4YQPA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
248
structure length
237
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 66
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqpA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqpA01
2YY8A 2V3KA 5D9FA 4J3CA 4YQDA 4YQGA 1VH0A 3NK7A 1MXIA 3BBHA 3O7BA 4YQIA 4CNEA 3DCMX 4YQSA 4JAKA 2QWVA 3KTYA 4YQ2A 4X3LA 5GMCA 4YVKA 3GYQA 4PZKA 1OY5A 4MCCA 4YVJA 1NS5A 5GM8A 4YQRA 4RG1A 4YQTA 4YQNA 4XBOA 4H3YA 3NK6A 4IG6A 1GZ0A 3KY7A 1O6DA 5GMBA 3OIJA 4YQ3A 4YPYA 4YQPA 4CNDA 3OINA 3AI9X 1UAKA 1TO0A 1P9PA 4YPZA 3BBDA 4E8BA 4YQ8A 4YQCA 3IC6A 4CNFA 5FAIA 3AXZA 1UALA 4YQ1A 1V6ZA 3QUVA 4FAKA 3KNUA 4YQ9A 4YVGA 3AIAA 2O3AA 2CX8A 3KW2A 3L8UA 4CNGA 1VHYA 4YPXA 1X7OA 4YQ0A 4YQ4A 4YQAA 3ILKA 1K3RA 4YQQA 4X3MA 1UAJA 4YQ7A 4L69A 2V3JA 4YQLA 3ONPA 4YPWA 4YQ6A 4YVIA 1NXZA 4YVHA 2QMMA 3IEFA 4KDZA 2I6DA 3N4KA 3N4JA 4YQ5A 4JALA 4MCBA 4YQJA 1VHKA 1Z85A 3BBEA 4KGNA 1ZJRA 4H3ZA 2EGVA 1V2XA 1UAMA 4YQBA 5CO4A 4YQOA 4MCDA 2HA8A 1J85A 3E5YA 3OIIA 1X7PA 1IPAA 2Z0YA 2EGWA 4YQKA
chains in the Genus database with same CATH superfamily
2YY8A 2V3KA 5D9FA 4J3CA 4YQDA 4YQGA 1VH0A 3NK7A 1MXIA 3BBHA 3O7BA 4YQIA 4CNEA 3DCMX 4YQSA 4JAKA 2QWVA 1WRTR 4YQ2A 3KTYA 4X3LA 5GMCA 4YVKA 3GYQA 4PZKA 1OY5A 4MCCA 1TROA 4YVJA 1NS5A 5GM8A 4YQRA 4RG1A 4YQTA 4YQNA 4XBOA 1ZT9A 4H3YA 3NK6A 4IG6A 1GZ0A 3KY7A 1O6DA 5GMBA 3OIJA 4YQ3A 4YPYA 3G1CA 4YQPA 4CNDA 3OINA 2XDIA 1MI7R 3AI9X 1UAKA 1TO0A 1P9PA 4YPZA 3BBDA 4E8BA 1TRRA 1WRPR 4YQ8A 4YQCA 3IC6A 4CNFA 5FAIA 2OZ9R 3AXZA 1UALA 4YQ1A 3QUVA 1V6ZA 4FAKA 3KORA 3KNUA 4YQ9A 4JWGA 4YVGA 4JWJA 1JHGA 3AIAA 2O3AA 4JWHA 2CX8A 3KW2A 3L8UA 4CNGA 1VHYA 4YPXA 1X7OA 4YQ0A 4YQ4A 4YQAA 3ILKA 1K3RA 4YQQA 4X3MA 1UAJA 4YQ7A 4L69A 2V3JA 4FMWA 4YQLA 3WRPA 3ONPA 4YPWA 4YQ6A 4YVIA 1NXZA 1WRSR 4YVHA 1CO0A 2QMMA 3IEFA 4KDZA 2I6DA 3N4KA 3N4JA 3SSWN 4YQ5A 4JALA 4MCBA 4YQJA 1VHKA 1Z85A 3BBEA 4KGNA 1ZJRA 4H3ZA 2EGVA 1V2XA 1UAMA 4YQBA 4YQKA 4YQOA 4MCDA 5CO4A 2HA8A 1J85A 3E5YA 3OIIA 1X7PA 4JWFA 1IPAA 1RCSA 3FRWA 2Z0YA 2EGWA 3SSXN
chains in the Genus database with same CATH topology
2YY8A 2V3KA 5D9FA 4J3CA 4YQDA 4YQGA 1VH0A 3NK7A 1MXIA 3BBHA 3O7BA 4YQIA 4CNEA 3DCMX 4YQSA 4JAKA 2QWVA 3KTYA 4YQ2A 4X3LA 5GMCA 4YVKA 3GYQA 4PZKA 1OY5A 4MCCA 4YVJA 1NS5A 5GM8A 4YQRA 4RG1A 4YQTA 4YQNA 4XBOA 4H3YA 3NK6A 4IG6A 1GZ0A 3KY7A 1O6DA 5GMBA 3OIJA 4YQ3A 4YPYA 4YQPA 4CNDA 3OINA 3AI9X 1UAKA 1TO0A 1P9PA 4YPZA 3BBDA 4E8BA 4YQ8A 4YQCA 3IC6A 4CNFA 5FAIA 3AXZA 1UALA 4YQ1A 1V6ZA 3QUVA 4FAKA 3KNUA 4YQ9A 4JWGA 4YVGA 4JWJA 3AIAA 2O3AA 4JWHA 2CX8A 3KW2A 3L8UA 4CNGA 1VHYA 4YPXA 1X7OA 4YQ0A 4YQ4A 4YQAA 3ILKA 1K3RA 4YQQA 4X3MA 1UAJA 4YQ7A 4L69A 2V3JA 4FMWA 4YQLA 3ONPA 4YPWA 4YQ6A 4YVIA 1NXZA 4YVHA 2QMMA 3IEFA 4KDZA 2I6DA 3N4KA 3N4JA 4YQ5A 4JALA 4MCBA 4YQJA 1VHKA 1Z85A 3BBEA 4KGNA 1ZJRA 4H3ZA 2EGVA 1V2XA 1UAMA 4YQBA 5CO4A 4YQOA 4MCDA 2HA8A 1J85A 3E5YA 3OIIA 1X7PA 4JWFA 1IPAA 2Z0YA 2EGWA 4YQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YY8 A;  2V3K A;  5D9F A;  4J3C A;  4YQD A;  4YQG A;  1VH0 A;  3NK7 A;  1MXI A;  3BBH A;  3O7B A;  4YQI A;  4CNE A;  3DCM X;  4YQS A;  4JAK A;  2QWV A;  3KTY A;  4YQ2 A;  4X3L A;  5GMC A;  4YVK A;  3GYQ A;  4PZK A;  1OY5 A;  4MCC A;  4YVJ A;  1NS5 A;  5GM8 A;  4YQR A;  4RG1 A;  4YQT A;  4YQN A;  4XBO A;  4H3Y A;  3NK6 A;  4IG6 A;  1GZ0 A;  3KY7 A;  1O6D A;  5GMB A;  3OIJ A;  4YQ3 A;  4YPY A;  4YQP A;  4CND A;  3OIN A;  3AI9 X;  1UAK A;  1TO0 A;  1P9P A;  4YPZ A;  3BBD A;  4E8B A;  4YQ8 A;  4YQC A;  3IC6 A;  4CNF A;  5FAI A;  3AXZ A;  1UAL A;  4YQ1 A;  1V6Z A;  3QUV A;  4FAK A;  3KNU A;  4YQ9 A;  4YVG A;  3AIA A;  2O3A A;  2CX8 A;  3KW2 A;  3L8U A;  4CNG A;  1VHY A;  4YPX A;  1X7O A;  4YQ0 A;  4YQ4 A;  4YQA A;  3ILK A;  1K3R A;  4YQQ A;  4X3M A;  1UAJ A;  4YQ7 A;  4L69 A;  2V3J A;  4YQL A;  3ONP A;  4YPW A;  4YQ6 A;  4YVI A;  1NXZ A;  4YVH A;  2QMM A;  3IEF A;  4KDZ A;  2I6D A;  3N4K A;  3N4J A;  4YQ5 A;  4JAL A;  4MCB A;  4YQJ A;  1VHK A;  1Z85 A;  3BBE A;  4KGN A;  1ZJR A;  4H3Z A;  2EGV A;  1V2X A;  1UAM A;  4YQB A;  5CO4 A;  4YQO A;  4MCD A;  2HA8 A;  1J85 A;  3E5Y A;  3OII A;  1X7P A;  1IPA A;  2Z0Y A;  2EGW A;  4YQK A; 
#chains in the Genus database with same CATH topology
 2YY8 A;  2V3K A;  5D9F A;  4J3C A;  4YQD A;  4YQG A;  1VH0 A;  3NK7 A;  1MXI A;  3BBH A;  3O7B A;  4YQI A;  4CNE A;  3DCM X;  4YQS A;  4JAK A;  2QWV A;  1WRT R;  4YQ2 A;  3KTY A;  4X3L A;  5GMC A;  4YVK A;  3GYQ A;  4PZK A;  1OY5 A;  4MCC A;  1TRO A;  4YVJ A;  1NS5 A;  5GM8 A;  4YQR A;  4RG1 A;  4YQT A;  4YQN A;  4XBO A;  1ZT9 A;  4H3Y A;  3NK6 A;  4IG6 A;  1GZ0 A;  3KY7 A;  1O6D A;  5GMB A;  3OIJ A;  4YQ3 A;  4YPY A;  3G1C A;  4YQP A;  4CND A;  3OIN A;  2XDI A;  1MI7 R;  3AI9 X;  1UAK A;  1TO0 A;  1P9P A;  4YPZ A;  3BBD A;  4E8B A;  1TRR A;  1WRP R;  4YQ8 A;  4YQC A;  3IC6 A;  4CNF A;  5FAI A;  2OZ9 R;  3AXZ A;  1UAL A;  4YQ1 A;  3QUV A;  1V6Z A;  4FAK A;  3KOR A;  3KNU A;  4YQ9 A;  4JWG A;  4YVG A;  4JWJ A;  1JHG A;  3AIA A;  2O3A A;  4JWH A;  2CX8 A;  3KW2 A;  3L8U A;  4CNG A;  1VHY A;  4YPX A;  1X7O A;  4YQ0 A;  4YQ4 A;  4YQA A;  3ILK A;  1K3R A;  4YQQ A;  4X3M A;  1UAJ A;  4YQ7 A;  4L69 A;  2V3J A;  4FMW A;  4YQL A;  3WRP A;  3ONP A;  4YPW A;  4YQ6 A;  4YVI A;  1NXZ A;  1WRS R;  4YVH A;  1CO0 A;  2QMM A;  3IEF A;  4KDZ A;  2I6D A;  3N4K A;  3N4J A;  3SSW N;  4YQ5 A;  4JAL A;  4MCB A;  4YQJ A;  1VHK A;  1Z85 A;  3BBE A;  4KGN A;  1ZJR A;  4H3Z A;  2EGV A;  1V2X A;  1UAM A;  4YQB A;  4YQK A;  4YQO A;  4MCD A;  5CO4 A;  2HA8 A;  1J85 A;  3E5Y A;  3OII A;  1X7P A;  4JWF A;  1IPA A;  1RCS A;  3FRW A;  2Z0Y A;  2EGW A;  3SSX N; 
#chains in the Genus database with same CATH homology
 2YY8 A;  2V3K A;  5D9F A;  4J3C A;  4YQD A;  4YQG A;  1VH0 A;  3NK7 A;  1MXI A;  3BBH A;  3O7B A;  4YQI A;  4CNE A;  3DCM X;  4YQS A;  4JAK A;  2QWV A;  3KTY A;  4YQ2 A;  4X3L A;  5GMC A;  4YVK A;  3GYQ A;  4PZK A;  1OY5 A;  4MCC A;  4YVJ A;  1NS5 A;  5GM8 A;  4YQR A;  4RG1 A;  4YQT A;  4YQN A;  4XBO A;  4H3Y A;  3NK6 A;  4IG6 A;  1GZ0 A;  3KY7 A;  1O6D A;  5GMB A;  3OIJ A;  4YQ3 A;  4YPY A;  4YQP A;  4CND A;  3OIN A;  3AI9 X;  1UAK A;  1TO0 A;  1P9P A;  4YPZ A;  3BBD A;  4E8B A;  4YQ8 A;  4YQC A;  3IC6 A;  4CNF A;  5FAI A;  3AXZ A;  1UAL A;  4YQ1 A;  1V6Z A;  3QUV A;  4FAK A;  3KNU A;  4YQ9 A;  4JWG A;  4YVG A;  4JWJ A;  3AIA A;  2O3A A;  4JWH A;  2CX8 A;  3KW2 A;  3L8U A;  4CNG A;  1VHY A;  4YPX A;  1X7O A;  4YQ0 A;  4YQ4 A;  4YQA A;  3ILK A;  1K3R A;  4YQQ A;  4X3M A;  1UAJ A;  4YQ7 A;  4L69 A;  2V3J A;  4FMW A;  4YQL A;  3ONP A;  4YPW A;  4YQ6 A;  4YVI A;  1NXZ A;  4YVH A;  2QMM A;  3IEF A;  4KDZ A;  2I6D A;  3N4K A;  3N4J A;  4YQ5 A;  4JAL A;  4MCB A;  4YQJ A;  1VHK A;  1Z85 A;  3BBE A;  4KGN A;  1ZJR A;  4H3Z A;  2EGV A;  1V2X A;  1UAM A;  4YQB A;  5CO4 A;  4YQO A;  4MCD A;  2HA8 A;  1J85 A;  3E5Y A;  3OII A;  1X7P A;  4JWF A;  1IPA A;  2Z0Y A;  2EGW A;  4YQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...