4YQGA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
237
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqgA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqgA01
1X7OA 3AI9X 1P9PA 4YVHA 5CO4A 2V3KA 3BBEA 2QWVA 5FAIA 3BBHA 4X3MA 4YQ7A 1X7PA 5GM8A 1NXZA 4MCBA 2CX8A 3KNUA 4J3CA 3AIAA 3GYQA 5GMBA 4YVGA 1VH0A 1OY5A 3O7BA 4YVIA 1UALA 1GZ0A 3OIIA 4YQBA 4CNEA 4YQDA 4YQGA 1VHYA 4YPXA 4YVJA 1TO0A 2V3JA 4YQAA 4H3ZA 4YQ8A 4JALA 4YQSA 4YQTA 2EGWA 4E8BA 1UAMA 3N4KA 4YQRA 5GMCA 1MXIA 4YQ2A 4YQLA 1VHKA 3KW2A 4YVKA 3ONPA 4FAKA 2I6DA 4YQNA 1NS5A 4RG1A 4KDZA 1ZJRA 4YQ5A 4CNDA 3NK7A 3QUVA 2HA8A 1V6ZA 2O3AA 3OINA 4YPYA 4CNFA 1V2XA 4L69A 1IPAA 5D9FA 4YQIA 2YY8A 4PZKA 4H3YA 4YPWA 3E5YA 4YQOA 4CNGA 4YQPA 4YQ1A 3DCMX 2EGVA 1UAKA 1J85A 1UAJA 4YQQA 4YQ9A 4YQ4A 3ILKA 3OIJA 2Z0YA 3NK6A 4IG6A 4YPZA 1O6DA 4JAKA 4MCDA 4YQCA 4YQJA 3N4JA 2QMMA 3L8UA 4YQ3A 4KGNA 4XBOA 3AXZA 3BBDA 3KTYA 4YQKA 4MCCA 3IC6A 3KY7A 3IEFA 1K3RA 1Z85A 4X3LA 4YQ0A 4YQ6A
chains in the Genus database with same CATH superfamily
3SSWN 2OZ9R 1X7OA 3AI9X 1P9PA 4YVHA 5CO4A 3FRWA 2V3KA 3BBEA 1JHGA 2QWVA 3BBHA 4X3MA 4YQ7A 1X7PA 5FAIA 5GM8A 1NXZA 4MCBA 2CX8A 3KNUA 4J3CA 3SSXN 3AIAA 3GYQA 5GMBA 4YVGA 1VH0A 1OY5A 3O7BA 4YVIA 1UALA 1GZ0A 3OIIA 1TRRA 1ZT9A 4YQBA 4CNEA 4YQDA 4YQGA 1VHYA 4YPXA 1WRTR 4YVJA 1TO0A 2V3JA 4YQAA 4H3ZA 1CO0A 4YQ8A 4JALA 4YQSA 4YQTA 2EGWA 3KORA 1TROA 4E8BA 1UAMA 3N4KA 1MI7R 4YQRA 5GMCA 1MXIA 4YQ2A 4YQLA 1VHKA 3KW2A 4YVKA 3ONPA 4FAKA 2I6DA 1WRPR 4YQNA 1NS5A 4RG1A 4KDZA 1ZJRA 4YQ5A 4CNDA 3WRPA 3NK7A 4JWJA 3QUVA 2HA8A 1V6ZA 2O3AA 3OINA 4YPYA 4CNFA 1V2XA 4L69A 1IPAA 5D9FA 1RCSA 4YQIA 2YY8A 4PZKA 4H3YA 4YPWA 3E5YA 4YQOA 4CNGA 4YQPA 4YQ1A 3DCMX 2EGVA 2XDIA 3G1CA 1UAKA 1J85A 1UAJA 4YQQA 4YQ9A 4YQ4A 3ILKA 4JWGA 3OIJA 2Z0YA 3NK6A 4JWFA 4IG6A 4YPZA 1O6DA 4JAKA 4MCDA 4YQCA 4YQJA 3N4JA 2QMMA 3L8UA 4YQ3A 4KGNA 4JWHA 1WRSR 4XBOA 3AXZA 3BBDA 3KTYA 4FMWA 4YQKA 4MCCA 3IC6A 3KY7A 3IEFA 1K3RA 1Z85A 4X3LA 4YQ0A 4YQ6A
chains in the Genus database with same CATH topology
1X7OA 3AI9X 1P9PA 4YVHA 5CO4A 2V3KA 3BBEA 2QWVA 5FAIA 3BBHA 4X3MA 4YQ7A 1X7PA 5GM8A 1NXZA 4MCBA 2CX8A 3KNUA 4J3CA 3AIAA 3GYQA 5GMBA 4YVGA 1VH0A 1OY5A 3O7BA 4YVIA 1UALA 1GZ0A 3OIIA 4YQBA 4CNEA 4YQDA 4YQGA 1VHYA 4YPXA 4YVJA 1TO0A 2V3JA 4YQAA 4H3ZA 4YQ8A 4JALA 4YQSA 4YQTA 2EGWA 4E8BA 1UAMA 3N4KA 4YQRA 5GMCA 1MXIA 4YQ2A 4YQLA 1VHKA 3KW2A 4YVKA 3ONPA 4FAKA 2I6DA 4YQNA 1NS5A 4RG1A 4KDZA 1ZJRA 4YQ5A 4CNDA 3NK7A 4JWJA 3QUVA 2HA8A 1V6ZA 2O3AA 3OINA 4YPYA 4CNFA 1V2XA 4L69A 1IPAA 5D9FA 4YQIA 2YY8A 4PZKA 4H3YA 4YPWA 3E5YA 4YQOA 4CNGA 4YQPA 4YQ1A 3DCMX 2EGVA 1UAKA 1J85A 1UAJA 4YQQA 4YQ9A 4YQ4A 3ILKA 4JWGA 3OIJA 2Z0YA 3NK6A 4JWFA 4IG6A 4YPZA 1O6DA 4JAKA 4MCDA 4YQCA 4YQJA 3N4JA 2QMMA 3L8UA 4YQ3A 4KGNA 4JWHA 4XBOA 3AXZA 3BBDA 3KTYA 4FMWA 4YQKA 4MCCA 3IC6A 3KY7A 3IEFA 1K3RA 1Z85A 4X3LA 4YQ0A 4YQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  3AI9 X;  1P9P A;  4YVH A;  5CO4 A;  2V3K A;  3BBE A;  2QWV A;  5FAI A;  3BBH A;  4X3M A;  4YQ7 A;  1X7P A;  5GM8 A;  1NXZ A;  4MCB A;  2CX8 A;  3KNU A;  4J3C A;  3AIA A;  3GYQ A;  5GMB A;  4YVG A;  1VH0 A;  1OY5 A;  3O7B A;  4YVI A;  1UAL A;  1GZ0 A;  3OII A;  4YQB A;  4CNE A;  4YQD A;  4YQG A;  1VHY A;  4YPX A;  4YVJ A;  1TO0 A;  2V3J A;  4YQA A;  4H3Z A;  4YQ8 A;  4JAL A;  4YQS A;  4YQT A;  2EGW A;  4E8B A;  1UAM A;  3N4K A;  4YQR A;  5GMC A;  1MXI A;  4YQ2 A;  4YQL A;  1VHK A;  3KW2 A;  4YVK A;  3ONP A;  4FAK A;  2I6D A;  4YQN A;  1NS5 A;  4RG1 A;  4KDZ A;  1ZJR A;  4YQ5 A;  4CND A;  3NK7 A;  3QUV A;  2HA8 A;  1V6Z A;  2O3A A;  3OIN A;  4YPY A;  4CNF A;  1V2X A;  4L69 A;  1IPA A;  5D9F A;  4YQI A;  2YY8 A;  4PZK A;  4H3Y A;  4YPW A;  3E5Y A;  4YQO A;  4CNG A;  4YQP A;  4YQ1 A;  3DCM X;  2EGV A;  1UAK A;  1J85 A;  1UAJ A;  4YQQ A;  4YQ9 A;  4YQ4 A;  3ILK A;  3OIJ A;  2Z0Y A;  3NK6 A;  4IG6 A;  4YPZ A;  1O6D A;  4JAK A;  4MCD A;  4YQC A;  4YQJ A;  3N4J A;  2QMM A;  3L8U A;  4YQ3 A;  4KGN A;  4XBO A;  3AXZ A;  3BBD A;  3KTY A;  4YQK A;  4MCC A;  3IC6 A;  3KY7 A;  3IEF A;  1K3R A;  1Z85 A;  4X3L A;  4YQ0 A;  4YQ6 A; 
#chains in the Genus database with same CATH topology
 3SSW N;  2OZ9 R;  1X7O A;  3AI9 X;  1P9P A;  4YVH A;  5CO4 A;  3FRW A;  2V3K A;  3BBE A;  1JHG A;  2QWV A;  3BBH A;  4X3M A;  4YQ7 A;  1X7P A;  5FAI A;  5GM8 A;  1NXZ A;  4MCB A;  2CX8 A;  3KNU A;  4J3C A;  3SSX N;  3AIA A;  3GYQ A;  5GMB A;  4YVG A;  1VH0 A;  1OY5 A;  3O7B A;  4YVI A;  1UAL A;  1GZ0 A;  3OII A;  1TRR A;  1ZT9 A;  4YQB A;  4CNE A;  4YQD A;  4YQG A;  1VHY A;  4YPX A;  1WRT R;  4YVJ A;  1TO0 A;  2V3J A;  4YQA A;  4H3Z A;  1CO0 A;  4YQ8 A;  4JAL A;  4YQS A;  4YQT A;  2EGW A;  3KOR A;  1TRO A;  4E8B A;  1UAM A;  3N4K A;  1MI7 R;  4YQR A;  5GMC A;  1MXI A;  4YQ2 A;  4YQL A;  1VHK A;  3KW2 A;  4YVK A;  3ONP A;  4FAK A;  2I6D A;  1WRP R;  4YQN A;  1NS5 A;  4RG1 A;  4KDZ A;  1ZJR A;  4YQ5 A;  4CND A;  3WRP A;  3NK7 A;  4JWJ A;  3QUV A;  2HA8 A;  1V6Z A;  2O3A A;  3OIN A;  4YPY A;  4CNF A;  1V2X A;  4L69 A;  1IPA A;  5D9F A;  1RCS A;  4YQI A;  2YY8 A;  4PZK A;  4H3Y A;  4YPW A;  3E5Y A;  4YQO A;  4CNG A;  4YQP A;  4YQ1 A;  3DCM X;  2EGV A;  2XDI A;  3G1C A;  1UAK A;  1J85 A;  1UAJ A;  4YQQ A;  4YQ9 A;  4YQ4 A;  3ILK A;  4JWG A;  3OIJ A;  2Z0Y A;  3NK6 A;  4JWF A;  4IG6 A;  4YPZ A;  1O6D A;  4JAK A;  4MCD A;  4YQC A;  4YQJ A;  3N4J A;  2QMM A;  3L8U A;  4YQ3 A;  4KGN A;  4JWH A;  1WRS R;  4XBO A;  3AXZ A;  3BBD A;  3KTY A;  4FMW A;  4YQK A;  4MCC A;  3IC6 A;  3KY7 A;  3IEF A;  1K3R A;  1Z85 A;  4X3L A;  4YQ0 A;  4YQ6 A; 
#chains in the Genus database with same CATH homology
 1X7O A;  3AI9 X;  1P9P A;  4YVH A;  5CO4 A;  2V3K A;  3BBE A;  2QWV A;  5FAI A;  3BBH A;  4X3M A;  4YQ7 A;  1X7P A;  5GM8 A;  1NXZ A;  4MCB A;  2CX8 A;  3KNU A;  4J3C A;  3AIA A;  3GYQ A;  5GMB A;  4YVG A;  1VH0 A;  1OY5 A;  3O7B A;  4YVI A;  1UAL A;  1GZ0 A;  3OII A;  4YQB A;  4CNE A;  4YQD A;  4YQG A;  1VHY A;  4YPX A;  4YVJ A;  1TO0 A;  2V3J A;  4YQA A;  4H3Z A;  4YQ8 A;  4JAL A;  4YQS A;  4YQT A;  2EGW A;  4E8B A;  1UAM A;  3N4K A;  4YQR A;  5GMC A;  1MXI A;  4YQ2 A;  4YQL A;  1VHK A;  3KW2 A;  4YVK A;  3ONP A;  4FAK A;  2I6D A;  4YQN A;  1NS5 A;  4RG1 A;  4KDZ A;  1ZJR A;  4YQ5 A;  4CND A;  3NK7 A;  4JWJ A;  3QUV A;  2HA8 A;  1V6Z A;  2O3A A;  3OIN A;  4YPY A;  4CNF A;  1V2X A;  4L69 A;  1IPA A;  5D9F A;  4YQI A;  2YY8 A;  4PZK A;  4H3Y A;  4YPW A;  3E5Y A;  4YQO A;  4CNG A;  4YQP A;  4YQ1 A;  3DCM X;  2EGV A;  1UAK A;  1J85 A;  1UAJ A;  4YQQ A;  4YQ9 A;  4YQ4 A;  3ILK A;  4JWG A;  3OIJ A;  2Z0Y A;  3NK6 A;  4JWF A;  4IG6 A;  4YPZ A;  1O6D A;  4JAK A;  4MCD A;  4YQC A;  4YQJ A;  3N4J A;  2QMM A;  3L8U A;  4YQ3 A;  4KGN A;  4JWH A;  4XBO A;  3AXZ A;  3BBD A;  3KTY A;  4FMW A;  4YQK A;  4MCC A;  3IC6 A;  3KY7 A;  3IEF A;  1K3R A;  1Z85 A;  4X3L A;  4YQ0 A;  4YQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...