1UAKA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
Knots found
sequence length
252
structure length
243
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 71
structure length 243
sequence length 252
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uakA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uakA01
2V3KA 4YQPA 4YQ9A 4YQOA 2O3AA 4MCBA 4CNFA 3BBDA 3ONPA 4YQ2A 1TO0A 4YQQA 3KW2A 5FAIA 4CNDA 4YQIA 5D9FA 4YQTA 3AXZA 1X7PA 1OY5A 4YQ4A 2I6DA 5GMCA 3QUVA 4YQ8A 3KTYA 4CNEA 3OINA 3N4KA 4YQCA 1V6ZA 4YQBA 1UAJA 3ILKA 2YY8A 2QMMA 4YVGA 4JALA 4MCDA 2EGWA 3BBEA 1K3RA 1UALA 1UAKA 4YQNA 2CX8A 4YQDA 1J85A 2QWVA 4H3YA 3IC6A 4YQ6A 5CO4A 1UAMA 3KY7A 4XBOA 4YVKA 4YQKA 4YPWA 1VH0A 3BBHA 4IG6A 4KDZA 1X7OA 3OIJA 4YQ7A 3GYQA 4YVIA 3O7BA 4YVHA 4L69A 4YQ0A 3IEFA 4YQLA 1MXIA 3DCMX 4FAKA 4YQJA 4MCCA 3L8UA 3OIIA 3KNUA 4YQSA 4X3MA 4J3CA 4YVJA 4X3LA 1V2XA 1GZ0A 3NK6A 1VHKA 4RG1A 4YPXA 5GMBA 4PZKA 1P9PA 4YPZA 4YQGA 4YPYA 4JAKA 4YQ1A 5GM8A 2V3JA 4YQ3A 2HA8A 1ZJRA 1IPAA 4YQ5A 3AI9X 4YQRA 4YQAA 1O6DA 4H3ZA 3E5YA 1VHYA 4CNGA 2Z0YA 1Z85A 1NXZA 3NK7A 4E8BA 2EGVA 4KGNA 3AIAA 3N4JA 1NS5A
chains in the Genus database with same CATH superfamily
4JWFA 2V3KA 3FRWA 4YQPA 4YQ9A 4YQOA 2O3AA 4MCBA 4CNFA 3BBDA 3ONPA 4YQ2A 1TO0A 4YQQA 3KW2A 5FAIA 4CNDA 4YQIA 5D9FA 4YQTA 3AXZA 1OY5A 4YQ4A 1TROA 1X7PA 2I6DA 1RCSA 1MI7R 4JWHA 5GMCA 3QUVA 4YQ8A 3KTYA 4CNEA 3OINA 3N4JA 3N4KA 1WRTR 4YQCA 1V6ZA 4YQBA 1WRSR 1UAJA 3ILKA 2YY8A 2QMMA 4YVGA 4JALA 4MCDA 2EGWA 1ZT9A 3BBEA 3SSWN 1K3RA 1UALA 1UAKA 3KORA 4YQNA 2CX8A 4YQDA 1J85A 2QWVA 4H3YA 3IC6A 4YQ6A 5CO4A 1UAMA 3KY7A 4XBOA 4FMWA 4YVKA 4YQKA 4YPWA 1VH0A 4JWJA 1TRRA 3BBHA 4IG6A 4KDZA 1X7OA 3OIJA 4YQ7A 3GYQA 4YVIA 3O7BA 4YVHA 4L69A 4YQ0A 3IEFA 4YQLA 1MXIA 3DCMX 4FAKA 4YQJA 4MCCA 3WRPA 1JHGA 3L8UA 3KNUA 4YQSA 3OIIA 4X3MA 4J3CA 4YVJA 1CO0A 4X3LA 3SSXN 1V2XA 3G1CA 1GZ0A 3NK6A 1VHKA 4RG1A 4YPXA 5GMBA 2XDIA 4PZKA 1P9PA 4YPZA 1WRPR 4YQGA 4YPYA 4JWGA 4JAKA 4YQ1A 5GM8A 2V3JA 4YQ3A 2HA8A 1ZJRA 1IPAA 4YQ5A 3AI9X 4YQRA 4YQAA 1O6DA 4H3ZA 3E5YA 1VHYA 4CNGA 2Z0YA 1Z85A 1NXZA 3NK7A 4E8BA 2EGVA 4KGNA 3AIAA 2OZ9R 1NS5A
chains in the Genus database with same CATH topology
4JWFA 2V3KA 4YQPA 4YQ9A 4YQOA 2O3AA 4MCBA 4CNFA 3BBDA 3ONPA 4YQ2A 1TO0A 4YQQA 3KW2A 5FAIA 4CNDA 4YQIA 5D9FA 4YQTA 3AXZA 1X7PA 1OY5A 4YQ4A 2I6DA 4JWHA 5GMCA 3QUVA 4YQ8A 3KTYA 4CNEA 3OINA 3N4KA 4YQCA 1V6ZA 4YQBA 1UAJA 3ILKA 2YY8A 2QMMA 4YVGA 4JALA 4MCDA 2EGWA 3BBEA 1K3RA 1UALA 1UAKA 4YQNA 2CX8A 4YQDA 1J85A 2QWVA 4H3YA 3IC6A 4YQ6A 5CO4A 1UAMA 3KY7A 4XBOA 4FMWA 4YVKA 4YQKA 4YPWA 1VH0A 4JWJA 3BBHA 4IG6A 4KDZA 1X7OA 3OIJA 4YQ7A 3GYQA 4YVIA 3O7BA 4YVHA 4L69A 4YQ0A 3IEFA 4YQLA 1MXIA 3DCMX 4FAKA 4YQJA 4MCCA 3L8UA 3OIIA 3KNUA 4YQSA 4X3MA 4J3CA 4YVJA 4X3LA 1V2XA 1GZ0A 3NK6A 1VHKA 4RG1A 4YPXA 5GMBA 4PZKA 1P9PA 4YPZA 4YQGA 4YPYA 4JWGA 4JAKA 4YQ1A 5GM8A 2V3JA 4YQ3A 2HA8A 1ZJRA 1IPAA 4YQ5A 3AI9X 4YQRA 4YQAA 1O6DA 4H3ZA 3E5YA 1VHYA 4CNGA 2Z0YA 1Z85A 1NXZA 3NK7A 4E8BA 2EGVA 4KGNA 3AIAA 3N4JA 1NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3K A;  4YQP A;  4YQ9 A;  4YQO A;  2O3A A;  4MCB A;  4CNF A;  3BBD A;  3ONP A;  4YQ2 A;  1TO0 A;  4YQQ A;  3KW2 A;  5FAI A;  4CND A;  4YQI A;  5D9F A;  4YQT A;  3AXZ A;  1X7P A;  1OY5 A;  4YQ4 A;  2I6D A;  5GMC A;  3QUV A;  4YQ8 A;  3KTY A;  4CNE A;  3OIN A;  3N4K A;  4YQC A;  1V6Z A;  4YQB A;  1UAJ A;  3ILK A;  2YY8 A;  2QMM A;  4YVG A;  4JAL A;  4MCD A;  2EGW A;  3BBE A;  1K3R A;  1UAL A;  1UAK A;  4YQN A;  2CX8 A;  4YQD A;  1J85 A;  2QWV A;  4H3Y A;  3IC6 A;  4YQ6 A;  5CO4 A;  1UAM A;  3KY7 A;  4XBO A;  4YVK A;  4YQK A;  4YPW A;  1VH0 A;  3BBH A;  4IG6 A;  4KDZ A;  1X7O A;  3OIJ A;  4YQ7 A;  3GYQ A;  4YVI A;  3O7B A;  4YVH A;  4L69 A;  4YQ0 A;  3IEF A;  4YQL A;  1MXI A;  3DCM X;  4FAK A;  4YQJ A;  4MCC A;  3L8U A;  3OII A;  3KNU A;  4YQS A;  4X3M A;  4J3C A;  4YVJ A;  4X3L A;  1V2X A;  1GZ0 A;  3NK6 A;  1VHK A;  4RG1 A;  4YPX A;  5GMB A;  4PZK A;  1P9P A;  4YPZ A;  4YQG A;  4YPY A;  4JAK A;  4YQ1 A;  5GM8 A;  2V3J A;  4YQ3 A;  2HA8 A;  1ZJR A;  1IPA A;  4YQ5 A;  3AI9 X;  4YQR A;  4YQA A;  1O6D A;  4H3Z A;  3E5Y A;  1VHY A;  4CNG A;  2Z0Y A;  1Z85 A;  1NXZ A;  3NK7 A;  4E8B A;  2EGV A;  4KGN A;  3AIA A;  3N4J A;  1NS5 A; 
#chains in the Genus database with same CATH topology
 4JWF A;  2V3K A;  3FRW A;  4YQP A;  4YQ9 A;  4YQO A;  2O3A A;  4MCB A;  4CNF A;  3BBD A;  3ONP A;  4YQ2 A;  1TO0 A;  4YQQ A;  3KW2 A;  5FAI A;  4CND A;  4YQI A;  5D9F A;  4YQT A;  3AXZ A;  1OY5 A;  4YQ4 A;  1TRO A;  1X7P A;  2I6D A;  1RCS A;  1MI7 R;  4JWH A;  5GMC A;  3QUV A;  4YQ8 A;  3KTY A;  4CNE A;  3OIN A;  3N4J A;  3N4K A;  1WRT R;  4YQC A;  1V6Z A;  4YQB A;  1WRS R;  1UAJ A;  3ILK A;  2YY8 A;  2QMM A;  4YVG A;  4JAL A;  4MCD A;  2EGW A;  1ZT9 A;  3BBE A;  3SSW N;  1K3R A;  1UAL A;  1UAK A;  3KOR A;  4YQN A;  2CX8 A;  4YQD A;  1J85 A;  2QWV A;  4H3Y A;  3IC6 A;  4YQ6 A;  5CO4 A;  1UAM A;  3KY7 A;  4XBO A;  4FMW A;  4YVK A;  4YQK A;  4YPW A;  1VH0 A;  4JWJ A;  1TRR A;  3BBH A;  4IG6 A;  4KDZ A;  1X7O A;  3OIJ A;  4YQ7 A;  3GYQ A;  4YVI A;  3O7B A;  4YVH A;  4L69 A;  4YQ0 A;  3IEF A;  4YQL A;  1MXI A;  3DCM X;  4FAK A;  4YQJ A;  4MCC A;  3WRP A;  1JHG A;  3L8U A;  3KNU A;  4YQS A;  3OII A;  4X3M A;  4J3C A;  4YVJ A;  1CO0 A;  4X3L A;  3SSX N;  1V2X A;  3G1C A;  1GZ0 A;  3NK6 A;  1VHK A;  4RG1 A;  4YPX A;  5GMB A;  2XDI A;  4PZK A;  1P9P A;  4YPZ A;  1WRP R;  4YQG A;  4YPY A;  4JWG A;  4JAK A;  4YQ1 A;  5GM8 A;  2V3J A;  4YQ3 A;  2HA8 A;  1ZJR A;  1IPA A;  4YQ5 A;  3AI9 X;  4YQR A;  4YQA A;  1O6D A;  4H3Z A;  3E5Y A;  1VHY A;  4CNG A;  2Z0Y A;  1Z85 A;  1NXZ A;  3NK7 A;  4E8B A;  2EGV A;  4KGN A;  3AIA A;  2OZ9 R;  1NS5 A; 
#chains in the Genus database with same CATH homology
 4JWF A;  2V3K A;  4YQP A;  4YQ9 A;  4YQO A;  2O3A A;  4MCB A;  4CNF A;  3BBD A;  3ONP A;  4YQ2 A;  1TO0 A;  4YQQ A;  3KW2 A;  5FAI A;  4CND A;  4YQI A;  5D9F A;  4YQT A;  3AXZ A;  1X7P A;  1OY5 A;  4YQ4 A;  2I6D A;  4JWH A;  5GMC A;  3QUV A;  4YQ8 A;  3KTY A;  4CNE A;  3OIN A;  3N4K A;  4YQC A;  1V6Z A;  4YQB A;  1UAJ A;  3ILK A;  2YY8 A;  2QMM A;  4YVG A;  4JAL A;  4MCD A;  2EGW A;  3BBE A;  1K3R A;  1UAL A;  1UAK A;  4YQN A;  2CX8 A;  4YQD A;  1J85 A;  2QWV A;  4H3Y A;  3IC6 A;  4YQ6 A;  5CO4 A;  1UAM A;  3KY7 A;  4XBO A;  4FMW A;  4YVK A;  4YQK A;  4YPW A;  1VH0 A;  4JWJ A;  3BBH A;  4IG6 A;  4KDZ A;  1X7O A;  3OIJ A;  4YQ7 A;  3GYQ A;  4YVI A;  3O7B A;  4YVH A;  4L69 A;  4YQ0 A;  3IEF A;  4YQL A;  1MXI A;  3DCM X;  4FAK A;  4YQJ A;  4MCC A;  3L8U A;  3OII A;  3KNU A;  4YQS A;  4X3M A;  4J3C A;  4YVJ A;  4X3L A;  1V2X A;  1GZ0 A;  3NK6 A;  1VHK A;  4RG1 A;  4YPX A;  5GMB A;  4PZK A;  1P9P A;  4YPZ A;  4YQG A;  4YPY A;  4JWG A;  4JAK A;  4YQ1 A;  5GM8 A;  2V3J A;  4YQ3 A;  2HA8 A;  1ZJR A;  1IPA A;  4YQ5 A;  3AI9 X;  4YQR A;  4YQA A;  1O6D A;  4H3Z A;  3E5Y A;  1VHY A;  4CNG A;  2Z0Y A;  1Z85 A;  1NXZ A;  3NK7 A;  4E8B A;  2EGV A;  4KGN A;  3AIA A;  3N4J A;  1NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...