4YQNA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
237
Chain Sequence
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 71
structure length 237
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yqnA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yqnA01
3BBHA 4YQPA 4YQ6A 1VHKA 4YQ4A 4YVJA 4J3CA 1TO0A 4CNEA 3N4KA 4YPYA 4MCBA 1V2XA 4YVGA 3IEFA 4FAKA 3BBEA 3ONPA 4JAKA 3NK7A 2V3JA 2V3KA 4CNGA 3AI9X 1UAKA 1K3RA 3KW2A 4YVHA 1Z85A 2I6DA 2HA8A 3L8UA 4YQ3A 3GYQA 4IG6A 3NK6A 4MCCA 5GM8A 4X3LA 3QUVA 4YPWA 4YQ2A 4KDZA 5FAIA 4YQAA 4YQLA 4YQOA 4YQNA 4YQ0A 4YQ1A 1ZJRA 3KNUA 5CO4A 1UAMA 4YQ9A 4YQ7A 3KTYA 4YVIA 1UALA 4KGNA 4YQDA 4YVKA 4CNDA 1IPAA 4YQ5A 2YY8A 4MCDA 4YQ8A 4YQCA 3AIAA 1UAJA 1OY5A 3IC6A 4H3YA 3BBDA 2EGWA 4L69A 1V6ZA 4E8BA 5GMBA 3KY7A 4X3MA 1NXZA 2O3AA 3O7BA 3OIJA 4YQKA 5D9FA 4RG1A 4JALA 3E5YA 2QWVA 5GMCA 2QMMA 4YQGA 4YQJA 4PZKA 4XBOA 1X7OA 3OINA 1GZ0A 1MXIA 3DCMX 1VHYA 4H3ZA 3ILKA 4YQBA 2EGVA 1X7PA 4CNFA 4YQSA 3OIIA 1P9PA 4YQTA 3N4JA 1VH0A 2Z0YA 4YPZA 3AXZA 4YPXA 1NS5A 1O6DA 4YQRA 4YQIA 4YQQA 2CX8A 1J85A
chains in the Genus database with same CATH superfamily
3FRWA 3BBHA 4YQPA 4YQ6A 4JWGA 4FMWA 1VHKA 4YQ4A 1TROA 1RCSA 4YVJA 1JHGA 4J3CA 1TO0A 4CNEA 3N4KA 4YPYA 4MCBA 1V2XA 1TRRA 4YVGA 3IEFA 4FAKA 3WRPA 3BBEA 3ONPA 1ZT9A 3SSXN 1MI7R 4JAKA 3NK7A 2V3JA 2V3KA 4CNGA 3G1CA 3AI9X 1UAKA 1K3RA 3KW2A 4YVHA 1Z85A 2OZ9R 2HA8A 2I6DA 3L8UA 4YQ3A 2XDIA 4IG6A 3GYQA 3NK6A 4MCCA 5GM8A 4X3LA 3QUVA 4YPWA 1CO0A 4JWJA 4JWFA 4YQ2A 4KDZA 5FAIA 4YQAA 4YQLA 4YQOA 4YQNA 4YQ0A 4YQ1A 1ZJRA 3SSWN 3KNUA 3KORA 5CO4A 1UAMA 4YQ9A 4YQ7A 3KTYA 4YVIA 1UALA 4KGNA 4YQDA 1WRSR 4YVKA 4CNDA 1IPAA 4YQ5A 2YY8A 4MCDA 4YQ8A 4YQCA 3AIAA 1UAJA 1OY5A 3IC6A 4H3YA 3BBDA 2EGWA 4L69A 1V6ZA 4E8BA 5GMBA 3KY7A 4X3MA 1NXZA 1WRTR 2O3AA 3O7BA 3OIJA 4YQKA 5D9FA 4RG1A 4JALA 4JWHA 3E5YA 2QWVA 5GMCA 2QMMA 4YQGA 4YQJA 4PZKA 1WRPR 4XBOA 1X7OA 3OINA 1GZ0A 1MXIA 3DCMX 1VHYA 4H3ZA 3ILKA 4YQBA 2EGVA 1X7PA 4CNFA 4YQSA 3OIIA 1P9PA 4YQTA 3N4JA 1VH0A 2Z0YA 4YPZA 3AXZA 4YPXA 1NS5A 1O6DA 4YQRA 4YQIA 4YQQA 2CX8A 1J85A
chains in the Genus database with same CATH topology
3BBHA 4YQPA 4YQ6A 4JWGA 4FMWA 1VHKA 4YQ4A 4YVJA 4J3CA 1TO0A 4CNEA 3N4KA 4YPYA 4MCBA 1V2XA 4YVGA 3IEFA 4FAKA 3BBEA 3ONPA 4JAKA 3NK7A 2V3JA 2V3KA 4CNGA 3AI9X 1UAKA 1K3RA 3KW2A 4YVHA 1Z85A 2I6DA 2HA8A 3L8UA 4YQ3A 3GYQA 4IG6A 3NK6A 4MCCA 5GM8A 4X3LA 3QUVA 4YPWA 4JWJA 4JWFA 4YQ2A 4KDZA 5FAIA 4YQAA 4YQLA 4YQOA 4YQNA 4YQ0A 4YQ1A 1ZJRA 3KNUA 5CO4A 1UAMA 4YQ9A 4YQ7A 3KTYA 4YVIA 1UALA 4KGNA 4YQDA 4YVKA 4CNDA 1IPAA 4YQ5A 2YY8A 4MCDA 4YQ8A 4YQCA 3AIAA 1UAJA 1OY5A 3IC6A 4H3YA 3BBDA 2EGWA 4L69A 1V6ZA 4E8BA 5GMBA 3KY7A 4X3MA 1NXZA 2O3AA 3O7BA 3OIJA 4YQKA 5D9FA 4RG1A 4JALA 4JWHA 3E5YA 2QWVA 5GMCA 2QMMA 4YQGA 4YQJA 4PZKA 4XBOA 1X7OA 3OINA 1GZ0A 1MXIA 3DCMX 1VHYA 4H3ZA 3ILKA 4YQBA 2EGVA 1X7PA 4CNFA 4YQSA 3OIIA 1P9PA 4YQTA 3N4JA 1VH0A 2Z0YA 4YPZA 3AXZA 4YPXA 1NS5A 1O6DA 4YQRA 4YQIA 4YQQA 2CX8A 1J85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBH A;  4YQP A;  4YQ6 A;  1VHK A;  4YQ4 A;  4YVJ A;  4J3C A;  1TO0 A;  4CNE A;  3N4K A;  4YPY A;  4MCB A;  1V2X A;  4YVG A;  3IEF A;  4FAK A;  3BBE A;  3ONP A;  4JAK A;  3NK7 A;  2V3J A;  2V3K A;  4CNG A;  3AI9 X;  1UAK A;  1K3R A;  3KW2 A;  4YVH A;  1Z85 A;  2I6D A;  2HA8 A;  3L8U A;  4YQ3 A;  3GYQ A;  4IG6 A;  3NK6 A;  4MCC A;  5GM8 A;  4X3L A;  3QUV A;  4YPW A;  4YQ2 A;  4KDZ A;  5FAI A;  4YQA A;  4YQL A;  4YQO A;  4YQN A;  4YQ0 A;  4YQ1 A;  1ZJR A;  3KNU A;  5CO4 A;  1UAM A;  4YQ9 A;  4YQ7 A;  3KTY A;  4YVI A;  1UAL A;  4KGN A;  4YQD A;  4YVK A;  4CND A;  1IPA A;  4YQ5 A;  2YY8 A;  4MCD A;  4YQ8 A;  4YQC A;  3AIA A;  1UAJ A;  1OY5 A;  3IC6 A;  4H3Y A;  3BBD A;  2EGW A;  4L69 A;  1V6Z A;  4E8B A;  5GMB A;  3KY7 A;  4X3M A;  1NXZ A;  2O3A A;  3O7B A;  3OIJ A;  4YQK A;  5D9F A;  4RG1 A;  4JAL A;  3E5Y A;  2QWV A;  5GMC A;  2QMM A;  4YQG A;  4YQJ A;  4PZK A;  4XBO A;  1X7O A;  3OIN A;  1GZ0 A;  1MXI A;  3DCM X;  1VHY A;  4H3Z A;  3ILK A;  4YQB A;  2EGV A;  1X7P A;  4CNF A;  4YQS A;  3OII A;  1P9P A;  4YQT A;  3N4J A;  1VH0 A;  2Z0Y A;  4YPZ A;  3AXZ A;  4YPX A;  1NS5 A;  1O6D A;  4YQR A;  4YQI A;  4YQQ A;  2CX8 A;  1J85 A; 
#chains in the Genus database with same CATH topology
 3FRW A;  3BBH A;  4YQP A;  4YQ6 A;  4JWG A;  4FMW A;  1VHK A;  4YQ4 A;  1TRO A;  1RCS A;  4YVJ A;  1JHG A;  4J3C A;  1TO0 A;  4CNE A;  3N4K A;  4YPY A;  4MCB A;  1V2X A;  1TRR A;  4YVG A;  3IEF A;  4FAK A;  3WRP A;  3BBE A;  3ONP A;  1ZT9 A;  3SSX N;  1MI7 R;  4JAK A;  3NK7 A;  2V3J A;  2V3K A;  4CNG A;  3G1C A;  3AI9 X;  1UAK A;  1K3R A;  3KW2 A;  4YVH A;  1Z85 A;  2OZ9 R;  2HA8 A;  2I6D A;  3L8U A;  4YQ3 A;  2XDI A;  4IG6 A;  3GYQ A;  3NK6 A;  4MCC A;  5GM8 A;  4X3L A;  3QUV A;  4YPW A;  1CO0 A;  4JWJ A;  4JWF A;  4YQ2 A;  4KDZ A;  5FAI A;  4YQA A;  4YQL A;  4YQO A;  4YQN A;  4YQ0 A;  4YQ1 A;  1ZJR A;  3SSW N;  3KNU A;  3KOR A;  5CO4 A;  1UAM A;  4YQ9 A;  4YQ7 A;  3KTY A;  4YVI A;  1UAL A;  4KGN A;  4YQD A;  1WRS R;  4YVK A;  4CND A;  1IPA A;  4YQ5 A;  2YY8 A;  4MCD A;  4YQ8 A;  4YQC A;  3AIA A;  1UAJ A;  1OY5 A;  3IC6 A;  4H3Y A;  3BBD A;  2EGW A;  4L69 A;  1V6Z A;  4E8B A;  5GMB A;  3KY7 A;  4X3M A;  1NXZ A;  1WRT R;  2O3A A;  3O7B A;  3OIJ A;  4YQK A;  5D9F A;  4RG1 A;  4JAL A;  4JWH A;  3E5Y A;  2QWV A;  5GMC A;  2QMM A;  4YQG A;  4YQJ A;  4PZK A;  1WRP R;  4XBO A;  1X7O A;  3OIN A;  1GZ0 A;  1MXI A;  3DCM X;  1VHY A;  4H3Z A;  3ILK A;  4YQB A;  2EGV A;  1X7P A;  4CNF A;  4YQS A;  3OII A;  1P9P A;  4YQT A;  3N4J A;  1VH0 A;  2Z0Y A;  4YPZ A;  3AXZ A;  4YPX A;  1NS5 A;  1O6D A;  4YQR A;  4YQI A;  4YQQ A;  2CX8 A;  1J85 A; 
#chains in the Genus database with same CATH homology
 3BBH A;  4YQP A;  4YQ6 A;  4JWG A;  4FMW A;  1VHK A;  4YQ4 A;  4YVJ A;  4J3C A;  1TO0 A;  4CNE A;  3N4K A;  4YPY A;  4MCB A;  1V2X A;  4YVG A;  3IEF A;  4FAK A;  3BBE A;  3ONP A;  4JAK A;  3NK7 A;  2V3J A;  2V3K A;  4CNG A;  3AI9 X;  1UAK A;  1K3R A;  3KW2 A;  4YVH A;  1Z85 A;  2I6D A;  2HA8 A;  3L8U A;  4YQ3 A;  3GYQ A;  4IG6 A;  3NK6 A;  4MCC A;  5GM8 A;  4X3L A;  3QUV A;  4YPW A;  4JWJ A;  4JWF A;  4YQ2 A;  4KDZ A;  5FAI A;  4YQA A;  4YQL A;  4YQO A;  4YQN A;  4YQ0 A;  4YQ1 A;  1ZJR A;  3KNU A;  5CO4 A;  1UAM A;  4YQ9 A;  4YQ7 A;  3KTY A;  4YVI A;  1UAL A;  4KGN A;  4YQD A;  4YVK A;  4CND A;  1IPA A;  4YQ5 A;  2YY8 A;  4MCD A;  4YQ8 A;  4YQC A;  3AIA A;  1UAJ A;  1OY5 A;  3IC6 A;  4H3Y A;  3BBD A;  2EGW A;  4L69 A;  1V6Z A;  4E8B A;  5GMB A;  3KY7 A;  4X3M A;  1NXZ A;  2O3A A;  3O7B A;  3OIJ A;  4YQK A;  5D9F A;  4RG1 A;  4JAL A;  4JWH A;  3E5Y A;  2QWV A;  5GMC A;  2QMM A;  4YQG A;  4YQJ A;  4PZK A;  4XBO A;  1X7O A;  3OIN A;  1GZ0 A;  1MXI A;  3DCM X;  1VHY A;  4H3Z A;  3ILK A;  4YQB A;  2EGV A;  1X7P A;  4CNF A;  4YQS A;  3OII A;  1P9P A;  4YQT A;  3N4J A;  1VH0 A;  2Z0Y A;  4YPZ A;  3AXZ A;  4YPX A;  1NS5 A;  1O6D A;  4YQR A;  4YQI A;  4YQQ A;  2CX8 A;  1J85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...