4YQOA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
254
structure length
242
Chain Sequence
GLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 242
sequence length 254
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqoA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqoA01
4L69A 4YQGA 3OIJA 1VHKA 1NS5A 4YQOA 4MCBA 2EGWA 1K3RA 4YPWA 2QMMA 1OY5A 4YPXA 5GMCA 5GMBA 4YQ8A 4MCCA 4YQ4A 2HA8A 4YQIA 4YQPA 4FAKA 4YVGA 1GZ0A 1ZJRA 1UAJA 4PZKA 1V2XA 1J85A 4YQTA 4JALA 4RG1A 4YQLA 2V3KA 2Z0YA 3KY7A 4YVIA 4MCDA 4KGNA 4YQQA 4YPZA 1Z85A 3L8UA 3BBHA 4YQKA 4YQAA 3E5YA 3OINA 3KW2A 4YQ1A 4XBOA 3OIIA 3BBDA 3GYQA 2I6DA 5D9FA 4YQ2A 1UALA 4YQRA 2V3JA 3O7BA 4KDZA 1P9PA 4H3ZA 4YQ6A 3N4KA 3IC6A 4YQJA 4J3CA 4CNGA 4YQ7A 4X3MA 1MXIA 4JAKA 4CNFA 2EGVA 3ONPA 2QWVA 4E8BA 1UAMA 3DCMX 3IEFA 4CNDA 3KNUA 2O3AA 3BBEA 1VHYA 4IG6A 2CX8A 1X7OA 4H3YA 3KTYA 1O6DA 4YQ5A 4YQ0A 5FAIA 3AI9X 3NK6A 4YQDA 1TO0A 1UAKA 4YQ9A 3ILKA 1NXZA 4YVHA 4YQNA 4CNEA 4YQBA 4X3LA 2YY8A 3AIAA 1IPAA 5GM8A 4YQ3A 1V6ZA 3N4JA 4YQCA 4YQSA 5CO4A 4YVJA 3NK7A 3QUVA 4YPYA 3AXZA 1VH0A 4YVKA 1X7PA
chains in the Genus database with same CATH superfamily
4L69A 4YQGA 1RCSA 1WRPR 1TRRA 3SSWN 3OIJA 1VHKA 1NS5A 4YQOA 4JWHA 4MCBA 2EGWA 1K3RA 4YPWA 2QMMA 1OY5A 4YPXA 5GMCA 5GMBA 4YQ8A 4MCCA 4YQ4A 2HA8A 4YQIA 4YQPA 4FAKA 4YVGA 1GZ0A 1ZJRA 1UAJA 4PZKA 3KORA 1V2XA 1J85A 2XDIA 1WRSR 4YQTA 1ZT9A 4JALA 4RG1A 4YQLA 4JWFA 2V3KA 2Z0YA 3KY7A 4YVIA 4MCDA 4KGNA 4YQQA 4YPZA 1Z85A 3L8UA 3G1CA 4YQKA 3BBHA 4YQAA 1MI7R 3E5YA 3OINA 3KW2A 4YQ1A 4XBOA 4JWJA 3SSXN 3OIIA 3BBDA 1WRTR 3GYQA 2I6DA 5D9FA 4YQ2A 1UALA 4YQRA 2V3JA 3O7BA 2OZ9R 4KDZA 1P9PA 4H3ZA 4FMWA 4YQ6A 3N4KA 1TROA 3IC6A 4YQJA 4J3CA 4CNGA 4YQ7A 4X3MA 1MXIA 4JAKA 4CNFA 2EGVA 3ONPA 2QWVA 4E8BA 1UAMA 3DCMX 3IEFA 4CNDA 3KNUA 2O3AA 3BBEA 3WRPA 1VHYA 4IG6A 1CO0A 2CX8A 1X7OA 4H3YA 3KTYA 1O6DA 4YQ5A 4YQ0A 5FAIA 3AI9X 3NK6A 4YQDA 1TO0A 1UAKA 4YQ9A 3ILKA 1JHGA 1NXZA 4YVHA 4YQNA 4CNEA 4YQBA 4X3LA 2YY8A 3AIAA 1IPAA 5GM8A 4YQ3A 1V6ZA 3N4JA 4JWGA 4YQCA 4YQSA 5CO4A 4YVJA 3NK7A 3FRWA 3QUVA 4YPYA 3AXZA 1VH0A 4YVKA 1X7PA
chains in the Genus database with same CATH topology
4L69A 4YQGA 3OIJA 1VHKA 1NS5A 4YQOA 4JWHA 4MCBA 2EGWA 1K3RA 4YPWA 2QMMA 1OY5A 4YPXA 5GMCA 5GMBA 4YQ8A 4MCCA 4YQ4A 2HA8A 4YQIA 4YQPA 4FAKA 4YVGA 1GZ0A 1ZJRA 1UAJA 4PZKA 1V2XA 1J85A 4YQTA 4JALA 4RG1A 4YQLA 4JWFA 2V3KA 2Z0YA 3KY7A 4YVIA 4MCDA 4KGNA 4YQQA 4YPZA 1Z85A 3L8UA 3BBHA 4YQKA 4YQAA 3E5YA 3OINA 3KW2A 4YQ1A 4XBOA 4JWJA 3OIIA 3BBDA 3GYQA 2I6DA 5D9FA 4YQ2A 1UALA 4YQRA 2V3JA 3O7BA 4KDZA 1P9PA 4H3ZA 4FMWA 4YQ6A 3N4KA 3IC6A 4YQJA 4J3CA 4CNGA 4YQ7A 4X3MA 1MXIA 4JAKA 4CNFA 2EGVA 3ONPA 2QWVA 4E8BA 1UAMA 3DCMX 3IEFA 4CNDA 3KNUA 2O3AA 3BBEA 1VHYA 4IG6A 2CX8A 1X7OA 4H3YA 3KTYA 1O6DA 4YQ5A 4YQ0A 5FAIA 3AI9X 3NK6A 4YQDA 1TO0A 1UAKA 4YQ9A 3ILKA 1NXZA 4YVHA 4YQNA 4CNEA 4YQBA 4X3LA 2YY8A 3AIAA 1IPAA 5GM8A 4YQ3A 1V6ZA 3N4JA 4JWGA 4YQCA 4YQSA 5CO4A 4YVJA 3NK7A 3QUVA 4YPYA 3AXZA 1VH0A 4YVKA 1X7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L69 A;  4YQG A;  3OIJ A;  1VHK A;  1NS5 A;  4YQO A;  4MCB A;  2EGW A;  1K3R A;  4YPW A;  2QMM A;  1OY5 A;  4YPX A;  5GMC A;  5GMB A;  4YQ8 A;  4MCC A;  4YQ4 A;  2HA8 A;  4YQI A;  4YQP A;  4FAK A;  4YVG A;  1GZ0 A;  1ZJR A;  1UAJ A;  4PZK A;  1V2X A;  1J85 A;  4YQT A;  4JAL A;  4RG1 A;  4YQL A;  2V3K A;  2Z0Y A;  3KY7 A;  4YVI A;  4MCD A;  4KGN A;  4YQQ A;  4YPZ A;  1Z85 A;  3L8U A;  3BBH A;  4YQK A;  4YQA A;  3E5Y A;  3OIN A;  3KW2 A;  4YQ1 A;  4XBO A;  3OII A;  3BBD A;  3GYQ A;  2I6D A;  5D9F A;  4YQ2 A;  1UAL A;  4YQR A;  2V3J A;  3O7B A;  4KDZ A;  1P9P A;  4H3Z A;  4YQ6 A;  3N4K A;  3IC6 A;  4YQJ A;  4J3C A;  4CNG A;  4YQ7 A;  4X3M A;  1MXI A;  4JAK A;  4CNF A;  2EGV A;  3ONP A;  2QWV A;  4E8B A;  1UAM A;  3DCM X;  3IEF A;  4CND A;  3KNU A;  2O3A A;  3BBE A;  1VHY A;  4IG6 A;  2CX8 A;  1X7O A;  4H3Y A;  3KTY A;  1O6D A;  4YQ5 A;  4YQ0 A;  5FAI A;  3AI9 X;  3NK6 A;  4YQD A;  1TO0 A;  1UAK A;  4YQ9 A;  3ILK A;  1NXZ A;  4YVH A;  4YQN A;  4CNE A;  4YQB A;  4X3L A;  2YY8 A;  3AIA A;  1IPA A;  5GM8 A;  4YQ3 A;  1V6Z A;  3N4J A;  4YQC A;  4YQS A;  5CO4 A;  4YVJ A;  3NK7 A;  3QUV A;  4YPY A;  3AXZ A;  1VH0 A;  4YVK A;  1X7P A; 
#chains in the Genus database with same CATH topology
 4L69 A;  4YQG A;  1RCS A;  1WRP R;  1TRR A;  3SSW N;  3OIJ A;  1VHK A;  1NS5 A;  4YQO A;  4JWH A;  4MCB A;  2EGW A;  1K3R A;  4YPW A;  2QMM A;  1OY5 A;  4YPX A;  5GMC A;  5GMB A;  4YQ8 A;  4MCC A;  4YQ4 A;  2HA8 A;  4YQI A;  4YQP A;  4FAK A;  4YVG A;  1GZ0 A;  1ZJR A;  1UAJ A;  4PZK A;  3KOR A;  1V2X A;  1J85 A;  2XDI A;  1WRS R;  4YQT A;  1ZT9 A;  4JAL A;  4RG1 A;  4YQL A;  4JWF A;  2V3K A;  2Z0Y A;  3KY7 A;  4YVI A;  4MCD A;  4KGN A;  4YQQ A;  4YPZ A;  1Z85 A;  3L8U A;  3G1C A;  4YQK A;  3BBH A;  4YQA A;  1MI7 R;  3E5Y A;  3OIN A;  3KW2 A;  4YQ1 A;  4XBO A;  4JWJ A;  3SSX N;  3OII A;  3BBD A;  1WRT R;  3GYQ A;  2I6D A;  5D9F A;  4YQ2 A;  1UAL A;  4YQR A;  2V3J A;  3O7B A;  2OZ9 R;  4KDZ A;  1P9P A;  4H3Z A;  4FMW A;  4YQ6 A;  3N4K A;  1TRO A;  3IC6 A;  4YQJ A;  4J3C A;  4CNG A;  4YQ7 A;  4X3M A;  1MXI A;  4JAK A;  4CNF A;  2EGV A;  3ONP A;  2QWV A;  4E8B A;  1UAM A;  3DCM X;  3IEF A;  4CND A;  3KNU A;  2O3A A;  3BBE A;  3WRP A;  1VHY A;  4IG6 A;  1CO0 A;  2CX8 A;  1X7O A;  4H3Y A;  3KTY A;  1O6D A;  4YQ5 A;  4YQ0 A;  5FAI A;  3AI9 X;  3NK6 A;  4YQD A;  1TO0 A;  1UAK A;  4YQ9 A;  3ILK A;  1JHG A;  1NXZ A;  4YVH A;  4YQN A;  4CNE A;  4YQB A;  4X3L A;  2YY8 A;  3AIA A;  1IPA A;  5GM8 A;  4YQ3 A;  1V6Z A;  3N4J A;  4JWG A;  4YQC A;  4YQS A;  5CO4 A;  4YVJ A;  3NK7 A;  3FRW A;  3QUV A;  4YPY A;  3AXZ A;  1VH0 A;  4YVK A;  1X7P A; 
#chains in the Genus database with same CATH homology
 4L69 A;  4YQG A;  3OIJ A;  1VHK A;  1NS5 A;  4YQO A;  4JWH A;  4MCB A;  2EGW A;  1K3R A;  4YPW A;  2QMM A;  1OY5 A;  4YPX A;  5GMC A;  5GMB A;  4YQ8 A;  4MCC A;  4YQ4 A;  2HA8 A;  4YQI A;  4YQP A;  4FAK A;  4YVG A;  1GZ0 A;  1ZJR A;  1UAJ A;  4PZK A;  1V2X A;  1J85 A;  4YQT A;  4JAL A;  4RG1 A;  4YQL A;  4JWF A;  2V3K A;  2Z0Y A;  3KY7 A;  4YVI A;  4MCD A;  4KGN A;  4YQQ A;  4YPZ A;  1Z85 A;  3L8U A;  3BBH A;  4YQK A;  4YQA A;  3E5Y A;  3OIN A;  3KW2 A;  4YQ1 A;  4XBO A;  4JWJ A;  3OII A;  3BBD A;  3GYQ A;  2I6D A;  5D9F A;  4YQ2 A;  1UAL A;  4YQR A;  2V3J A;  3O7B A;  4KDZ A;  1P9P A;  4H3Z A;  4FMW A;  4YQ6 A;  3N4K A;  3IC6 A;  4YQJ A;  4J3C A;  4CNG A;  4YQ7 A;  4X3M A;  1MXI A;  4JAK A;  4CNF A;  2EGV A;  3ONP A;  2QWV A;  4E8B A;  1UAM A;  3DCM X;  3IEF A;  4CND A;  3KNU A;  2O3A A;  3BBE A;  1VHY A;  4IG6 A;  2CX8 A;  1X7O A;  4H3Y A;  3KTY A;  1O6D A;  4YQ5 A;  4YQ0 A;  5FAI A;  3AI9 X;  3NK6 A;  4YQD A;  1TO0 A;  1UAK A;  4YQ9 A;  3ILK A;  1NXZ A;  4YVH A;  4YQN A;  4CNE A;  4YQB A;  4X3L A;  2YY8 A;  3AIA A;  1IPA A;  5GM8 A;  4YQ3 A;  1V6Z A;  3N4J A;  4JWG A;  4YQC A;  4YQS A;  5CO4 A;  4YVJ A;  3NK7 A;  3QUV A;  4YPY A;  3AXZ A;  1VH0 A;  4YVK A;  1X7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...