4YQ9A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
245
Chain Sequence
LVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 77
structure length 245
sequence length 253
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq9A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq9A01
2HA8A 3OINA 3AXZA 3KTYA 3BBDA 5FAIA 4CNFA 4YQOA 4YQKA 3AI9X 4YQSA 3NK6A 1X7OA 4YQ6A 1NXZA 4IG6A 4JAKA 3KY7A 4KGNA 4YQ5A 4YQLA 5D9FA 4YQ3A 1V2XA 3OIIA 5CO4A 4H3YA 4RG1A 4YPWA 1V6ZA 4YQ1A 4YQ0A 3IEFA 4YQIA 3N4JA 3KNUA 3N4KA 4YQCA 4YVHA 2QWVA 1K3RA 4YQ7A 4YQDA 2YY8A 2V3JA 1UAJA 4XBOA 1VHKA 1UAMA 4E8BA 2V3KA 4YQJA 4YVIA 1GZ0A 4YQBA 2O3AA 1MXIA 4YQ2A 2EGVA 4KDZA 3OIJA 4MCBA 3ONPA 4YVKA 4CNGA 4YPYA 4MCCA 3BBEA 1OY5A 3GYQA 4CNEA 4H3ZA 3E5YA 4YPXA 5GMBA 4X3LA 4JALA 1P9PA 4YVJA 4FAKA 5GM8A 1VHYA 1ZJRA 4CNDA 4X3MA 2EGWA 3NK7A 1J85A 1UALA 1TO0A 4YQ8A 2I6DA 1UAKA 4YPZA 4YQQA 3DCMX 3BBHA 4PZKA 2QMMA 4L69A 4YQ4A 3O7BA 4YQTA 4J3CA 4YQNA 1VH0A 1IPAA 1Z85A 4YQAA 4MCDA 3QUVA 1NS5A 3AIAA 1X7PA 3L8UA 4YQRA 4YQ9A 5GMCA 3ILKA 4YVGA 2CX8A 4YQPA 1O6DA 3KW2A 3IC6A 2Z0YA 4YQGA
chains in the Genus database with same CATH superfamily
1JHGA 2HA8A 3OINA 3AXZA 3KTYA 3BBDA 5FAIA 4CNFA 1ZT9A 2XDIA 4YQOA 4YQKA 3AI9X 4YQSA 3NK6A 1X7OA 4YQ6A 1NXZA 4IG6A 4JAKA 3KY7A 4KGNA 4YQ5A 4YQLA 5D9FA 4YQ3A 4JWHA 1WRSR 1V2XA 3OIIA 5CO4A 4H3YA 4RG1A 1MI7R 4YPWA 1V6ZA 3SSXN 4YQ1A 4YQ0A 3IEFA 4YQIA 3N4JA 3KNUA 3N4KA 4JWFA 1WRPR 1TROA 4YQCA 4YVHA 3WRPA 2QWVA 1K3RA 4FMWA 4YQ7A 4YQDA 2YY8A 3KORA 2V3JA 1UAJA 4XBOA 1VHKA 1UAMA 4E8BA 4JWGA 2V3KA 4YQJA 4YVIA 1GZ0A 4YQBA 2O3AA 1MXIA 4YQ2A 2EGVA 4KDZA 3OIJA 4MCBA 3ONPA 4YVKA 4JWJA 4CNGA 4YPYA 4MCCA 3BBEA 1OY5A 3GYQA 4CNEA 4H3ZA 3E5YA 4YPXA 1WRTR 5GMBA 4X3LA 4JALA 1P9PA 4YVJA 4FAKA 5GM8A 1VHYA 1CO0A 1ZJRA 4CNDA 4X3MA 2EGWA 3NK7A 1J85A 1UALA 1TO0A 4YQ8A 2I6DA 1UAKA 4YPZA 4YQQA 3DCMX 3BBHA 4PZKA 2QMMA 4L69A 4YQ4A 3O7BA 4YQTA 1RCSA 4J3CA 4YQNA 1VH0A 1IPAA 1Z85A 4YQAA 4MCDA 3QUVA 1NS5A 3AIAA 1X7PA 3L8UA 4YQRA 4YQ9A 5GMCA 1TRRA 3G1CA 3ILKA 4YVGA 2CX8A 3FRWA 4YQPA 1O6DA 3KW2A 3IC6A 2OZ9R 2Z0YA 3SSWN 4YQGA
chains in the Genus database with same CATH topology
2HA8A 3OINA 3AXZA 3KTYA 3BBDA 5FAIA 4CNFA 4YQOA 4YQKA 3AI9X 4YQSA 3NK6A 1X7OA 4YQ6A 1NXZA 4IG6A 4JAKA 3KY7A 4KGNA 4YQ5A 4YQLA 5D9FA 4YQ3A 4JWHA 1V2XA 3OIIA 5CO4A 4H3YA 4RG1A 4YPWA 1V6ZA 4YQ1A 4YQ0A 3IEFA 4YQIA 3N4JA 3KNUA 3N4KA 4JWFA 4YQCA 4YVHA 2QWVA 1K3RA 4FMWA 4YQ7A 4YQDA 2YY8A 2V3JA 1UAJA 4XBOA 1VHKA 1UAMA 4E8BA 4JWGA 2V3KA 4YQJA 4YVIA 1GZ0A 4YQBA 2O3AA 1MXIA 4YQ2A 2EGVA 4KDZA 3OIJA 4MCBA 3ONPA 4YVKA 4JWJA 4CNGA 4YPYA 4MCCA 3BBEA 1OY5A 3GYQA 4CNEA 4H3ZA 3E5YA 4YPXA 5GMBA 4X3LA 4JALA 1P9PA 4YVJA 4FAKA 5GM8A 1VHYA 1ZJRA 4CNDA 4X3MA 2EGWA 3NK7A 1J85A 1UALA 1TO0A 4YQ8A 2I6DA 1UAKA 4YPZA 4YQQA 3DCMX 3BBHA 4PZKA 2QMMA 4L69A 4YQ4A 3O7BA 4YQTA 4J3CA 4YQNA 1VH0A 1IPAA 1Z85A 4YQAA 4MCDA 3QUVA 1NS5A 3AIAA 1X7PA 3L8UA 4YQRA 4YQ9A 5GMCA 3ILKA 4YVGA 2CX8A 4YQPA 1O6DA 3KW2A 3IC6A 2Z0YA 4YQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HA8 A;  3OIN A;  3AXZ A;  3KTY A;  3BBD A;  5FAI A;  4CNF A;  4YQO A;  4YQK A;  3AI9 X;  4YQS A;  3NK6 A;  1X7O A;  4YQ6 A;  1NXZ A;  4IG6 A;  4JAK A;  3KY7 A;  4KGN A;  4YQ5 A;  4YQL A;  5D9F A;  4YQ3 A;  1V2X A;  3OII A;  5CO4 A;  4H3Y A;  4RG1 A;  4YPW A;  1V6Z A;  4YQ1 A;  4YQ0 A;  3IEF A;  4YQI A;  3N4J A;  3KNU A;  3N4K A;  4YQC A;  4YVH A;  2QWV A;  1K3R A;  4YQ7 A;  4YQD A;  2YY8 A;  2V3J A;  1UAJ A;  4XBO A;  1VHK A;  1UAM A;  4E8B A;  2V3K A;  4YQJ A;  4YVI A;  1GZ0 A;  4YQB A;  2O3A A;  1MXI A;  4YQ2 A;  2EGV A;  4KDZ A;  3OIJ A;  4MCB A;  3ONP A;  4YVK A;  4CNG A;  4YPY A;  4MCC A;  3BBE A;  1OY5 A;  3GYQ A;  4CNE A;  4H3Z A;  3E5Y A;  4YPX A;  5GMB A;  4X3L A;  4JAL A;  1P9P A;  4YVJ A;  4FAK A;  5GM8 A;  1VHY A;  1ZJR A;  4CND A;  4X3M A;  2EGW A;  3NK7 A;  1J85 A;  1UAL A;  1TO0 A;  4YQ8 A;  2I6D A;  1UAK A;  4YPZ A;  4YQQ A;  3DCM X;  3BBH A;  4PZK A;  2QMM A;  4L69 A;  4YQ4 A;  3O7B A;  4YQT A;  4J3C A;  4YQN A;  1VH0 A;  1IPA A;  1Z85 A;  4YQA A;  4MCD A;  3QUV A;  1NS5 A;  3AIA A;  1X7P A;  3L8U A;  4YQR A;  4YQ9 A;  5GMC A;  3ILK A;  4YVG A;  2CX8 A;  4YQP A;  1O6D A;  3KW2 A;  3IC6 A;  2Z0Y A;  4YQG A; 
#chains in the Genus database with same CATH topology
 1JHG A;  2HA8 A;  3OIN A;  3AXZ A;  3KTY A;  3BBD A;  5FAI A;  4CNF A;  1ZT9 A;  2XDI A;  4YQO A;  4YQK A;  3AI9 X;  4YQS A;  3NK6 A;  1X7O A;  4YQ6 A;  1NXZ A;  4IG6 A;  4JAK A;  3KY7 A;  4KGN A;  4YQ5 A;  4YQL A;  5D9F A;  4YQ3 A;  4JWH A;  1WRS R;  1V2X A;  3OII A;  5CO4 A;  4H3Y A;  4RG1 A;  1MI7 R;  4YPW A;  1V6Z A;  3SSX N;  4YQ1 A;  4YQ0 A;  3IEF A;  4YQI A;  3N4J A;  3KNU A;  3N4K A;  4JWF A;  1WRP R;  1TRO A;  4YQC A;  4YVH A;  3WRP A;  2QWV A;  1K3R A;  4FMW A;  4YQ7 A;  4YQD A;  2YY8 A;  3KOR A;  2V3J A;  1UAJ A;  4XBO A;  1VHK A;  1UAM A;  4E8B A;  4JWG A;  2V3K A;  4YQJ A;  4YVI A;  1GZ0 A;  4YQB A;  2O3A A;  1MXI A;  4YQ2 A;  2EGV A;  4KDZ A;  3OIJ A;  4MCB A;  3ONP A;  4YVK A;  4JWJ A;  4CNG A;  4YPY A;  4MCC A;  3BBE A;  1OY5 A;  3GYQ A;  4CNE A;  4H3Z A;  3E5Y A;  4YPX A;  1WRT R;  5GMB A;  4X3L A;  4JAL A;  1P9P A;  4YVJ A;  4FAK A;  5GM8 A;  1VHY A;  1CO0 A;  1ZJR A;  4CND A;  4X3M A;  2EGW A;  3NK7 A;  1J85 A;  1UAL A;  1TO0 A;  4YQ8 A;  2I6D A;  1UAK A;  4YPZ A;  4YQQ A;  3DCM X;  3BBH A;  4PZK A;  2QMM A;  4L69 A;  4YQ4 A;  3O7B A;  4YQT A;  1RCS A;  4J3C A;  4YQN A;  1VH0 A;  1IPA A;  1Z85 A;  4YQA A;  4MCD A;  3QUV A;  1NS5 A;  3AIA A;  1X7P A;  3L8U A;  4YQR A;  4YQ9 A;  5GMC A;  1TRR A;  3G1C A;  3ILK A;  4YVG A;  2CX8 A;  3FRW A;  4YQP A;  1O6D A;  3KW2 A;  3IC6 A;  2OZ9 R;  2Z0Y A;  3SSW N;  4YQG A; 
#chains in the Genus database with same CATH homology
 2HA8 A;  3OIN A;  3AXZ A;  3KTY A;  3BBD A;  5FAI A;  4CNF A;  4YQO A;  4YQK A;  3AI9 X;  4YQS A;  3NK6 A;  1X7O A;  4YQ6 A;  1NXZ A;  4IG6 A;  4JAK A;  3KY7 A;  4KGN A;  4YQ5 A;  4YQL A;  5D9F A;  4YQ3 A;  4JWH A;  1V2X A;  3OII A;  5CO4 A;  4H3Y A;  4RG1 A;  4YPW A;  1V6Z A;  4YQ1 A;  4YQ0 A;  3IEF A;  4YQI A;  3N4J A;  3KNU A;  3N4K A;  4JWF A;  4YQC A;  4YVH A;  2QWV A;  1K3R A;  4FMW A;  4YQ7 A;  4YQD A;  2YY8 A;  2V3J A;  1UAJ A;  4XBO A;  1VHK A;  1UAM A;  4E8B A;  4JWG A;  2V3K A;  4YQJ A;  4YVI A;  1GZ0 A;  4YQB A;  2O3A A;  1MXI A;  4YQ2 A;  2EGV A;  4KDZ A;  3OIJ A;  4MCB A;  3ONP A;  4YVK A;  4JWJ A;  4CNG A;  4YPY A;  4MCC A;  3BBE A;  1OY5 A;  3GYQ A;  4CNE A;  4H3Z A;  3E5Y A;  4YPX A;  5GMB A;  4X3L A;  4JAL A;  1P9P A;  4YVJ A;  4FAK A;  5GM8 A;  1VHY A;  1ZJR A;  4CND A;  4X3M A;  2EGW A;  3NK7 A;  1J85 A;  1UAL A;  1TO0 A;  4YQ8 A;  2I6D A;  1UAK A;  4YPZ A;  4YQQ A;  3DCM X;  3BBH A;  4PZK A;  2QMM A;  4L69 A;  4YQ4 A;  3O7B A;  4YQT A;  4J3C A;  4YQN A;  1VH0 A;  1IPA A;  1Z85 A;  4YQA A;  4MCD A;  3QUV A;  1NS5 A;  3AIA A;  1X7P A;  3L8U A;  4YQR A;  4YQ9 A;  5GMC A;  3ILK A;  4YVG A;  2CX8 A;  4YQP A;  1O6D A;  3KW2 A;  3IC6 A;  2Z0Y A;  4YQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...