A;  4KGN A;  4H3Y A;  4YQI A;  4J3C A;  1X7P A;  1OY5 A;  4YPW A;  3BBH A;  1P9P A;  4YVH A;  4YPX A;  1UAK A;  4JAL A;  4YQD A;  1J85 A;  1NXZ A;  4YVK A;  4YQB A;  3N4K A;  4YQ7 A;  3AI9 X;  1UAM A;  4YQR A;  4JWG A;  1VHK A;  3DCM X;  1MXI A;  4YQG A;  3OIJ A;  4YPY A;  4YVG A;  4X3L A;  2EGV A;  4YQ0 A;  3OIN A;  2V3J A;  4CNF A;  4YVJ A;  4YQL A;  1X7O A;  3QUV A;  3AIA A;  1Z85 A;  4YQA A;  5GM8 A;  5GMB A;  4YQK A;  2EGW A;  4MCC A;  4IG6 A;  4PZK A;  3NK6 A;  1NS5 A;  4MCD A;  4YQQ A;  3N4J A;  4JWH A;  1V2X A;  1GZ0 A;  2O3A A;  3BBD A;  4E8B A;  3L8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...