4YQ0A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
249
structure length
238
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 73
structure length 238
sequence length 249
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq0A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq0A01
1IPAA 4H3YA 4KDZA 3OIJA 1UAMA 4YQ9A 4MCBA 1P9PA 4YQAA 4YQ8A 1MXIA 4YVJA 3ONPA 1VHYA 3KW2A 1Z85A 2QWVA 4RG1A 4YQBA 5GM8A 4MCCA 5D9FA 1ZJRA 1NXZA 5GMBA 4YQOA 1UAJA 4JAKA 1GZ0A 4YQ7A 2HA8A 4MCDA 4XBOA 4YQ6A 4YQCA 1O6DA 1K3RA 3ILKA 3DCMX 1NS5A 2YY8A 4YQIA 3BBDA 4L69A 4YQ1A 4CNFA 3AIAA 4YQSA 4YQ2A 4YQNA 4YQ3A 1VH0A 4YQJA 4YPXA 3KNUA 4CNDA 1UAKA 1J85A 2I6DA 4FAKA 3O7BA 3IEFA 2EGVA 4JALA 4CNEA 4H3ZA 3BBHA 4PZKA 2O3AA 4E8BA 3L8UA 3OINA 3N4JA 4X3MA 4KGNA 3OIIA 4YPYA 4YQLA 4YQQA 3NK7A 4YQRA 1V2XA 1UALA 4YQ0A 4YVKA 4YQKA 3N4KA 1X7OA 2QMMA 5CO4A 4YQ5A 1V6ZA 3BBEA 3QUVA 4YQDA 4YPWA 3AXZA 1TO0A 2V3JA 2Z0YA 3AI9X 3NK6A 5FAIA 4YQ4A 4YVGA 2CX8A 1OY5A 5GMCA 3IC6A 4YPZA 4CNGA 3KY7A 2EGWA 1X7PA 4IG6A 4YQPA 4YQGA 1VHKA 4YVHA 4YVIA 2V3KA 4J3CA 4YQTA 3E5YA 3KTYA 4X3LA 3GYQA
chains in the Genus database with same CATH superfamily
1IPAA 4H3YA 4KDZA 3OIJA 1UAMA 4YQ9A 4MCBA 3KORA 1P9PA 4YQAA 4YQ8A 1MXIA 4YVJA 3ONPA 1VHYA 3KW2A 1Z85A 2QWVA 4RG1A 4YQBA 5GM8A 4MCCA 5D9FA 1ZJRA 1NXZA 5GMBA 4YQOA 1UAJA 4FMWA 4JAKA 1GZ0A 4YQ7A 2HA8A 4MCDA 4XBOA 4YQ6A 1ZT9A 4YQCA 1O6DA 1K3RA 3ILKA 4JWFA 3DCMX 1NS5A 2YY8A 1CO0A 4YQIA 3BBDA 4L69A 1JHGA 1WRTR 4YQ1A 4CNFA 1TRRA 3AIAA 3FRWA 4YQSA 4YQ2A 4YQNA 4YQ3A 1VH0A 4YQJA 4YPXA 3KNUA 4CNDA 1UAKA 1J85A 2I6DA 4FAKA 3O7BA 1WRSR 3IEFA 2EGVA 4JALA 3SSXN 4CNEA 4H3ZA 1WRPR 3BBHA 4PZKA 2O3AA 4E8BA 3L8UA 3OINA 3N4JA 4X3MA 4KGNA 3OIIA 2XDIA 4YPYA 4YQQA 4YQLA 3NK7A 4YQRA 4JWJA 1V2XA 1UALA 4YQ0A 4YVKA 4JWGA 4YQKA 3N4KA 1X7OA 2QMMA 5CO4A 4YQ5A 1MI7R 1V6ZA 3BBEA 3SSWN 3QUVA 4YQDA 4YPWA 3G1CA 1RCSA 3AXZA 1TO0A 2V3JA 2Z0YA 3AI9X 3NK6A 5FAIA 4YQ4A 4YVGA 2CX8A 1OY5A 5GMCA 3IC6A 4YPZA 1TROA 4CNGA 3KY7A 2EGWA 1X7PA 4IG6A 4YQPA 4YQGA 1VHKA 4YVHA 4YVIA 4JWHA 2V3KA 3WRPA 4J3CA 4YQTA 3E5YA 3KTYA 4X3LA 2OZ9R 3GYQA
chains in the Genus database with same CATH topology
1IPAA 4H3YA 4KDZA 3OIJA 1UAMA 4YQ9A 4MCBA 1P9PA 4YQAA 4YQ8A 1MXIA 4YVJA 3ONPA 1VHYA 3KW2A 1Z85A 2QWVA 4RG1A 4YQBA 5GM8A 4MCCA 5D9FA 1ZJRA 1NXZA 5GMBA 4YQOA 1UAJA 4FMWA 4JAKA 1GZ0A 4YQ7A 2HA8A 4MCDA 4XBOA 4YQ6A 4YQCA 1O6DA 1K3RA 3ILKA 4JWFA 3DCMX 1NS5A 2YY8A 4YQIA 3BBDA 4L69A 4YQ1A 4CNFA 3AIAA 4YQSA 4YQ2A 4YQNA 4YQ3A 1VH0A 4YQJA 4YPXA 3KNUA 4CNDA 1UAKA 1J85A 2I6DA 4FAKA 3O7BA 3IEFA 2EGVA 4JALA 4CNEA 4H3ZA 3BBHA 4PZKA 2O3AA 4E8BA 3L8UA 3OINA 3N4JA 4X3MA 4KGNA 3OIIA 4YPYA 4YQLA 4YQQA 3NK7A 4YQRA 4JWJA 1V2XA 1UALA 4YQ0A 4YVKA 4JWGA 4YQKA 3N4KA 1X7OA 2QMMA 5CO4A 4YQ5A 1V6ZA 3BBEA 3QUVA 4YQDA 4YPWA 3AXZA 1TO0A 2V3JA 2Z0YA 3AI9X 3NK6A 5FAIA 4YQ4A 4YVGA 2CX8A 1OY5A 5GMCA 3IC6A 4YPZA 4CNGA 3KY7A 2EGWA 1X7PA 4IG6A 4YQPA 4YQGA 1VHKA 4YVHA 4YVIA 4JWHA 2V3KA 4J3CA 4YQTA 3E5YA 3KTYA 4X3LA 3GYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IPA A;  4H3Y A;  4KDZ A;  3OIJ A;  1UAM A;  4YQ9 A;  4MCB A;  1P9P A;  4YQA A;  4YQ8 A;  1MXI A;  4YVJ A;  3ONP A;  1VHY A;  3KW2 A;  1Z85 A;  2QWV A;  4RG1 A;  4YQB A;  5GM8 A;  4MCC A;  5D9F A;  1ZJR A;  1NXZ A;  5GMB A;  4YQO A;  1UAJ A;  4JAK A;  1GZ0 A;  4YQ7 A;  2HA8 A;  4MCD A;  4XBO A;  4YQ6 A;  4YQC A;  1O6D A;  1K3R A;  3ILK A;  3DCM X;  1NS5 A;  2YY8 A;  4YQI A;  3BBD A;  4L69 A;  4YQ1 A;  4CNF A;  3AIA A;  4YQS A;  4YQ2 A;  4YQN A;  4YQ3 A;  1VH0 A;  4YQJ A;  4YPX A;  3KNU A;  4CND A;  1UAK A;  1J85 A;  2I6D A;  4FAK A;  3O7B A;  3IEF A;  2EGV A;  4JAL A;  4CNE A;  4H3Z A;  3BBH A;  4PZK A;  2O3A A;  4E8B A;  3L8U A;  3OIN A;  3N4J A;  4X3M A;  4KGN A;  3OII A;  4YPY A;  4YQL A;  4YQQ A;  3NK7 A;  4YQR A;  1V2X A;  1UAL A;  4YQ0 A;  4YVK A;  4YQK A;  3N4K A;  1X7O A;  2QMM A;  5CO4 A;  4YQ5 A;  1V6Z A;  3BBE A;  3QUV A;  4YQD A;  4YPW A;  3AXZ A;  1TO0 A;  2V3J A;  2Z0Y A;  3AI9 X;  3NK6 A;  5FAI A;  4YQ4 A;  4YVG A;  2CX8 A;  1OY5 A;  5GMC A;  3IC6 A;  4YPZ A;  4CNG A;  3KY7 A;  2EGW A;  1X7P A;  4IG6 A;  4YQP A;  4YQG A;  1VHK A;  4YVH A;  4YVI A;  2V3K A;  4J3C A;  4YQT A;  3E5Y A;  3KTY A;  4X3L A;  3GYQ A; 
#chains in the Genus database with same CATH topology
 1IPA A;  4H3Y A;  4KDZ A;  3OIJ A;  1UAM A;  4YQ9 A;  4MCB A;  3KOR A;  1P9P A;  4YQA A;  4YQ8 A;  1MXI A;  4YVJ A;  3ONP A;  1VHY A;  3KW2 A;  1Z85 A;  2QWV A;  4RG1 A;  4YQB A;  5GM8 A;  4MCC A;  5D9F A;  1ZJR A;  1NXZ A;  5GMB A;  4YQO A;  1UAJ A;  4FMW A;  4JAK A;  1GZ0 A;  4YQ7 A;  2HA8 A;  4MCD A;  4XBO A;  4YQ6 A;  1ZT9 A;  4YQC A;  1O6D A;  1K3R A;  3ILK A;  4JWF A;  3DCM X;  1NS5 A;  2YY8 A;  1CO0 A;  4YQI A;  3BBD A;  4L69 A;  1JHG A;  1WRT R;  4YQ1 A;  4CNF A;  1TRR A;  3AIA A;  3FRW A;  4YQS A;  4YQ2 A;  4YQN A;  4YQ3 A;  1VH0 A;  4YQJ A;  4YPX A;  3KNU A;  4CND A;  1UAK A;  1J85 A;  2I6D A;  4FAK A;  3O7B A;  1WRS R;  3IEF A;  2EGV A;  4JAL A;  3SSX N;  4CNE A;  4H3Z A;  1WRP R;  3BBH A;  4PZK A;  2O3A A;  4E8B A;  3L8U A;  3OIN A;  3N4J A;  4X3M A;  4KGN A;  3OII A;  2XDI A;  4YPY A;  4YQQ A;  4YQL A;  3NK7 A;  4YQR A;  4JWJ A;  1V2X A;  1UAL A;  4YQ0 A;  4YVK A;  4JWG A;  4YQK A;  3N4K A;  1X7O A;  2QMM A;  5CO4 A;  4YQ5 A;  1MI7 R;  1V6Z A;  3BBE A;  3SSW N;  3QUV A;  4YQD A;  4YPW A;  3G1C A;  1RCS A;  3AXZ A;  1TO0 A;  2V3J A;  2Z0Y A;  3AI9 X;  3NK6 A;  5FAI A;  4YQ4 A;  4YVG A;  2CX8 A;  1OY5 A;  5GMC A;  3IC6 A;  4YPZ A;  1TRO A;  4CNG A;  3KY7 A;  2EGW A;  1X7P A;  4IG6 A;  4YQP A;  4YQG A;  1VHK A;  4YVH A;  4YVI A;  4JWH A;  2V3K A;  3WRP A;  4J3C A;  4YQT A;  3E5Y A;  3KTY A;  4X3L A;  2OZ9 R;  3GYQ A; 
#chains in the Genus database with same CATH homology
 1IPA A;  4H3Y A;  4KDZ A;  3OIJ A;  1UAM A;  4YQ9 A;  4MCB A;  1P9P A;  4YQA A;  4YQ8 A;  1MXI A;  4YVJ A;  3ONP A;  1VHY A;  3KW2 A;  1Z85 A;  2QWV A;  4RG1 A;  4YQB A;  5GM8 A;  4MCC A;  5D9F A;  1ZJR A;  1NXZ A;  5GMB A;  4YQO A;  1UAJ A;  4FMW A;  4JAK A;  1GZ0 A;  4YQ7 A;  2HA8 A;  4MCD A;  4XBO A;  4YQ6 A;  4YQC A;  1O6D A;  1K3R A;  3ILK A;  4JWF A;  3DCM X;  1NS5 A;  2YY8 A;  4YQI A;  3BBD A;  4L69 A;  4YQ1 A;  4CNF A;  3AIA A;  4YQS A;  4YQ2 A;  4YQN A;  4YQ3 A;  1VH0 A;  4YQJ A;  4YPX A;  3KNU A;  4CND A;  1UAK A;  1J85 A;  2I6D A;  4FAK A;  3O7B A;  3IEF A;  2EGV A;  4JAL A;  4CNE A;  4H3Z A;  3BBH A;  4PZK A;  2O3A A;  4E8B A;  3L8U A;  3OIN A;  3N4J A;  4X3M A;  4KGN A;  3OII A;  4YPY A;  4YQL A;  4YQQ A;  3NK7 A;  4YQR A;  4JWJ A;  1V2X A;  1UAL A;  4YQ0 A;  4YVK A;  4JWG A;  4YQK A;  3N4K A;  1X7O A;  2QMM A;  5CO4 A;  4YQ5 A;  1V6Z A;  3BBE A;  3QUV A;  4YQD A;  4YPW A;  3AXZ A;  1TO0 A;  2V3J A;  2Z0Y A;  3AI9 X;  3NK6 A;  5FAI A;  4YQ4 A;  4YVG A;  2CX8 A;  1OY5 A;  5GMC A;  3IC6 A;  4YPZ A;  4CNG A;  3KY7 A;  2EGW A;  1X7P A;  4IG6 A;  4YQP A;  4YQG A;  1VHK A;  4YVH A;  4YVI A;  4JWH A;  2V3K A;  4J3C A;  4YQT A;  3E5Y A;  3KTY A;  4X3L A;  3GYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...