4YQ1A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
253
structure length
244
Chain Sequence
GLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title To Be Published
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 69
structure length 244
sequence length 253
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq1A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq1A01
2V3KA 4KGNA 4CNFA 4YQCA 4YQJA 4H3YA 1VHKA 3GYQA 4X3LA 2EGWA 4CNGA 1V2XA 4PZKA 3KNUA 4YQ4A 4FAKA 4YQ2A 1V6ZA 3E5YA 5FAIA 4YQSA 4YQ3A 1UALA 1VH0A 4E8BA 1J85A 1OY5A 1UAMA 4YPYA 2CX8A 3BBEA 3KTYA 4YQAA 1P9PA 3NK6A 4YPWA 4YVHA 3QUVA 4YVJA 4YQTA 1Z85A 4YVKA 4YPZA 4YQOA 4MCDA 4YQ7A 4IG6A 3OIIA 4MCBA 4YQRA 1X7OA 4YQQA 4JAKA 4KDZA 4YQLA 4YQDA 3OIJA 2Z0YA 3AIAA 5GM8A 3O7BA 3KW2A 4YVIA 4XBOA 3L8UA 4YQ9A 1IPAA 4YQ0A 5D9FA 1K3RA 2HA8A 2QWVA 2O3AA 3ILKA 4MCCA 1NXZA 2EGVA 3BBHA 4H3ZA 5GMBA 4YQ5A 3AXZA 3BBDA 1UAJA 4YQKA 4YQ1A 4X3MA 2YY8A 4L69A 1O6DA 3NK7A 2V3JA 4CNDA 4YQPA 4YQ6A 4JALA 4RG1A 4YQGA 2QMMA 5CO4A 1MXIA 3KY7A 3OINA 5GMCA 4J3CA 1VHYA 4YQBA 1TO0A 4YQIA 4YVGA 4YQNA 1GZ0A 4CNEA 4YQ8A 3AI9X 3N4JA 3N4KA 3IEFA 3ONPA 2I6DA 3DCMX 3IC6A 4YPXA 1X7PA 1UAKA 1NS5A 1ZJRA
chains in the Genus database with same CATH superfamily
2V3KA 4KGNA 4CNFA 2XDIA 4YQCA 1TRRA 1JHGA 4YQJA 4H3YA 1VHKA 3GYQA 3G1CA 4X3LA 2EGWA 4JWHA 4CNGA 1V2XA 4JWFA 4PZKA 3KNUA 4YQ4A 4FAKA 4YQ2A 1V6ZA 3SSXN 3E5YA 5FAIA 4YQSA 4YQ3A 4JWJA 1UALA 1VH0A 4E8BA 1J85A 1OY5A 1UAMA 4YPYA 2CX8A 3BBEA 3KTYA 4YQAA 1P9PA 3NK6A 4YPWA 4YVHA 3QUVA 4YVJA 4YQTA 1Z85A 4YVKA 4YPZA 4YQOA 4MCDA 4YQ7A 4IG6A 3OIIA 4MCBA 4YQRA 4FMWA 1X7OA 4YQQA 4JAKA 4KDZA 4YQLA 4YQDA 3OIJA 2Z0YA 3AIAA 5GM8A 3O7BA 3KW2A 4YVIA 1CO0A 4XBOA 3L8UA 4YQ9A 1IPAA 4YQ0A 5D9FA 1K3RA 2HA8A 2QWVA 2O3AA 3ILKA 4MCCA 1NXZA 1WRTR 2EGVA 3BBHA 4H3ZA 5GMBA 4YQ5A 3AXZA 3BBDA 4JWGA 1UAJA 4YQKA 4YQ1A 1WRSR 1ZT9A 4X3MA 3WRPA 2YY8A 1WRPR 4L69A 1O6DA 3NK7A 2V3JA 4CNDA 4YQPA 4YQ6A 3FRWA 1ZJRA 4JALA 4RG1A 4YQGA 2QMMA 5CO4A 1MXIA 3KY7A 1TROA 3OINA 3KORA 5GMCA 3SSWN 4J3CA 1VHYA 1MI7R 4YQBA 1TO0A 4YQIA 4YVGA 4YQNA 1GZ0A 4CNEA 4YQ8A 3AI9X 3N4JA 3N4KA 3IEFA 3ONPA 2I6DA 3DCMX 3IC6A 2OZ9R 1RCSA 4YPXA 1X7PA 1NS5A 1UAKA
chains in the Genus database with same CATH topology
2V3KA 4KGNA 4CNFA 4YQCA 4YQJA 4H3YA 1VHKA 3GYQA 4X3LA 2EGWA 4JWHA 4CNGA 1V2XA 4JWFA 4PZKA 3KNUA 4YQ4A 4FAKA 4YQ2A 1V6ZA 3E5YA 5FAIA 4YQSA 4YQ3A 4JWJA 1UALA 1VH0A 4E8BA 1J85A 1OY5A 1UAMA 4YPYA 2CX8A 3BBEA 3KTYA 4YQAA 1P9PA 3NK6A 4YPWA 4YVHA 3QUVA 4YVJA 4YQTA 1Z85A 4YVKA 4YPZA 4YQOA 4MCDA 4YQ7A 4IG6A 3OIIA 4MCBA 4YQRA 4FMWA 1X7OA 4YQQA 4JAKA 4KDZA 4YQLA 4YQDA 3OIJA 2Z0YA 3AIAA 5GM8A 3O7BA 3KW2A 4YVIA 4XBOA 3L8UA 4YQ9A 1IPAA 4YQ0A 5D9FA 1K3RA 2HA8A 2QWVA 2O3AA 3ILKA 4MCCA 1NXZA 2EGVA 3BBHA 4H3ZA 5GMBA 4YQ5A 3AXZA 3BBDA 4JWGA 1UAJA 4YQKA 4YQ1A 4X3MA 2YY8A 4L69A 1O6DA 3NK7A 2V3JA 4CNDA 4YQPA 4YQ6A 4JALA 4RG1A 4YQGA 2QMMA 5CO4A 1MXIA 3KY7A 3OINA 5GMCA 4J3CA 1VHYA 4YQBA 1TO0A 4YQIA 4YVGA 4YQNA 1GZ0A 4CNEA 4YQ8A 3AI9X 3N4JA 3N4KA 3IEFA 3ONPA 2I6DA 3DCMX 3IC6A 4YPXA 1X7PA 1UAKA 1NS5A 1ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3K A;  4KGN A;  4CNF A;  4YQC A;  4YQJ A;  4H3Y A;  1VHK A;  3GYQ A;  4X3L A;  2EGW A;  4CNG A;  1V2X A;  4PZK A;  3KNU A;  4YQ4 A;  4FAK A;  4YQ2 A;  1V6Z A;  3E5Y A;  5FAI A;  4YQS A;  4YQ3 A;  1UAL A;  1VH0 A;  4E8B A;  1J85 A;  1OY5 A;  1UAM A;  4YPY A;  2CX8 A;  3BBE A;  3KTY A;  4YQA A;  1P9P A;  3NK6 A;  4YPW A;  4YVH A;  3QUV A;  4YVJ A;  4YQT A;  1Z85 A;  4YVK A;  4YPZ A;  4YQO A;  4MCD A;  4YQ7 A;  4IG6 A;  3OII A;  4MCB A;  4YQR A;  1X7O A;  4YQQ A;  4JAK A;  4KDZ A;  4YQL A;  4YQD A;  3OIJ A;  2Z0Y A;  3AIA A;  5GM8 A;  3O7B A;  3KW2 A;  4YVI A;  4XBO A;  3L8U A;  4YQ9 A;  1IPA A;  4YQ0 A;  5D9F A;  1K3R A;  2HA8 A;  2QWV A;  2O3A A;  3ILK A;  4MCC A;  1NXZ A;  2EGV A;  3BBH A;  4H3Z A;  5GMB A;  4YQ5 A;  3AXZ A;  3BBD A;  1UAJ A;  4YQK A;  4YQ1 A;  4X3M A;  2YY8 A;  4L69 A;  1O6D A;  3NK7 A;  2V3J A;  4CND A;  4YQP A;  4YQ6 A;  4JAL A;  4RG1 A;  4YQG A;  2QMM A;  5CO4 A;  1MXI A;  3KY7 A;  3OIN A;  5GMC A;  4J3C A;  1VHY A;  4YQB A;  1TO0 A;  4YQI A;  4YVG A;  4YQN A;  1GZ0 A;  4CNE A;  4YQ8 A;  3AI9 X;  3N4J A;  3N4K A;  3IEF A;  3ONP A;  2I6D A;  3DCM X;  3IC6 A;  4YPX A;  1X7P A;  1UAK A;  1NS5 A;  1ZJR A; 
#chains in the Genus database with same CATH topology
 2V3K A;  4KGN A;  4CNF A;  2XDI A;  4YQC A;  1TRR A;  1JHG A;  4YQJ A;  4H3Y A;  1VHK A;  3GYQ A;  3G1C A;  4X3L A;  2EGW A;  4JWH A;  4CNG A;  1V2X A;  4JWF A;  4PZK A;  3KNU A;  4YQ4 A;  4FAK A;  4YQ2 A;  1V6Z A;  3SSX N;  3E5Y A;  5FAI A;  4YQS A;  4YQ3 A;  4JWJ A;  1UAL A;  1VH0 A;  4E8B A;  1J85 A;  1OY5 A;  1UAM A;  4YPY A;  2CX8 A;  3BBE A;  3KTY A;  4YQA A;  1P9P A;  3NK6 A;  4YPW A;  4YVH A;  3QUV A;  4YVJ A;  4YQT A;  1Z85 A;  4YVK A;  4YPZ A;  4YQO A;  4MCD A;  4YQ7 A;  4IG6 A;  3OII A;  4MCB A;  4YQR A;  4FMW A;  1X7O A;  4YQQ A;  4JAK A;  4KDZ A;  4YQL A;  4YQD A;  3OIJ A;  2Z0Y A;  3AIA A;  5GM8 A;  3O7B A;  3KW2 A;  4YVI A;  1CO0 A;  4XBO A;  3L8U A;  4YQ9 A;  1IPA A;  4YQ0 A;  5D9F A;  1K3R A;  2HA8 A;  2QWV A;  2O3A A;  3ILK A;  4MCC A;  1NXZ A;  1WRT R;  2EGV A;  3BBH A;  4H3Z A;  5GMB A;  4YQ5 A;  3AXZ A;  3BBD A;  4JWG A;  1UAJ A;  4YQK A;  4YQ1 A;  1WRS R;  1ZT9 A;  4X3M A;  3WRP A;  2YY8 A;  1WRP R;  4L69 A;  1O6D A;  3NK7 A;  2V3J A;  4CND A;  4YQP A;  4YQ6 A;  3FRW A;  1ZJR A;  4JAL A;  4RG1 A;  4YQG A;  2QMM A;  5CO4 A;  1MXI A;  3KY7 A;  1TRO A;  3OIN A;  3KOR A;  5GMC A;  3SSW N;  4J3C A;  1VHY A;  1MI7 R;  4YQB A;  1TO0 A;  4YQI A;  4YVG A;  4YQN A;  1GZ0 A;  4CNE A;  4YQ8 A;  3AI9 X;  3N4J A;  3N4K A;  3IEF A;  3ONP A;  2I6D A;  3DCM X;  3IC6 A;  2OZ9 R;  1RCS A;  4YPX A;  1X7P A;  1NS5 A;  1UAK A; 
#chains in the Genus database with same CATH homology
 2V3K A;  4KGN A;  4CNF A;  4YQC A;  4YQJ A;  4H3Y A;  1VHK A;  3GYQ A;  4X3L A;  2EGW A;  4JWH A;  4CNG A;  1V2X A;  4JWF A;  4PZK A;  3KNU A;  4YQ4 A;  4FAK A;  4YQ2 A;  1V6Z A;  3E5Y A;  5FAI A;  4YQS A;  4YQ3 A;  4JWJ A;  1UAL A;  1VH0 A;  4E8B A;  1J85 A;  1OY5 A;  1UAM A;  4YPY A;  2CX8 A;  3BBE A;  3KTY A;  4YQA A;  1P9P A;  3NK6 A;  4YPW A;  4YVH A;  3QUV A;  4YVJ A;  4YQT A;  1Z85 A;  4YVK A;  4YPZ A;  4YQO A;  4MCD A;  4YQ7 A;  4IG6 A;  3OII A;  4MCB A;  4YQR A;  4FMW A;  1X7O A;  4YQQ A;  4JAK A;  4KDZ A;  4YQL A;  4YQD A;  3OIJ A;  2Z0Y A;  3AIA A;  5GM8 A;  3O7B A;  3KW2 A;  4YVI A;  4XBO A;  3L8U A;  4YQ9 A;  1IPA A;  4YQ0 A;  5D9F A;  1K3R A;  2HA8 A;  2QWV A;  2O3A A;  3ILK A;  4MCC A;  1NXZ A;  2EGV A;  3BBH A;  4H3Z A;  5GMB A;  4YQ5 A;  3AXZ A;  3BBD A;  4JWG A;  1UAJ A;  4YQK A;  4YQ1 A;  4X3M A;  2YY8 A;  4L69 A;  1O6D A;  3NK7 A;  2V3J A;  4CND A;  4YQP A;  4YQ6 A;  4JAL A;  4RG1 A;  4YQG A;  2QMM A;  5CO4 A;  1MXI A;  3KY7 A;  3OIN A;  5GMC A;  4J3C A;  1VHY A;  4YQB A;  1TO0 A;  4YQI A;  4YVG A;  4YQN A;  1GZ0 A;  4CNE A;  4YQ8 A;  3AI9 X;  3N4J A;  3N4K A;  3IEF A;  3ONP A;  2I6D A;  3DCM X;  3IC6 A;  4YPX A;  1X7P A;  1UAK A;  1NS5 A;  1ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...