4YQBA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
240
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 72
structure length 240
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqbA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqbA01
2QWVA 3AI9X 4YQGA 4YQKA 3ONPA 1O6DA 4PZKA 4YQSA 2O3AA 4L69A 4CNFA 4YPZA 3KNUA 1UAKA 4YPXA 4YQ4A 4YPWA 4YQ5A 4J3CA 5GMCA 1J85A 2HA8A 4KDZA 4KGNA 4MCDA 4YQ1A 2EGVA 3N4JA 4E8BA 4H3ZA 3GYQA 1V6ZA 4YQLA 3IC6A 4CNEA 4JALA 3OIIA 4YVJA 3BBEA 1IPAA 4YQRA 3IEFA 3KTYA 4YQ0A 4CNDA 5CO4A 4YQ8A 3QUVA 4YQCA 1UALA 4FAKA 4YQIA 3NK6A 4YQPA 4YVIA 4X3MA 3N4KA 2I6DA 3DCMX 1X7OA 4IG6A 2Z0YA 3BBHA 3OIJA 3E5YA 1MXIA 4YQTA 5FAIA 4MCBA 4YQ7A 1NXZA 4RG1A 1NS5A 3KW2A 4YPYA 4YQJA 3BBDA 3AIAA 1Z85A 4YVHA 1VHYA 4YQ2A 2EGWA 1X7PA 2V3JA 1OY5A 1UAMA 2V3KA 3O7BA 5GM8A 1UAJA 4YQ9A 4YVKA 1VH0A 4YQNA 4YQ3A 1P9PA 1TO0A 1V2XA 4YQOA 5GMBA 3OINA 3L8UA 4MCCA 4JAKA 1ZJRA 4YQDA 1K3RA 4CNGA 3AXZA 4YVGA 2QMMA 4H3YA 2YY8A 3ILKA 4XBOA 3NK7A 2CX8A 3KY7A 4YQ6A 1GZ0A 1VHKA 5D9FA 4YQBA 4X3LA 4YQQA 4YQAA
chains in the Genus database with same CATH superfamily
3KORA 2QWVA 3AI9X 4YQGA 4JWFA 4YQKA 3ONPA 1O6DA 4PZKA 4YQSA 2O3AA 4L69A 4CNFA 4YPZA 3KNUA 1UAKA 4YPXA 4YQ4A 4YPWA 3WRPA 4YQ5A 4J3CA 5GMCA 1J85A 2HA8A 4KDZA 4KGNA 4JWGA 4MCDA 4YQ1A 2EGVA 3N4JA 4E8BA 4H3ZA 3GYQA 1V6ZA 4YQLA 3IC6A 4JWJA 4CNEA 4JALA 3OIIA 4YVJA 3BBEA 1IPAA 4YQRA 3IEFA 3KTYA 1WRPR 4YQ0A 4CNDA 1WRTR 5CO4A 4YQ8A 3QUVA 1ZT9A 4YQCA 1UALA 4FAKA 4YQIA 3NK6A 4YQPA 1MI7R 4YVIA 1TROA 4X3MA 3N4KA 2I6DA 3DCMX 1X7OA 4IG6A 2Z0YA 3BBHA 3OIJA 3E5YA 1TRRA 1MXIA 4YQTA 5FAIA 4MCBA 4YQ7A 1CO0A 1NXZA 4RG1A 1NS5A 3KW2A 4YPYA 3G1CA 4YQJA 1JHGA 3BBDA 3AIAA 1Z85A 4YVHA 1VHYA 2OZ9R 4YQ2A 2EGWA 1X7PA 2V3JA 1OY5A 1UAMA 2V3KA 3O7BA 5GM8A 1UAJA 4YQ9A 4YVKA 1VH0A 4YQNA 4YQ3A 1P9PA 1TO0A 1V2XA 4YQOA 5GMBA 3OINA 3L8UA 4MCCA 4JAKA 3SSWN 2XDIA 4YQDA 1K3RA 1ZJRA 4JWHA 1WRSR 4CNGA 3AXZA 4YVGA 2QMMA 4H3YA 2YY8A 3ILKA 4XBOA 3NK7A 2CX8A 4FMWA 1RCSA 3KY7A 3SSXN 4YQ6A 3FRWA 1GZ0A 1VHKA 5D9FA 4YQBA 4X3LA 4YQQA 4YQAA
chains in the Genus database with same CATH topology
2QWVA 3AI9X 4YQGA 4JWFA 4YQKA 3ONPA 1O6DA 4PZKA 4YQSA 2O3AA 4L69A 4CNFA 4YPZA 3KNUA 1UAKA 4YPXA 4YQ4A 4YPWA 4YQ5A 4J3CA 5GMCA 1J85A 2HA8A 4KDZA 4KGNA 4JWGA 4MCDA 4YQ1A 2EGVA 3N4JA 4E8BA 4H3ZA 3GYQA 1V6ZA 4YQLA 3IC6A 4JWJA 4CNEA 4JALA 3OIIA 4YVJA 3BBEA 1IPAA 4YQRA 3IEFA 3KTYA 4YQ0A 4CNDA 5CO4A 4YQ8A 3QUVA 4YQCA 1UALA 4FAKA 4YQIA 3NK6A 4YQPA 4YVIA 4X3MA 3N4KA 2I6DA 3DCMX 1X7OA 4IG6A 2Z0YA 3BBHA 3OIJA 3E5YA 1MXIA 4YQTA 5FAIA 4MCBA 4YQ7A 1NXZA 4RG1A 1NS5A 3KW2A 4YPYA 4YQJA 3BBDA 3AIAA 1Z85A 4YVHA 1VHYA 4YQ2A 2EGWA 1X7PA 2V3JA 1OY5A 1UAMA 2V3KA 3O7BA 5GM8A 1UAJA 4YQ9A 4YVKA 1VH0A 4YQNA 4YQ3A 1P9PA 1TO0A 1V2XA 4YQOA 5GMBA 3OINA 3L8UA 4MCCA 4JAKA 1ZJRA 4YQDA 1K3RA 4JWHA 4CNGA 3AXZA 4YVGA 2QMMA 4H3YA 2YY8A 3ILKA 4XBOA 3NK7A 2CX8A 4FMWA 3KY7A 4YQ6A 1GZ0A 1VHKA 5D9FA 4YQBA 4X3LA 4YQQA 4YQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWV A;  3AI9 X;  4YQG A;  4YQK A;  3ONP A;  1O6D A;  4PZK A;  4YQS A;  2O3A A;  4L69 A;  4CNF A;  4YPZ A;  3KNU A;  1UAK A;  4YPX A;  4YQ4 A;  4YPW A;  4YQ5 A;  4J3C A;  5GMC A;  1J85 A;  2HA8 A;  4KDZ A;  4KGN A;  4MCD A;  4YQ1 A;  2EGV A;  3N4J A;  4E8B A;  4H3Z A;  3GYQ A;  1V6Z A;  4YQL A;  3IC6 A;  4CNE A;  4JAL A;  3OII A;  4YVJ A;  3BBE A;  1IPA A;  4YQR A;  3IEF A;  3KTY A;  4YQ0 A;  4CND A;  5CO4 A;  4YQ8 A;  3QUV A;  4YQC A;  1UAL A;  4FAK A;  4YQI A;  3NK6 A;  4YQP A;  4YVI A;  4X3M A;  3N4K A;  2I6D A;  3DCM X;  1X7O A;  4IG6 A;  2Z0Y A;  3BBH A;  3OIJ A;  3E5Y A;  1MXI A;  4YQT A;  5FAI A;  4MCB A;  4YQ7 A;  1NXZ A;  4RG1 A;  1NS5 A;  3KW2 A;  4YPY A;  4YQJ A;  3BBD A;  3AIA A;  1Z85 A;  4YVH A;  1VHY A;  4YQ2 A;  2EGW A;  1X7P A;  2V3J A;  1OY5 A;  1UAM A;  2V3K A;  3O7B A;  5GM8 A;  1UAJ A;  4YQ9 A;  4YVK A;  1VH0 A;  4YQN A;  4YQ3 A;  1P9P A;  1TO0 A;  1V2X A;  4YQO A;  5GMB A;  3OIN A;  3L8U A;  4MCC A;  4JAK A;  1ZJR A;  4YQD A;  1K3R A;  4CNG A;  3AXZ A;  4YVG A;  2QMM A;  4H3Y A;  2YY8 A;  3ILK A;  4XBO A;  3NK7 A;  2CX8 A;  3KY7 A;  4YQ6 A;  1GZ0 A;  1VHK A;  5D9F A;  4YQB A;  4X3L A;  4YQQ A;  4YQA A; 
#chains in the Genus database with same CATH topology
 3KOR A;  2QWV A;  3AI9 X;  4YQG A;  4JWF A;  4YQK A;  3ONP A;  1O6D A;  4PZK A;  4YQS A;  2O3A A;  4L69 A;  4CNF A;  4YPZ A;  3KNU A;  1UAK A;  4YPX A;  4YQ4 A;  4YPW A;  3WRP A;  4YQ5 A;  4J3C A;  5GMC A;  1J85 A;  2HA8 A;  4KDZ A;  4KGN A;  4JWG A;  4MCD A;  4YQ1 A;  2EGV A;  3N4J A;  4E8B A;  4H3Z A;  3GYQ A;  1V6Z A;  4YQL A;  3IC6 A;  4JWJ A;  4CNE A;  4JAL A;  3OII A;  4YVJ A;  3BBE A;  1IPA A;  4YQR A;  3IEF A;  3KTY A;  1WRP R;  4YQ0 A;  4CND A;  1WRT R;  5CO4 A;  4YQ8 A;  3QUV A;  1ZT9 A;  4YQC A;  1UAL A;  4FAK A;  4YQI A;  3NK6 A;  4YQP A;  1MI7 R;  4YVI A;  1TRO A;  4X3M A;  3N4K A;  2I6D A;  3DCM X;  1X7O A;  4IG6 A;  2Z0Y A;  3BBH A;  3OIJ A;  3E5Y A;  1TRR A;  1MXI A;  4YQT A;  5FAI A;  4MCB A;  4YQ7 A;  1CO0 A;  1NXZ A;  4RG1 A;  1NS5 A;  3KW2 A;  4YPY A;  3G1C A;  4YQJ A;  1JHG A;  3BBD A;  3AIA A;  1Z85 A;  4YVH A;  1VHY A;  2OZ9 R;  4YQ2 A;  2EGW A;  1X7P A;  2V3J A;  1OY5 A;  1UAM A;  2V3K A;  3O7B A;  5GM8 A;  1UAJ A;  4YQ9 A;  4YVK A;  1VH0 A;  4YQN A;  4YQ3 A;  1P9P A;  1TO0 A;  1V2X A;  4YQO A;  5GMB A;  3OIN A;  3L8U A;  4MCC A;  4JAK A;  3SSW N;  2XDI A;  4YQD A;  1K3R A;  1ZJR A;  4JWH A;  1WRS R;  4CNG A;  3AXZ A;  4YVG A;  2QMM A;  4H3Y A;  2YY8 A;  3ILK A;  4XBO A;  3NK7 A;  2CX8 A;  4FMW A;  1RCS A;  3KY7 A;  3SSX N;  4YQ6 A;  3FRW A;  1GZ0 A;  1VHK A;  5D9F A;  4YQB A;  4X3L A;  4YQQ A;  4YQA A; 
#chains in the Genus database with same CATH homology
 2QWV A;  3AI9 X;  4YQG A;  4JWF A;  4YQK A;  3ONP A;  1O6D A;  4PZK A;  4YQS A;  2O3A A;  4L69 A;  4CNF A;  4YPZ A;  3KNU A;  1UAK A;  4YPX A;  4YQ4 A;  4YPW A;  4YQ5 A;  4J3C A;  5GMC A;  1J85 A;  2HA8 A;  4KDZ A;  4KGN A;  4JWG A;  4MCD A;  4YQ1 A;  2EGV A;  3N4J A;  4E8B A;  4H3Z A;  3GYQ A;  1V6Z A;  4YQL A;  3IC6 A;  4JWJ A;  4CNE A;  4JAL A;  3OII A;  4YVJ A;  3BBE A;  1IPA A;  4YQR A;  3IEF A;  3KTY A;  4YQ0 A;  4CND A;  5CO4 A;  4YQ8 A;  3QUV A;  4YQC A;  1UAL A;  4FAK A;  4YQI A;  3NK6 A;  4YQP A;  4YVI A;  4X3M A;  3N4K A;  2I6D A;  3DCM X;  1X7O A;  4IG6 A;  2Z0Y A;  3BBH A;  3OIJ A;  3E5Y A;  1MXI A;  4YQT A;  5FAI A;  4MCB A;  4YQ7 A;  1NXZ A;  4RG1 A;  1NS5 A;  3KW2 A;  4YPY A;  4YQJ A;  3BBD A;  3AIA A;  1Z85 A;  4YVH A;  1VHY A;  4YQ2 A;  2EGW A;  1X7P A;  2V3J A;  1OY5 A;  1UAM A;  2V3K A;  3O7B A;  5GM8 A;  1UAJ A;  4YQ9 A;  4YVK A;  1VH0 A;  4YQN A;  4YQ3 A;  1P9P A;  1TO0 A;  1V2X A;  4YQO A;  5GMB A;  3OIN A;  3L8U A;  4MCC A;  4JAK A;  1ZJR A;  4YQD A;  1K3R A;  4JWH A;  4CNG A;  3AXZ A;  4YVG A;  2QMM A;  4H3Y A;  2YY8 A;  3ILK A;  4XBO A;  3NK7 A;  2CX8 A;  4FMW A;  3KY7 A;  4YQ6 A;  1GZ0 A;  1VHK A;  5D9F A;  4YQB A;  4X3L A;  4YQQ A;  4YQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...