4YQPA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
248
structure length
237
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 66
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqpA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqpA01
4X3LA 4CNFA 1O6DA 4PZKA 2HA8A 4YQ9A 2V3KA 4KGNA 4YQ4A 4KDZA 5GMBA 4YVJA 4YQNA 4YPWA 3NK6A 4H3YA 4YQAA 4YPYA 4YPXA 3E5YA 4YVIA 3KNUA 1V6ZA 4L69A 4YQ2A 3GYQA 3OINA 3ONPA 4X3MA 3AIAA 3BBEA 4IG6A 4YQ7A 3O7BA 4JAKA 4JALA 3IC6A 4YQIA 1J85A 4YQLA 4CNDA 1UALA 1IPAA 2EGWA 2Z0YA 1X7OA 4YQBA 4MCBA 1VH0A 4YQ0A 4MCCA 4YQ5A 4CNEA 4YQQA 4YQ1A 1GZ0A 4YQCA 1V2XA 3KW2A 3L8UA 2CX8A 1P9PA 3OIJA 1UAJA 4YVHA 2QWVA 3DCMX 1UAMA 1VHKA 4YQTA 3NK7A 4YQPA 4YQGA 5D9FA 2QMMA 2O3AA 1OY5A 4YQ6A 1TO0A 5GMCA 3OIIA 3AXZA 2V3JA 4YQ3A 2EGVA 4YQRA 4YQSA 2I6DA 3KY7A 3ILKA 4J3CA 4CNGA 1UAKA 4YPZA 4YQKA 1NXZA 1MXIA 4E8BA 4YQJA 4YVGA 1NS5A 4YQOA 4FAKA 3N4JA 4RG1A 3AI9X 3KTYA 4MCDA 2YY8A 1ZJRA 3IEFA 1VHYA 4XBOA 5FAIA 5GM8A 3BBDA 5CO4A 4YVKA 4YQ8A 1Z85A 3QUVA 4H3ZA 3BBHA 4YQDA 3N4KA 1K3RA 1X7PA
chains in the Genus database with same CATH superfamily
4X3LA 3WRPA 4CNFA 1O6DA 4PZKA 1CO0A 1WRTR 3SSWN 2HA8A 3KORA 4YQ9A 2V3KA 4KGNA 4FMWA 4YQ4A 4KDZA 5GMBA 4YVJA 4YQNA 4YPWA 3NK6A 4H3YA 4YQAA 4YPYA 4YPXA 3E5YA 1MI7R 4YVIA 3KNUA 1V6ZA 4L69A 4YQ2A 1TROA 3GYQA 3OINA 3ONPA 1ZT9A 4X3MA 3AIAA 4JWJA 3BBEA 4IG6A 4YQ7A 2XDIA 4JWHA 3O7BA 4JAKA 4JALA 3IC6A 4YQIA 1J85A 1WRSR 1WRPR 4YQLA 1UALA 1IPAA 4CNDA 2EGWA 2Z0YA 1X7OA 4YQBA 4MCBA 1VH0A 4YQ0A 4MCCA 4YQ5A 4CNEA 4YQQA 4YQ1A 1GZ0A 4YQCA 1V2XA 3KW2A 3L8UA 2CX8A 1P9PA 3OIJA 1UAJA 4YVHA 4JWFA 2QWVA 3DCMX 1UAMA 3G1CA 1VHKA 4YQTA 3SSXN 3NK7A 4YQPA 4YQGA 1RCSA 5D9FA 2QMMA 2O3AA 1OY5A 4YQ6A 1TO0A 5GMCA 3OIIA 1JHGA 3AXZA 2V3JA 4YQ3A 2EGVA 4YQRA 4YQSA 2I6DA 3KY7A 3ILKA 4J3CA 4CNGA 1UAKA 4YPZA 4YQKA 4JWGA 1NXZA 1MXIA 4E8BA 4YQJA 4YVGA 2OZ9R 1NS5A 4YQOA 4FAKA 3FRWA 3N4JA 4RG1A 3AI9X 3KTYA 4MCDA 2YY8A 1ZJRA 3IEFA 1VHYA 4XBOA 5FAIA 5GM8A 3BBDA 5CO4A 4YVKA 4YQ8A 1Z85A 3QUVA 4H3ZA 3BBHA 4YQDA 1TRRA 3N4KA 1K3RA 1X7PA
chains in the Genus database with same CATH topology
4X3LA 4CNFA 1O6DA 4PZKA 2HA8A 4YQ9A 2V3KA 4KGNA 4FMWA 4YQ4A 4KDZA 5GMBA 4YVJA 4YQNA 4YPWA 3NK6A 4H3YA 4YQAA 4YPYA 4YPXA 3E5YA 4YVIA 3KNUA 1V6ZA 4L69A 4YQ2A 3GYQA 3OINA 3ONPA 4X3MA 3AIAA 4JWJA 3BBEA 4IG6A 4YQ7A 4JWHA 3O7BA 4JAKA 4JALA 3IC6A 4YQIA 1J85A 4YQLA 4CNDA 1UALA 1IPAA 2EGWA 2Z0YA 1X7OA 4YQBA 4MCBA 1VH0A 4YQ0A 4MCCA 4YQ5A 4CNEA 4YQQA 4YQ1A 1GZ0A 4YQCA 1V2XA 3KW2A 3L8UA 2CX8A 1P9PA 3OIJA 1UAJA 4YVHA 4JWFA 2QWVA 3DCMX 1UAMA 1VHKA 4YQTA 3NK7A 4YQPA 4YQGA 5D9FA 2QMMA 2O3AA 1OY5A 4YQ6A 1TO0A 5GMCA 3OIIA 3AXZA 2V3JA 4YQ3A 2EGVA 4YQRA 4YQSA 2I6DA 3KY7A 3ILKA 4J3CA 4CNGA 1UAKA 4YPZA 4YQKA 4JWGA 1NXZA 1MXIA 4E8BA 4YQJA 4YVGA 1NS5A 4YQOA 4FAKA 3N4JA 4RG1A 3AI9X 3KTYA 4MCDA 2YY8A 1ZJRA 3IEFA 1VHYA 4XBOA 5FAIA 5GM8A 3BBDA 5CO4A 4YVKA 4YQ8A 1Z85A 3QUVA 4H3ZA 3BBHA 4YQDA 3N4KA 1K3RA 1X7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3L A;  4CNF A;  1O6D A;  4PZK A;  2HA8 A;  4YQ9 A;  2V3K A;  4KGN A;  4YQ4 A;  4KDZ A;  5GMB A;  4YVJ A;  4YQN A;  4YPW A;  3NK6 A;  4H3Y A;  4YQA A;  4YPY A;  4YPX A;  3E5Y A;  4YVI A;  3KNU A;  1V6Z A;  4L69 A;  4YQ2 A;  3GYQ A;  3OIN A;  3ONP A;  4X3M A;  3AIA A;  3BBE A;  4IG6 A;  4YQ7 A;  3O7B A;  4JAK A;  4JAL A;  3IC6 A;  4YQI A;  1J85 A;  4YQL A;  4CND A;  1UAL A;  1IPA A;  2EGW A;  2Z0Y A;  1X7O A;  4YQB A;  4MCB A;  1VH0 A;  4YQ0 A;  4MCC A;  4YQ5 A;  4CNE A;  4YQQ A;  4YQ1 A;  1GZ0 A;  4YQC A;  1V2X A;  3KW2 A;  3L8U A;  2CX8 A;  1P9P A;  3OIJ A;  1UAJ A;  4YVH A;  2QWV A;  3DCM X;  1UAM A;  1VHK A;  4YQT A;  3NK7 A;  4YQP A;  4YQG A;  5D9F A;  2QMM A;  2O3A A;  1OY5 A;  4YQ6 A;  1TO0 A;  5GMC A;  3OII A;  3AXZ A;  2V3J A;  4YQ3 A;  2EGV A;  4YQR A;  4YQS A;  2I6D A;  3KY7 A;  3ILK A;  4J3C A;  4CNG A;  1UAK A;  4YPZ A;  4YQK A;  1NXZ A;  1MXI A;  4E8B A;  4YQJ A;  4YVG A;  1NS5 A;  4YQO A;  4FAK A;  3N4J A;  4RG1 A;  3AI9 X;  3KTY A;  4MCD A;  2YY8 A;  1ZJR A;  3IEF A;  1VHY A;  4XBO A;  5FAI A;  5GM8 A;  3BBD A;  5CO4 A;  4YVK A;  4YQ8 A;  1Z85 A;  3QUV A;  4H3Z A;  3BBH A;  4YQD A;  3N4K A;  1K3R A;  1X7P A; 
#chains in the Genus database with same CATH topology
 4X3L A;  3WRP A;  4CNF A;  1O6D A;  4PZK A;  1CO0 A;  1WRT R;  3SSW N;  2HA8 A;  3KOR A;  4YQ9 A;  2V3K A;  4KGN A;  4FMW A;  4YQ4 A;  4KDZ A;  5GMB A;  4YVJ A;  4YQN A;  4YPW A;  3NK6 A;  4H3Y A;  4YQA A;  4YPY A;  4YPX A;  3E5Y A;  1MI7 R;  4YVI A;  3KNU A;  1V6Z A;  4L69 A;  4YQ2 A;  1TRO A;  3GYQ A;  3OIN A;  3ONP A;  1ZT9 A;  4X3M A;  3AIA A;  4JWJ A;  3BBE A;  4IG6 A;  4YQ7 A;  2XDI A;  4JWH A;  3O7B A;  4JAK A;  4JAL A;  3IC6 A;  4YQI A;  1J85 A;  1WRS R;  1WRP R;  4YQL A;  1UAL A;  1IPA A;  4CND A;  2EGW A;  2Z0Y A;  1X7O A;  4YQB A;  4MCB A;  1VH0 A;  4YQ0 A;  4MCC A;  4YQ5 A;  4CNE A;  4YQQ A;  4YQ1 A;  1GZ0 A;  4YQC A;  1V2X A;  3KW2 A;  3L8U A;  2CX8 A;  1P9P A;  3OIJ A;  1UAJ A;  4YVH A;  4JWF A;  2QWV A;  3DCM X;  1UAM A;  3G1C A;  1VHK A;  4YQT A;  3SSX N;  3NK7 A;  4YQP A;  4YQG A;  1RCS A;  5D9F A;  2QMM A;  2O3A A;  1OY5 A;  4YQ6 A;  1TO0 A;  5GMC A;  3OII A;  1JHG A;  3AXZ A;  2V3J A;  4YQ3 A;  2EGV A;  4YQR A;  4YQS A;  2I6D A;  3KY7 A;  3ILK A;  4J3C A;  4CNG A;  1UAK A;  4YPZ A;  4YQK A;  4JWG A;  1NXZ A;  1MXI A;  4E8B A;  4YQJ A;  4YVG A;  2OZ9 R;  1NS5 A;  4YQO A;  4FAK A;  3FRW A;  3N4J A;  4RG1 A;  3AI9 X;  3KTY A;  4MCD A;  2YY8 A;  1ZJR A;  3IEF A;  1VHY A;  4XBO A;  5FAI A;  5GM8 A;  3BBD A;  5CO4 A;  4YVK A;  4YQ8 A;  1Z85 A;  3QUV A;  4H3Z A;  3BBH A;  4YQD A;  1TRR A;  3N4K A;  1K3R A;  1X7P A; 
#chains in the Genus database with same CATH homology
 4X3L A;  4CNF A;  1O6D A;  4PZK A;  2HA8 A;  4YQ9 A;  2V3K A;  4KGN A;  4FMW A;  4YQ4 A;  4KDZ A;  5GMB A;  4YVJ A;  4YQN A;  4YPW A;  3NK6 A;  4H3Y A;  4YQA A;  4YPY A;  4YPX A;  3E5Y A;  4YVI A;  3KNU A;  1V6Z A;  4L69 A;  4YQ2 A;  3GYQ A;  3OIN A;  3ONP A;  4X3M A;  3AIA A;  4JWJ A;  3BBE A;  4IG6 A;  4YQ7 A;  4JWH A;  3O7B A;  4JAK A;  4JAL A;  3IC6 A;  4YQI A;  1J85 A;  4YQL A;  4CND A;  1UAL A;  1IPA A;  2EGW A;  2Z0Y A;  1X7O A;  4YQB A;  4MCB A;  1VH0 A;  4YQ0 A;  4MCC A;  4YQ5 A;  4CNE A;  4YQQ A;  4YQ1 A;  1GZ0 A;  4YQC A;  1V2X A;  3KW2 A;  3L8U A;  2CX8 A;  1P9P A;  3OIJ A;  1UAJ A;  4YVH A;  4JWF A;  2QWV A;  3DCM X;  1UAM A;  1VHK A;  4YQT A;  3NK7 A;  4YQP A;  4YQG A;  5D9F A;  2QMM A;  2O3A A;  1OY5 A;  4YQ6 A;  1TO0 A;  5GMC A;  3OII A;  3AXZ A;  2V3J A;  4YQ3 A;  2EGV A;  4YQR A;  4YQS A;  2I6D A;  3KY7 A;  3ILK A;  4J3C A;  4CNG A;  1UAK A;  4YPZ A;  4YQK A;  4JWG A;  1NXZ A;  1MXI A;  4E8B A;  4YQJ A;  4YVG A;  1NS5 A;  4YQO A;  4FAK A;  3N4J A;  4RG1 A;  3AI9 X;  3KTY A;  4MCD A;  2YY8 A;  1ZJR A;  3IEF A;  1VHY A;  4XBO A;  5FAI A;  5GM8 A;  3BBD A;  5CO4 A;  4YVK A;  4YQ8 A;  1Z85 A;  3QUV A;  4H3Z A;  3BBH A;  4YQD A;  3N4K A;  1K3R A;  1X7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...