4YQGA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
237
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 71
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqgA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqgA01
3DCMX 1V6ZA 3KY7A 3N4KA 2Z0YA 4J3CA 1NS5A 1X7OA 4JALA 1V2XA 3ONPA 1ZJRA 4KGNA 4X3LA 1UAJA 3OIIA 4YQSA 3KNUA 1OY5A 3IC6A 4CNFA 4YQ4A 2EGWA 4YVKA 2V3KA 4CNGA 1GZ0A 4YQKA 4YQQA 2HA8A 1VHYA 3L8UA 4JAKA 4MCCA 3QUVA 4YVIA 3KW2A 4YQRA 4H3YA 2QWVA 4YVGA 3OIJA 4PZKA 3OINA 1MXIA 3AXZA 1UAMA 4YQTA 4CNDA 1VHKA 3E5YA 4MCDA 4RG1A 1VH0A 5D9FA 1IPAA 3BBEA 3NK7A 2I6DA 4E8BA 5GMCA 3IEFA 4FAKA 4YQOA 4YQ3A 4YQAA 4L69A 1O6DA 3BBDA 4YPYA 4YQ8A 4MCBA 4YVHA 4YQPA 2CX8A 2EGVA 4YQ7A 3KTYA 3N4JA 4CNEA 5GMBA 4YQLA 4X3MA 1K3RA 4YPXA 2YY8A 5CO4A 4YPZA 4YQ6A 4YQJA 3ILKA 5GM8A 3AIAA 4YQ1A 4YQ9A 4KDZA 3AI9X 4XBOA 4YQCA 2O3AA 4YQNA 4YQDA 4YQIA 1NXZA 3BBHA 4YQBA 3GYQA 1X7PA 3O7BA 1TO0A 5FAIA 4YQ2A 4YPWA 2V3JA 1J85A 4H3ZA 4YQ0A 2QMMA 1Z85A 1UAKA 4IG6A 1P9PA 4YQ5A 1UALA 4YVJA 3NK6A 4YQGA
chains in the Genus database with same CATH superfamily
3DCMX 1V6ZA 3KY7A 1WRPR 3N4KA 3KORA 2Z0YA 4J3CA 1NS5A 1X7OA 4JALA 1V2XA 3ONPA 1RCSA 1ZJRA 4KGNA 4X3LA 3SSXN 1UAJA 3OIIA 1TROA 3FRWA 4YQSA 3KNUA 1OY5A 3IC6A 4CNFA 4YQ4A 2EGWA 4YVKA 2V3KA 4CNGA 1GZ0A 4YQKA 4YQQA 2HA8A 1VHYA 4JWGA 3SSWN 3L8UA 4JAKA 4MCCA 3QUVA 1MI7R 4YVIA 3KW2A 4YQRA 4H3YA 2QWVA 4YVGA 3OIJA 4PZKA 3OINA 1MXIA 3AXZA 1UAMA 4YQTA 4CNDA 1TRRA 1VHKA 3E5YA 4MCDA 4RG1A 1CO0A 1VH0A 5D9FA 1IPAA 3BBEA 3NK7A 2I6DA 4FMWA 4E8BA 1ZT9A 5GMCA 3IEFA 4FAKA 4YQOA 4YQ3A 4YQAA 4L69A 1O6DA 3BBDA 4YPYA 4JWFA 4YQ8A 1WRTR 2XDIA 4MCBA 2OZ9R 4YVHA 4YQPA 2CX8A 2EGVA 4YQ7A 3KTYA 1JHGA 3N4JA 4CNEA 5GMBA 4YQLA 4X3MA 1K3RA 4YPXA 2YY8A 5CO4A 4YPZA 4YQ6A 4YQJA 3ILKA 5GM8A 3AIAA 4YQ1A 4YQ9A 4KDZA 3AI9X 4XBOA 4YQCA 3WRPA 2O3AA 4YQNA 4YQDA 4YQIA 1NXZA 4JWHA 3BBHA 4YQBA 3GYQA 1X7PA 3O7BA 1TO0A 5FAIA 4YQ2A 4YPWA 2V3JA 1J85A 4H3ZA 4YQ0A 2QMMA 1Z85A 1UAKA 4IG6A 1P9PA 4JWJA 4YQ5A 1UALA 4YVJA 1WRSR 3NK6A 3G1CA 4YQGA
chains in the Genus database with same CATH topology
3DCMX 1V6ZA 3KY7A 3N4KA 2Z0YA 4J3CA 1NS5A 1X7OA 4JALA 1V2XA 3ONPA 1ZJRA 4KGNA 4X3LA 1UAJA 3OIIA 4YQSA 3KNUA 1OY5A 3IC6A 4CNFA 4YQ4A 2EGWA 4YVKA 2V3KA 4CNGA 1GZ0A 4YQKA 4YQQA 2HA8A 1VHYA 4JWGA 3L8UA 4JAKA 4MCCA 3QUVA 4YVIA 3KW2A 4YQRA 4H3YA 2QWVA 4YVGA 3OIJA 4PZKA 3OINA 1MXIA 3AXZA 1UAMA 4YQTA 4CNDA 1VHKA 3E5YA 4MCDA 4RG1A 1VH0A 5D9FA 1IPAA 3BBEA 3NK7A 2I6DA 4FMWA 4E8BA 5GMCA 3IEFA 4FAKA 4YQOA 4YQ3A 4YQAA 4L69A 1O6DA 3BBDA 4YPYA 4JWFA 4YQ8A 4MCBA 4YVHA 4YQPA 2CX8A 2EGVA 4YQ7A 3KTYA 3N4JA 4CNEA 5GMBA 4YQLA 4X3MA 1K3RA 4YPXA 2YY8A 5CO4A 4YPZA 4YQ6A 4YQJA 3ILKA 5GM8A 3AIAA 4YQ1A 4YQ9A 4KDZA 3AI9X 4XBOA 4YQCA 2O3AA 4YQNA 4YQDA 4YQIA 1NXZA 4JWHA 3BBHA 4YQBA 3GYQA 1X7PA 3O7BA 1TO0A 5FAIA 4YQ2A 4YPWA 2V3JA 1J85A 4H3ZA 4YQ0A 2QMMA 1Z85A 1UAKA 4IG6A 1P9PA 4JWJA 4YQ5A 1UALA 4YVJA 3NK6A 4YQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCM X;  1V6Z A;  3KY7 A;  3N4K A;  2Z0Y A;  4J3C A;  1NS5 A;  1X7O A;  4JAL A;  1V2X A;  3ONP A;  1ZJR A;  4KGN A;  4X3L A;  1UAJ A;  3OII A;  4YQS A;  3KNU A;  1OY5 A;  3IC6 A;  4CNF A;  4YQ4 A;  2EGW A;  4YVK A;  2V3K A;  4CNG A;  1GZ0 A;  4YQK A;  4YQQ A;  2HA8 A;  1VHY A;  3L8U A;  4JAK A;  4MCC A;  3QUV A;  4YVI A;  3KW2 A;  4YQR A;  4H3Y A;  2QWV A;  4YVG A;  3OIJ A;  4PZK A;  3OIN A;  1MXI A;  3AXZ A;  1UAM A;  4YQT A;  4CND A;  1VHK A;  3E5Y A;  4MCD A;  4RG1 A;  1VH0 A;  5D9F A;  1IPA A;  3BBE A;  3NK7 A;  2I6D A;  4E8B A;  5GMC A;  3IEF A;  4FAK A;  4YQO A;  4YQ3 A;  4YQA A;  4L69 A;  1O6D A;  3BBD A;  4YPY A;  4YQ8 A;  4MCB A;  4YVH A;  4YQP A;  2CX8 A;  2EGV A;  4YQ7 A;  3KTY A;  3N4J A;  4CNE A;  5GMB A;  4YQL A;  4X3M A;  1K3R A;  4YPX A;  2YY8 A;  5CO4 A;  4YPZ A;  4YQ6 A;  4YQJ A;  3ILK A;  5GM8 A;  3AIA A;  4YQ1 A;  4YQ9 A;  4KDZ A;  3AI9 X;  4XBO A;  4YQC A;  2O3A A;  4YQN A;  4YQD A;  4YQI A;  1NXZ A;  3BBH A;  4YQB A;  3GYQ A;  1X7P A;  3O7B A;  1TO0 A;  5FAI A;  4YQ2 A;  4YPW A;  2V3J A;  1J85 A;  4H3Z A;  4YQ0 A;  2QMM A;  1Z85 A;  1UAK A;  4IG6 A;  1P9P A;  4YQ5 A;  1UAL A;  4YVJ A;  3NK6 A;  4YQG A; 
#chains in the Genus database with same CATH topology
 3DCM X;  1V6Z A;  3KY7 A;  1WRP R;  3N4K A;  3KOR A;  2Z0Y A;  4J3C A;  1NS5 A;  1X7O A;  4JAL A;  1V2X A;  3ONP A;  1RCS A;  1ZJR A;  4KGN A;  4X3L A;  3SSX N;  1UAJ A;  3OII A;  1TRO A;  3FRW A;  4YQS A;  3KNU A;  1OY5 A;  3IC6 A;  4CNF A;  4YQ4 A;  2EGW A;  4YVK A;  2V3K A;  4CNG A;  1GZ0 A;  4YQK A;  4YQQ A;  2HA8 A;  1VHY A;  4JWG A;  3SSW N;  3L8U A;  4JAK A;  4MCC A;  3QUV A;  1MI7 R;  4YVI A;  3KW2 A;  4YQR A;  4H3Y A;  2QWV A;  4YVG A;  3OIJ A;  4PZK A;  3OIN A;  1MXI A;  3AXZ A;  1UAM A;  4YQT A;  4CND A;  1TRR A;  1VHK A;  3E5Y A;  4MCD A;  4RG1 A;  1CO0 A;  1VH0 A;  5D9F A;  1IPA A;  3BBE A;  3NK7 A;  2I6D A;  4FMW A;  4E8B A;  1ZT9 A;  5GMC A;  3IEF A;  4FAK A;  4YQO A;  4YQ3 A;  4YQA A;  4L69 A;  1O6D A;  3BBD A;  4YPY A;  4JWF A;  4YQ8 A;  1WRT R;  2XDI A;  4MCB A;  2OZ9 R;  4YVH A;  4YQP A;  2CX8 A;  2EGV A;  4YQ7 A;  3KTY A;  1JHG A;  3N4J A;  4CNE A;  5GMB A;  4YQL A;  4X3M A;  1K3R A;  4YPX A;  2YY8 A;  5CO4 A;  4YPZ A;  4YQ6 A;  4YQJ A;  3ILK A;  5GM8 A;  3AIA A;  4YQ1 A;  4YQ9 A;  4KDZ A;  3AI9 X;  4XBO A;  4YQC A;  3WRP A;  2O3A A;  4YQN A;  4YQD A;  4YQI A;  1NXZ A;  4JWH A;  3BBH A;  4YQB A;  3GYQ A;  1X7P A;  3O7B A;  1TO0 A;  5FAI A;  4YQ2 A;  4YPW A;  2V3J A;  1J85 A;  4H3Z A;  4YQ0 A;  2QMM A;  1Z85 A;  1UAK A;  4IG6 A;  1P9P A;  4JWJ A;  4YQ5 A;  1UAL A;  4YVJ A;  1WRS R;  3NK6 A;  3G1C A;  4YQG A; 
#chains in the Genus database with same CATH homology
 3DCM X;  1V6Z A;  3KY7 A;  3N4K A;  2Z0Y A;  4J3C A;  1NS5 A;  1X7O A;  4JAL A;  1V2X A;  3ONP A;  1ZJR A;  4KGN A;  4X3L A;  1UAJ A;  3OII A;  4YQS A;  3KNU A;  1OY5 A;  3IC6 A;  4CNF A;  4YQ4 A;  2EGW A;  4YVK A;  2V3K A;  4CNG A;  1GZ0 A;  4YQK A;  4YQQ A;  2HA8 A;  1VHY A;  4JWG A;  3L8U A;  4JAK A;  4MCC A;  3QUV A;  4YVI A;  3KW2 A;  4YQR A;  4H3Y A;  2QWV A;  4YVG A;  3OIJ A;  4PZK A;  3OIN A;  1MXI A;  3AXZ A;  1UAM A;  4YQT A;  4CND A;  1VHK A;  3E5Y A;  4MCD A;  4RG1 A;  1VH0 A;  5D9F A;  1IPA A;  3BBE A;  3NK7 A;  2I6D A;  4FMW A;  4E8B A;  5GMC A;  3IEF A;  4FAK A;  4YQO A;  4YQ3 A;  4YQA A;  4L69 A;  1O6D A;  3BBD A;  4YPY A;  4JWF A;  4YQ8 A;  4MCB A;  4YVH A;  4YQP A;  2CX8 A;  2EGV A;  4YQ7 A;  3KTY A;  3N4J A;  4CNE A;  5GMB A;  4YQL A;  4X3M A;  1K3R A;  4YPX A;  2YY8 A;  5CO4 A;  4YPZ A;  4YQ6 A;  4YQJ A;  3ILK A;  5GM8 A;  3AIA A;  4YQ1 A;  4YQ9 A;  4KDZ A;  3AI9 X;  4XBO A;  4YQC A;  2O3A A;  4YQN A;  4YQD A;  4YQI A;  1NXZ A;  4JWH A;  3BBH A;  4YQB A;  3GYQ A;  1X7P A;  3O7B A;  1TO0 A;  5FAI A;  4YQ2 A;  4YPW A;  2V3J A;  1J85 A;  4H3Z A;  4YQ0 A;  2QMM A;  1Z85 A;  1UAK A;  4IG6 A;  1P9P A;  4JWJ A;  4YQ5 A;  1UAL A;  4YVJ A;  3NK6 A;  4YQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...