4YQOA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
254
structure length
242
Chain Sequence
b'GLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 242
sequence length 254
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqoA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqoA01
4MCCA 1TO0A 4YQGA 4KDZA 4YVKA 2EGVA 4YPYA 4YQRA 5GM8A 4MCBA 1Z85A 3IEFA 1NXZA 2QWVA 5GMBA 4YQBA 4YQJA 4YQ2A 4YQCA 1VH0A 5CO4A 4YQLA 4YQ0A 4YQSA 4YQ3A 4MCDA 4YQAA 1VHKA 3KNUA 3BBHA 3ILKA 4YQ4A 3KY7A 4YQ8A 4YVJA 4YQ5A 1V2XA 1UAJA 4YQ7A 4YQ1A 4YQPA 1K3RA 1J85A 3OIIA 3NK7A 3ONPA 4IG6A 3OIJA 3O7BA 1UAMA 1IPAA 4RG1A 3NK6A 5D9FA 4H3ZA 3OINA 4YQNA 1UALA 3AI9X 4YQKA 4CNEA 4YPWA 4E8BA 4L69A 5FAIA 4YVHA 1P9PA 4YVGA 2YY8A 4FAKA 1ZJRA 4KGNA 4CNDA 1X7PA 3AXZA 3KTYA 2CX8A 1OY5A 1V6ZA 2HA8A 5GMCA 1MXIA 3BBEA 3E5YA 4H3YA 3QUVA 4X3LA 4XBOA 2QMMA 3BBDA 4CNFA 2O3AA 1X7OA 3AIAA 3N4JA 2I6DA 1GZ0A 2V3JA 4PZKA 4YQQA 4CNGA 1UAKA 4YQOA 3DCMX 3IC6A 4X3MA 4JALA 4J3CA 1O6DA 4YQIA 1NS5A 4YPXA 3L8UA 3GYQA 4YPZA 2Z0YA 4YQ9A 4YQ6A 4YQDA 1VHYA 2EGWA 3N4KA 4YVIA 2V3KA 3KW2A 4YQTA 4JAKA
chains in the Genus database with same CATH superfamily
4MCCA 1TO0A 4JWHA 4YQGA 4KDZA 4YVKA 2EGVA 4YPYA 4YQRA 5GM8A 4MCBA 1Z85A 3IEFA 1NXZA 4JWJA 2QWVA 1RCSA 5GMBA 4YQBA 4YQJA 4YQ2A 4YQCA 1VH0A 5CO4A 1MI7R 4YQLA 4YQ0A 4YQSA 4YQ3A 3KORA 4MCDA 4YQAA 1VHKA 3KNUA 3BBHA 3ILKA 4YQ4A 3KY7A 4YQ8A 4YVJA 4YQ5A 1V2XA 1UAJA 4YQ7A 4YQ1A 4YQPA 1K3RA 1J85A 3OIIA 3NK7A 3ONPA 4IG6A 3OIJA 4JWFA 2OZ9R 3O7BA 1UAMA 1IPAA 4RG1A 3NK6A 5D9FA 4H3ZA 3OINA 3WRPA 4YQNA 1UALA 3AI9X 4YQKA 1ZT9A 1TROA 4CNEA 4JWGA 4YPWA 4E8BA 4L69A 1WRSR 4YVHA 5FAIA 1P9PA 4YVGA 1WRTR 2YY8A 4FAKA 1ZJRA 4KGNA 4CNDA 1X7PA 3AXZA 3KTYA 3FRWA 2CX8A 1OY5A 1V6ZA 2HA8A 5GMCA 1MXIA 3BBEA 3E5YA 4H3YA 3QUVA 4FMWA 4X3LA 4XBOA 2XDIA 2QMMA 3BBDA 4CNFA 3SSXN 2O3AA 1X7OA 3AIAA 3N4JA 2I6DA 1GZ0A 3SSWN 2V3JA 4PZKA 4YQQA 4CNGA 1UAKA 4YQOA 1JHGA 3DCMX 3IC6A 4X3MA 4JALA 4J3CA 1O6DA 4YQIA 1NS5A 4YPXA 3L8UA 3GYQA 4YPZA 2Z0YA 4YQ9A 4YQ6A 4YQDA 1VHYA 2EGWA 1TRRA 1CO0A 3N4KA 4YVIA 2V3KA 3KW2A 3G1CA 4YQTA 1WRPR 4JAKA
chains in the Genus database with same CATH topology
4MCCA 1TO0A 4JWHA 4YQGA 4KDZA 4YVKA 2EGVA 4YPYA 4YQRA 5GM8A 4MCBA 1Z85A 3IEFA 1NXZA 4JWJA 2QWVA 5GMBA 4YQBA 4YQJA 4YQ2A 4YQCA 1VH0A 5CO4A 4YQLA 4YQ0A 4YQSA 4YQ3A 4MCDA 4YQAA 1VHKA 3KNUA 3BBHA 3ILKA 4YQ4A 3KY7A 4YQ8A 4YVJA 4YQ5A 1V2XA 1UAJA 4YQ7A 4YQ1A 4YQPA 1K3RA 1J85A 3OIIA 3NK7A 3ONPA 4IG6A 3OIJA 4JWFA 3O7BA 1UAMA 1IPAA 4RG1A 3NK6A 5D9FA 4H3ZA 3OINA 4YQNA 1UALA 3AI9X 4YQKA 4CNEA 4JWGA 4YPWA 4E8BA 4L69A 5FAIA 4YVHA 1P9PA 4YVGA 2YY8A 4FAKA 1ZJRA 4KGNA 4CNDA 1X7PA 3AXZA 3KTYA 2CX8A 1OY5A 1V6ZA 2HA8A 5GMCA 1MXIA 3BBEA 3E5YA 4H3YA 3QUVA 4FMWA 4X3LA 4XBOA 2QMMA 3BBDA 4CNFA 2O3AA 1X7OA 3AIAA 3N4JA 2I6DA 1GZ0A 2V3JA 4PZKA 4YQQA 4CNGA 1UAKA 4YQOA 3DCMX 3IC6A 4X3MA 4JALA 4J3CA 1O6DA 4YQIA 1NS5A 4YPXA 3L8UA 3GYQA 4YPZA 2Z0YA 4YQ9A 4YQ6A 4YQDA 1VHYA 2EGWA 3N4KA 4YVIA 2V3KA 3KW2A 4YQTA 4JAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCC A;  1TO0 A;  4YQG A;  4KDZ A;  4YVK A;  2EGV A;  4YPY A;  4YQR A;  5GM8 A;  4MCB A;  1Z85 A;  3IEF A;  1NXZ A;  2QWV A;  5GMB A;  4YQB A;  4YQJ A;  4YQ2 A;  4YQC A;  1VH0 A;  5CO4 A;  4YQL A;  4YQ0 A;  4YQS A;  4YQ3 A;  4MCD A;  4YQA A;  1VHK A;  3KNU A;  3BBH A;  3ILK A;  4YQ4 A;  3KY7 A;  4YQ8 A;  4YVJ A;  4YQ5 A;  1V2X A;  1UAJ A;  4YQ7 A;  4YQ1 A;  4YQP A;  1K3R A;  1J85 A;  3OII A;  3NK7 A;  3ONP A;  4IG6 A;  3OIJ A;  3O7B A;  1UAM A;  1IPA A;  4RG1 A;  3NK6 A;  5D9F A;  4H3Z A;  3OIN A;  4YQN A;  1UAL A;  3AI9 X;  4YQK A;  4CNE A;  4YPW A;  4E8B A;  4L69 A;  5FAI A;  4YVH A;  1P9P A;  4YVG A;  2YY8 A;  4FAK A;  1ZJR A;  4KGN A;  4CND A;  1X7P A;  3AXZ A;  3KTY A;  2CX8 A;  1OY5 A;  1V6Z A;  2HA8 A;  5GMC A;  1MXI A;  3BBE A;  3E5Y A;  4H3Y A;  3QUV A;  4X3L A;  4XBO A;  2QMM A;  3BBD A;  4CNF A;  2O3A A;  1X7O A;  3AIA A;  3N4J A;  2I6D A;  1GZ0 A;  2V3J A;  4PZK A;  4YQQ A;  4CNG A;  1UAK A;  4YQO A;  3DCM X;  3IC6 A;  4X3M A;  4JAL A;  4J3C A;  1O6D A;  4YQI A;  1NS5 A;  4YPX A;  3L8U A;  3GYQ A;  4YPZ A;  2Z0Y A;  4YQ9 A;  4YQ6 A;  4YQD A;  1VHY A;  2EGW A;  3N4K A;  4YVI A;  2V3K A;  3KW2 A;  4YQT A;  4JAK A; 
#chains in the Genus database with same CATH topology
 4MCC A;  1TO0 A;  4JWH A;  4YQG A;  4KDZ A;  4YVK A;  2EGV A;  4YPY A;  4YQR A;  5GM8 A;  4MCB A;  1Z85 A;  3IEF A;  1NXZ A;  4JWJ A;  2QWV A;  1RCS A;  5GMB A;  4YQB A;  4YQJ A;  4YQ2 A;  4YQC A;  1VH0 A;  5CO4 A;  1MI7 R;  4YQL A;  4YQ0 A;  4YQS A;  4YQ3 A;  3KOR A;  4MCD A;  4YQA A;  1VHK A;  3KNU A;  3BBH A;  3ILK A;  4YQ4 A;  3KY7 A;  4YQ8 A;  4YVJ A;  4YQ5 A;  1V2X A;  1UAJ A;  4YQ7 A;  4YQ1 A;  4YQP A;  1K3R A;  1J85 A;  3OII A;  3NK7 A;  3ONP A;  4IG6 A;  3OIJ A;  4JWF A;  2OZ9 R;  3O7B A;  1UAM A;  1IPA A;  4RG1 A;  3NK6 A;  5D9F A;  4H3Z A;  3OIN A;  3WRP A;  4YQN A;  1UAL A;  3AI9 X;  4YQK A;  1ZT9 A;  1TRO A;  4CNE A;  4JWG A;  4YPW A;  4E8B A;  4L69 A;  1WRS R;  4YVH A;  5FAI A;  1P9P A;  4YVG A;  1WRT R;  2YY8 A;  4FAK A;  1ZJR A;  4KGN A;  4CND A;  1X7P A;  3AXZ A;  3KTY A;  3FRW A;  2CX8 A;  1OY5 A;  1V6Z A;  2HA8 A;  5GMC A;  1MXI A;  3BBE A;  3E5Y A;  4H3Y A;  3QUV A;  4FMW A;  4X3L A;  4XBO A;  2XDI A;  2QMM A;  3BBD A;  4CNF A;  3SSX N;  2O3A A;  1X7O A;  3AIA A;  3N4J A;  2I6D A;  1GZ0 A;  3SSW N;  2V3J A;  4PZK A;  4YQQ A;  4CNG A;  1UAK A;  4YQO A;  1JHG A;  3DCM X;  3IC6 A;  4X3M A;  4JAL A;  4J3C A;  1O6D A;  4YQI A;  1NS5 A;  4YPX A;  3L8U A;  3GYQ A;  4YPZ A;  2Z0Y A;  4YQ9 A;  4YQ6 A;  4YQD A;  1VHY A;  2EGW A;  1TRR A;  1CO0 A;  3N4K A;  4YVI A;  2V3K A;  3KW2 A;  3G1C A;  4YQT A;  1WRP R;  4JAK A; 
#chains in the Genus database with same CATH homology
 4MCC A;  1TO0 A;  4JWH A;  4YQG A;  4KDZ A;  4YVK A;  2EGV A;  4YPY A;  4YQR A;  5GM8 A;  4MCB A;  1Z85 A;  3IEF A;  1NXZ A;  4JWJ A;  2QWV A;  5GMB A;  4YQB A;  4YQJ A;  4YQ2 A;  4YQC A;  1VH0 A;  5CO4 A;  4YQL A;  4YQ0 A;  4YQS A;  4YQ3 A;  4MCD A;  4YQA A;  1VHK A;  3KNU A;  3BBH A;  3ILK A;  4YQ4 A;  3KY7 A;  4YQ8 A;  4YVJ A;  4YQ5 A;  1V2X A;  1UAJ A;  4YQ7 A;  4YQ1 A;  4YQP A;  1K3R A;  1J85 A;  3OII A;  3NK7 A;  3ONP A;  4IG6 A;  3OIJ A;  4JWF A;  3O7B A;  1UAM A;  1IPA A;  4RG1 A;  3NK6 A;  5D9F A;  4H3Z A;  3OIN A;  4YQN A;  1UAL A;  3AI9 X;  4YQK A;  4CNE A;  4JWG A;  4YPW A;  4E8B A;  4L69 A;  5FAI A;  4YVH A;  1P9P A;  4YVG A;  2YY8 A;  4FAK A;  1ZJR A;  4KGN A;  4CND A;  1X7P A;  3AXZ A;  3KTY A;  2CX8 A;  1OY5 A;  1V6Z A;  2HA8 A;  5GMC A;  1MXI A;  3BBE A;  3E5Y A;  4H3Y A;  3QUV A;  4FMW A;  4X3L A;  4XBO A;  2QMM A;  3BBD A;  4CNF A;  2O3A A;  1X7O A;  3AIA A;  3N4J A;  2I6D A;  1GZ0 A;  2V3J A;  4PZK A;  4YQQ A;  4CNG A;  1UAK A;  4YQO A;  3DCM X;  3IC6 A;  4X3M A;  4JAL A;  4J3C A;  1O6D A;  4YQI A;  1NS5 A;  4YPX A;  3L8U A;  3GYQ A;  4YPZ A;  2Z0Y A;  4YQ9 A;  4YQ6 A;  4YQD A;  1VHY A;  2EGW A;  3N4K A;  4YVI A;  2V3K A;  3KW2 A;  4YQT A;  4JAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...