4YQLA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
248
structure length
240
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 69
structure length 240
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqlA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqlA01
4CNGA 3GYQA 4KDZA 4YQ2A 4YQ8A 2EGVA 3OINA 3AIAA 5FAIA 4YVGA 1VHYA 4YPZA 2CX8A 4H3YA 2QMMA 1V2XA 4YPWA 3L8UA 4X3LA 1X7PA 4E8BA 1Z85A 3NK6A 4YQLA 4YPYA 4YQBA 4YQCA 2EGWA 5GMBA 1UAJA 5GMCA 3BBDA 4YQ5A 4YPXA 3N4JA 3ONPA 4YQRA 4CNDA 3KNUA 3AI9X 4YQ4A 4YQKA 4FAKA 3KW2A 3O7BA 3BBHA 4YQ7A 3QUVA 4MCCA 4YQPA 4YQGA 3E5YA 1O6DA 4YQTA 4YVKA 4YQ9A 4JAKA 4YQQA 4YQ0A 3OIJA 4YQ3A 4KGNA 2QWVA 2V3KA 4CNFA 4MCBA 4YVJA 1K3RA 1VH0A 2Z0YA 1P9PA 4YQDA 3KTYA 2YY8A 1NS5A 4YQJA 3BBEA 1TO0A 5CO4A 1J85A 2I6DA 3ILKA 4MCDA 3IEFA 1UALA 4H3ZA 4L69A 5D9FA 4YVHA 3N4KA 1UAKA 1UAMA 4YQOA 1NXZA 3OIIA 4CNEA 3KY7A 4YQSA 4J3CA 4YQAA 4JALA 4YQIA 4YVIA 1ZJRA 1VHKA 1V6ZA 4PZKA 3NK7A 4YQ1A 2O3AA 4YQ6A 2V3JA 1GZ0A 1IPAA 4IG6A 4YQNA 4X3MA 4XBOA 1OY5A 1MXIA 1X7OA 3IC6A 3AXZA 5GM8A 3DCMX 4RG1A 2HA8A
chains in the Genus database with same CATH superfamily
3SSXN 4CNGA 3GYQA 4KDZA 3WRPA 4YQ2A 4YQ8A 2EGVA 3G1CA 3OINA 3AIAA 5FAIA 4YVGA 1VHYA 4JWHA 4JWGA 4YPZA 4JWJA 3SSWN 2CX8A 4H3YA 2QMMA 1V2XA 4FMWA 4YPWA 3L8UA 4X3LA 1X7PA 1ZT9A 4E8BA 1Z85A 3NK6A 4YQLA 4YPYA 4YQBA 4YQCA 2EGWA 5GMBA 1UAJA 5GMCA 1RCSA 3BBDA 4YQ5A 4YPXA 3N4JA 1JHGA 4YQRA 3ONPA 4CNDA 3KNUA 3AI9X 4YQ4A 4YQKA 4FAKA 3KW2A 3O7BA 3BBHA 4YQ7A 3QUVA 4MCCA 4YQPA 4YQGA 3E5YA 1O6DA 4YQTA 2XDIA 4YVKA 4YQ9A 4JAKA 4YQQA 4YQ0A 1WRPR 3OIJA 4YQ3A 4KGNA 2QWVA 2V3KA 4CNFA 4MCBA 4YVJA 1K3RA 1VH0A 2Z0YA 1P9PA 4YQDA 3KTYA 2YY8A 1NS5A 4YQJA 3BBEA 1TO0A 5CO4A 1CO0A 1J85A 2I6DA 3ILKA 4MCDA 3IEFA 1UALA 4H3ZA 4L69A 5D9FA 1MI7R 3KORA 4YVHA 2OZ9R 3N4KA 1UAKA 1UAMA 4YQOA 1NXZA 3OIIA 4CNEA 3KY7A 4YQSA 4J3CA 4YQAA 1WRTR 4JALA 4YQIA 4YVIA 1ZJRA 4JWFA 1VHKA 1V6ZA 1WRSR 4PZKA 3NK7A 4YQ1A 2O3AA 1TRRA 4YQ6A 2V3JA 1GZ0A 1IPAA 4IG6A 4YQNA 4X3MA 3FRWA 4XBOA 1OY5A 1MXIA 1X7OA 3IC6A 3AXZA 5GM8A 3DCMX 1TROA 4RG1A 2HA8A
chains in the Genus database with same CATH topology
4CNGA 3GYQA 4KDZA 4YQ2A 4YQ8A 2EGVA 3OINA 3AIAA 5FAIA 4YVGA 1VHYA 4JWHA 4JWGA 4YPZA 4JWJA 2CX8A 4H3YA 2QMMA 1V2XA 4FMWA 4YPWA 3L8UA 4X3LA 1X7PA 4E8BA 1Z85A 3NK6A 4YQLA 4YPYA 4YQBA 4YQCA 2EGWA 5GMBA 1UAJA 5GMCA 3BBDA 4YQ5A 4YPXA 3N4JA 3ONPA 4YQRA 4CNDA 3KNUA 3AI9X 4YQ4A 4YQKA 4FAKA 3KW2A 3O7BA 3BBHA 4YQ7A 3QUVA 4MCCA 4YQPA 4YQGA 3E5YA 1O6DA 4YQTA 4YVKA 4YQ9A 4JAKA 4YQQA 4YQ0A 3OIJA 4YQ3A 4KGNA 2QWVA 2V3KA 4CNFA 4MCBA 4YVJA 1K3RA 1VH0A 2Z0YA 1P9PA 4YQDA 3KTYA 2YY8A 1NS5A 4YQJA 3BBEA 1TO0A 5CO4A 1J85A 2I6DA 3ILKA 4MCDA 3IEFA 1UALA 4H3ZA 4L69A 5D9FA 4YVHA 3N4KA 1UAKA 1UAMA 4YQOA 1NXZA 3OIIA 4CNEA 3KY7A 4YQSA 4J3CA 4YQAA 4JALA 4YQIA 4YVIA 1ZJRA 4JWFA 1VHKA 1V6ZA 4PZKA 3NK7A 4YQ1A 2O3AA 4YQ6A 2V3JA 1GZ0A 1IPAA 4IG6A 4YQNA 4X3MA 4XBOA 1OY5A 1MXIA 1X7OA 3IC6A 3AXZA 5GM8A 3DCMX 4RG1A 2HA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CNG A;  3GYQ A;  4KDZ A;  4YQ2 A;  4YQ8 A;  2EGV A;  3OIN A;  3AIA A;  5FAI A;  4YVG A;  1VHY A;  4YPZ A;  2CX8 A;  4H3Y A;  2QMM A;  1V2X A;  4YPW A;  3L8U A;  4X3L A;  1X7P A;  4E8B A;  1Z85 A;  3NK6 A;  4YQL A;  4YPY A;  4YQB A;  4YQC A;  2EGW A;  5GMB A;  1UAJ A;  5GMC A;  3BBD A;  4YQ5 A;  4YPX A;  3N4J A;  3ONP A;  4YQR A;  4CND A;  3KNU A;  3AI9 X;  4YQ4 A;  4YQK A;  4FAK A;  3KW2 A;  3O7B A;  3BBH A;  4YQ7 A;  3QUV A;  4MCC A;  4YQP A;  4YQG A;  3E5Y A;  1O6D A;  4YQT A;  4YVK A;  4YQ9 A;  4JAK A;  4YQQ A;  4YQ0 A;  3OIJ A;  4YQ3 A;  4KGN A;  2QWV A;  2V3K A;  4CNF A;  4MCB A;  4YVJ A;  1K3R A;  1VH0 A;  2Z0Y A;  1P9P A;  4YQD A;  3KTY A;  2YY8 A;  1NS5 A;  4YQJ A;  3BBE A;  1TO0 A;  5CO4 A;  1J85 A;  2I6D A;  3ILK A;  4MCD A;  3IEF A;  1UAL A;  4H3Z A;  4L69 A;  5D9F A;  4YVH A;  3N4K A;  1UAK A;  1UAM A;  4YQO A;  1NXZ A;  3OII A;  4CNE A;  3KY7 A;  4YQS A;  4J3C A;  4YQA A;  4JAL A;  4YQI A;  4YVI A;  1ZJR A;  1VHK A;  1V6Z A;  4PZK A;  3NK7 A;  4YQ1 A;  2O3A A;  4YQ6 A;  2V3J A;  1GZ0 A;  1IPA A;  4IG6 A;  4YQN A;  4X3M A;  4XBO A;  1OY5 A;  1MXI A;  1X7O A;  3IC6 A;  3AXZ A;  5GM8 A;  3DCM X;  4RG1 A;  2HA8 A; 
#chains in the Genus database with same CATH topology
 3SSX N;  4CNG A;  3GYQ A;  4KDZ A;  3WRP A;  4YQ2 A;  4YQ8 A;  2EGV A;  3G1C A;  3OIN A;  3AIA A;  5FAI A;  4YVG A;  1VHY A;  4JWH A;  4JWG A;  4YPZ A;  4JWJ A;  3SSW N;  2CX8 A;  4H3Y A;  2QMM A;  1V2X A;  4FMW A;  4YPW A;  3L8U A;  4X3L A;  1X7P A;  1ZT9 A;  4E8B A;  1Z85 A;  3NK6 A;  4YQL A;  4YPY A;  4YQB A;  4YQC A;  2EGW A;  5GMB A;  1UAJ A;  5GMC A;  1RCS A;  3BBD A;  4YQ5 A;  4YPX A;  3N4J A;  1JHG A;  4YQR A;  3ONP A;  4CND A;  3KNU A;  3AI9 X;  4YQ4 A;  4YQK A;  4FAK A;  3KW2 A;  3O7B A;  3BBH A;  4YQ7 A;  3QUV A;  4MCC A;  4YQP A;  4YQG A;  3E5Y A;  1O6D A;  4YQT A;  2XDI A;  4YVK A;  4YQ9 A;  4JAK A;  4YQQ A;  4YQ0 A;  1WRP R;  3OIJ A;  4YQ3 A;  4KGN A;  2QWV A;  2V3K A;  4CNF A;  4MCB A;  4YVJ A;  1K3R A;  1VH0 A;  2Z0Y A;  1P9P A;  4YQD A;  3KTY A;  2YY8 A;  1NS5 A;  4YQJ A;  3BBE A;  1TO0 A;  5CO4 A;  1CO0 A;  1J85 A;  2I6D A;  3ILK A;  4MCD A;  3IEF A;  1UAL A;  4H3Z A;  4L69 A;  5D9F A;  1MI7 R;  3KOR A;  4YVH A;  2OZ9 R;  3N4K A;  1UAK A;  1UAM A;  4YQO A;  1NXZ A;  3OII A;  4CNE A;  3KY7 A;  4YQS A;  4J3C A;  4YQA A;  1WRT R;  4JAL A;  4YQI A;  4YVI A;  1ZJR A;  4JWF A;  1VHK A;  1V6Z A;  1WRS R;  4PZK A;  3NK7 A;  4YQ1 A;  2O3A A;  1TRR A;  4YQ6 A;  2V3J A;  1GZ0 A;  1IPA A;  4IG6 A;  4YQN A;  4X3M A;  3FRW A;  4XBO A;  1OY5 A;  1MXI A;  1X7O A;  3IC6 A;  3AXZ A;  5GM8 A;  3DCM X;  1TRO A;  4RG1 A;  2HA8 A; 
#chains in the Genus database with same CATH homology
 4CNG A;  3GYQ A;  4KDZ A;  4YQ2 A;  4YQ8 A;  2EGV A;  3OIN A;  3AIA A;  5FAI A;  4YVG A;  1VHY A;  4JWH A;  4JWG A;  4YPZ A;  4JWJ A;  2CX8 A;  4H3Y A;  2QMM A;  1V2X A;  4FMW A;  4YPW A;  3L8U A;  4X3L A;  1X7P A;  4E8B A;  1Z85 A;  3NK6 A;  4YQL A;  4YPY A;  4YQB A;  4YQC A;  2EGW A;  5GMB A;  1UAJ A;  5GMC A;  3BBD A;  4YQ5 A;  4YPX A;  3N4J A;  3ONP A;  4YQR A;  4CND A;  3KNU A;  3AI9 X;  4YQ4 A;  4YQK A;  4FAK A;  3KW2 A;  3O7B A;  3BBH A;  4YQ7 A;  3QUV A;  4MCC A;  4YQP A;  4YQG A;  3E5Y A;  1O6D A;  4YQT A;  4YVK A;  4YQ9 A;  4JAK A;  4YQQ A;  4YQ0 A;  3OIJ A;  4YQ3 A;  4KGN A;  2QWV A;  2V3K A;  4CNF A;  4MCB A;  4YVJ A;  1K3R A;  1VH0 A;  2Z0Y A;  1P9P A;  4YQD A;  3KTY A;  2YY8 A;  1NS5 A;  4YQJ A;  3BBE A;  1TO0 A;  5CO4 A;  1J85 A;  2I6D A;  3ILK A;  4MCD A;  3IEF A;  1UAL A;  4H3Z A;  4L69 A;  5D9F A;  4YVH A;  3N4K A;  1UAK A;  1UAM A;  4YQO A;  1NXZ A;  3OII A;  4CNE A;  3KY7 A;  4YQS A;  4J3C A;  4YQA A;  4JAL A;  4YQI A;  4YVI A;  1ZJR A;  4JWF A;  1VHK A;  1V6Z A;  4PZK A;  3NK7 A;  4YQ1 A;  2O3A A;  4YQ6 A;  2V3J A;  1GZ0 A;  1IPA A;  4IG6 A;  4YQN A;  4X3M A;  4XBO A;  1OY5 A;  1MXI A;  1X7O A;  3IC6 A;  3AXZ A;  5GM8 A;  3DCM X;  4RG1 A;  2HA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...