4YQLA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
248
structure length
240
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 69
structure length 240
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqlA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqlA01
4FAKA 2CX8A 1X7OA 1J85A 3OIIA 4IG6A 1GZ0A 4H3ZA 3KW2A 2V3KA 4CNFA 1OY5A 4YQ0A 4YQQA 3KY7A 4CNEA 4XBOA 4YQ6A 4MCDA 3QUVA 4YQ9A 4YVHA 4YQKA 2I6DA 3KTYA 4L69A 4YVGA 5GM8A 1IPAA 2YY8A 4YQJA 3AI9X 5GMCA 3N4JA 3IEFA 1VHYA 1TO0A 1K3RA 3BBDA 5GMBA 4KDZA 4YQAA 4X3LA 2QWVA 4YQGA 2O3AA 4CNGA 4YQPA 3O7BA 4PZKA 3DCMX 5CO4A 1VHKA 4X3MA 4YQNA 2EGWA 4YQ8A 1P9PA 3BBHA 4YQ7A 3AXZA 4YQRA 4KGNA 2EGVA 3NK7A 3IC6A 3E5YA 1MXIA 3ILKA 5FAIA 3L8UA 4YVIA 1V2XA 2QMMA 3ONPA 4YPXA 4YVKA 3BBEA 4YQIA 4YQBA 4YQCA 4YPWA 3N4KA 4YQ2A 4YPZA 2V3JA 3OINA 4YPYA 4J3CA 4YQ4A 4E8BA 3KNUA 4YQ1A 1UALA 4JALA 4YQOA 1UAKA 1Z85A 4RG1A 1UAMA 4JAKA 1VH0A 4YQSA 4CNDA 1X7PA 2Z0YA 3AIAA 1NS5A 4H3YA 5D9FA 4YVJA 3GYQA 1UAJA 1NXZA 4MCCA 4YQTA 3OIJA 4MCBA 1ZJRA 4YQ3A 4YQDA 1O6DA 1V6ZA 4YQLA 3NK6A 4YQ5A 2HA8A
chains in the Genus database with same CATH superfamily
4FAKA 1ZT9A 2CX8A 1X7OA 1J85A 3OIIA 4IG6A 2XDIA 1GZ0A 4H3ZA 3KW2A 2V3KA 4CNFA 1OY5A 4YQ0A 4YQQA 3KY7A 1TRRA 4CNEA 4XBOA 4YQ6A 4MCDA 3QUVA 4YQ9A 4YVHA 4YQKA 2I6DA 3KTYA 4L69A 4YVGA 1JHGA 3FRWA 1IPAA 5GM8A 1WRPR 4YQJA 2YY8A 3AI9X 5GMCA 4JWFA 3N4JA 3WRPA 3IEFA 1VHYA 1TO0A 1CO0A 1K3RA 3BBDA 1TROA 5GMBA 4KDZA 4YQAA 4X3LA 2QWVA 2OZ9R 4YQGA 2O3AA 4CNGA 4YQPA 3O7BA 4PZKA 3DCMX 5CO4A 3G1CA 1VHKA 4X3MA 4YQNA 2EGWA 4YQ8A 4JWHA 1P9PA 3BBHA 4YQ7A 3AXZA 4YQRA 4KGNA 2EGVA 3NK7A 3IC6A 3E5YA 1MXIA 3SSWN 3ILKA 5FAIA 3L8UA 4YVIA 1V2XA 2QMMA 3ONPA 4YPXA 4YVKA 3BBEA 4YQIA 1WRTR 4YQBA 4YQCA 3SSXN 3KORA 4YPWA 3N4KA 4YQ2A 4YPZA 2V3JA 3OINA 4YPYA 4J3CA 4YQ4A 4E8BA 3KNUA 4YQ1A 1UALA 4JALA 4YQOA 1UAKA 1Z85A 4RG1A 1UAMA 4JAKA 1VH0A 4YQSA 4CNDA 1X7PA 2Z0YA 3AIAA 1NS5A 1WRSR 4H3YA 5D9FA 4FMWA 4YVJA 3GYQA 1UAJA 4JWGA 1MI7R 1NXZA 4MCCA 4YQTA 1RCSA 3OIJA 4JWJA 4MCBA 1ZJRA 4YQ3A 4YQDA 1O6DA 1V6ZA 4YQLA 3NK6A 4YQ5A 2HA8A
chains in the Genus database with same CATH topology
4FAKA 2CX8A 1X7OA 1J85A 3OIIA 4IG6A 1GZ0A 4H3ZA 3KW2A 2V3KA 4CNFA 1OY5A 4YQ0A 4YQQA 3KY7A 4CNEA 4XBOA 4YQ6A 4MCDA 3QUVA 4YQ9A 4YVHA 4YQKA 2I6DA 3KTYA 4L69A 4YVGA 5GM8A 1IPAA 2YY8A 4YQJA 3AI9X 5GMCA 4JWFA 3N4JA 3IEFA 1VHYA 1TO0A 1K3RA 3BBDA 5GMBA 4KDZA 4YQAA 4X3LA 2QWVA 4YQGA 2O3AA 4CNGA 4YQPA 3O7BA 4PZKA 3DCMX 5CO4A 1VHKA 4X3MA 4YQNA 2EGWA 4YQ8A 4JWHA 1P9PA 3BBHA 4YQ7A 3AXZA 4YQRA 4KGNA 2EGVA 3NK7A 3IC6A 3E5YA 1MXIA 3ILKA 5FAIA 3L8UA 4YVIA 1V2XA 2QMMA 3ONPA 4YPXA 4YVKA 3BBEA 4YQIA 4YQBA 4YQCA 4YPWA 3N4KA 4YQ2A 4YPZA 2V3JA 3OINA 4YPYA 4J3CA 4YQ4A 4E8BA 3KNUA 4YQ1A 1UALA 4JALA 4YQOA 1UAKA 1Z85A 4RG1A 1UAMA 4JAKA 1VH0A 4YQSA 4CNDA 1X7PA 2Z0YA 3AIAA 1NS5A 4H3YA 5D9FA 4FMWA 4YVJA 3GYQA 1UAJA 4JWGA 1NXZA 4MCCA 4YQTA 3OIJA 4JWJA 4MCBA 1ZJRA 4YQ3A 4YQDA 1O6DA 1V6ZA 4YQLA 3NK6A 4YQ5A 2HA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAK A;  2CX8 A;  1X7O A;  1J85 A;  3OII A;  4IG6 A;  1GZ0 A;  4H3Z A;  3KW2 A;  2V3K A;  4CNF A;  1OY5 A;  4YQ0 A;  4YQQ A;  3KY7 A;  4CNE A;  4XBO A;  4YQ6 A;  4MCD A;  3QUV A;  4YQ9 A;  4YVH A;  4YQK A;  2I6D A;  3KTY A;  4L69 A;  4YVG A;  5GM8 A;  1IPA A;  2YY8 A;  4YQJ A;  3AI9 X;  5GMC A;  3N4J A;  3IEF A;  1VHY A;  1TO0 A;  1K3R A;  3BBD A;  5GMB A;  4KDZ A;  4YQA A;  4X3L A;  2QWV A;  4YQG A;  2O3A A;  4CNG A;  4YQP A;  3O7B A;  4PZK A;  3DCM X;  5CO4 A;  1VHK A;  4X3M A;  4YQN A;  2EGW A;  4YQ8 A;  1P9P A;  3BBH A;  4YQ7 A;  3AXZ A;  4YQR A;  4KGN A;  2EGV A;  3NK7 A;  3IC6 A;  3E5Y A;  1MXI A;  3ILK A;  5FAI A;  3L8U A;  4YVI A;  1V2X A;  2QMM A;  3ONP A;  4YPX A;  4YVK A;  3BBE A;  4YQI A;  4YQB A;  4YQC A;  4YPW A;  3N4K A;  4YQ2 A;  4YPZ A;  2V3J A;  3OIN A;  4YPY A;  4J3C A;  4YQ4 A;  4E8B A;  3KNU A;  4YQ1 A;  1UAL A;  4JAL A;  4YQO A;  1UAK A;  1Z85 A;  4RG1 A;  1UAM A;  4JAK A;  1VH0 A;  4YQS A;  4CND A;  1X7P A;  2Z0Y A;  3AIA A;  1NS5 A;  4H3Y A;  5D9F A;  4YVJ A;  3GYQ A;  1UAJ A;  1NXZ A;  4MCC A;  4YQT A;  3OIJ A;  4MCB A;  1ZJR A;  4YQ3 A;  4YQD A;  1O6D A;  1V6Z A;  4YQL A;  3NK6 A;  4YQ5 A;  2HA8 A; 
#chains in the Genus database with same CATH topology
 4FAK A;  1ZT9 A;  2CX8 A;  1X7O A;  1J85 A;  3OII A;  4IG6 A;  2XDI A;  1GZ0 A;  4H3Z A;  3KW2 A;  2V3K A;  4CNF A;  1OY5 A;  4YQ0 A;  4YQQ A;  3KY7 A;  1TRR A;  4CNE A;  4XBO A;  4YQ6 A;  4MCD A;  3QUV A;  4YQ9 A;  4YVH A;  4YQK A;  2I6D A;  3KTY A;  4L69 A;  4YVG A;  1JHG A;  3FRW A;  1IPA A;  5GM8 A;  1WRP R;  4YQJ A;  2YY8 A;  3AI9 X;  5GMC A;  4JWF A;  3N4J A;  3WRP A;  3IEF A;  1VHY A;  1TO0 A;  1CO0 A;  1K3R A;  3BBD A;  1TRO A;  5GMB A;  4KDZ A;  4YQA A;  4X3L A;  2QWV A;  2OZ9 R;  4YQG A;  2O3A A;  4CNG A;  4YQP A;  3O7B A;  4PZK A;  3DCM X;  5CO4 A;  3G1C A;  1VHK A;  4X3M A;  4YQN A;  2EGW A;  4YQ8 A;  4JWH A;  1P9P A;  3BBH A;  4YQ7 A;  3AXZ A;  4YQR A;  4KGN A;  2EGV A;  3NK7 A;  3IC6 A;  3E5Y A;  1MXI A;  3SSW N;  3ILK A;  5FAI A;  3L8U A;  4YVI A;  1V2X A;  2QMM A;  3ONP A;  4YPX A;  4YVK A;  3BBE A;  4YQI A;  1WRT R;  4YQB A;  4YQC A;  3SSX N;  3KOR A;  4YPW A;  3N4K A;  4YQ2 A;  4YPZ A;  2V3J A;  3OIN A;  4YPY A;  4J3C A;  4YQ4 A;  4E8B A;  3KNU A;  4YQ1 A;  1UAL A;  4JAL A;  4YQO A;  1UAK A;  1Z85 A;  4RG1 A;  1UAM A;  4JAK A;  1VH0 A;  4YQS A;  4CND A;  1X7P A;  2Z0Y A;  3AIA A;  1NS5 A;  1WRS R;  4H3Y A;  5D9F A;  4FMW A;  4YVJ A;  3GYQ A;  1UAJ A;  4JWG A;  1MI7 R;  1NXZ A;  4MCC A;  4YQT A;  1RCS A;  3OIJ A;  4JWJ A;  4MCB A;  1ZJR A;  4YQ3 A;  4YQD A;  1O6D A;  1V6Z A;  4YQL A;  3NK6 A;  4YQ5 A;  2HA8 A; 
#chains in the Genus database with same CATH homology
 4FAK A;  2CX8 A;  1X7O A;  1J85 A;  3OII A;  4IG6 A;  1GZ0 A;  4H3Z A;  3KW2 A;  2V3K A;  4CNF A;  1OY5 A;  4YQ0 A;  4YQQ A;  3KY7 A;  4CNE A;  4XBO A;  4YQ6 A;  4MCD A;  3QUV A;  4YQ9 A;  4YVH A;  4YQK A;  2I6D A;  3KTY A;  4L69 A;  4YVG A;  5GM8 A;  1IPA A;  2YY8 A;  4YQJ A;  3AI9 X;  5GMC A;  4JWF A;  3N4J A;  3IEF A;  1VHY A;  1TO0 A;  1K3R A;  3BBD A;  5GMB A;  4KDZ A;  4YQA A;  4X3L A;  2QWV A;  4YQG A;  2O3A A;  4CNG A;  4YQP A;  3O7B A;  4PZK A;  3DCM X;  5CO4 A;  1VHK A;  4X3M A;  4YQN A;  2EGW A;  4YQ8 A;  4JWH A;  1P9P A;  3BBH A;  4YQ7 A;  3AXZ A;  4YQR A;  4KGN A;  2EGV A;  3NK7 A;  3IC6 A;  3E5Y A;  1MXI A;  3ILK A;  5FAI A;  3L8U A;  4YVI A;  1V2X A;  2QMM A;  3ONP A;  4YPX A;  4YVK A;  3BBE A;  4YQI A;  4YQB A;  4YQC A;  4YPW A;  3N4K A;  4YQ2 A;  4YPZ A;  2V3J A;  3OIN A;  4YPY A;  4J3C A;  4YQ4 A;  4E8B A;  3KNU A;  4YQ1 A;  1UAL A;  4JAL A;  4YQO A;  1UAK A;  1Z85 A;  4RG1 A;  1UAM A;  4JAK A;  1VH0 A;  4YQS A;  4CND A;  1X7P A;  2Z0Y A;  3AIA A;  1NS5 A;  4H3Y A;  5D9F A;  4FMW A;  4YVJ A;  3GYQ A;  1UAJ A;  4JWG A;  1NXZ A;  4MCC A;  4YQT A;  3OIJ A;  4JWJ A;  4MCB A;  1ZJR A;  4YQ3 A;  4YQD A;  1O6D A;  1V6Z A;  4YQL A;  3NK6 A;  4YQ5 A;  2HA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...