4MCDA

Hintrmd in complex with 5-phenylthieno[2,3-d]pyrimidin-4(3h)-one
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
246
structure length
237
Chain Sequence
MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Selective Inhibitors of Bacterial t-RNA-(N(1)G37) Methyltransferase (TrmD) That Demonstrate Novel Ordering of the Lid Domain.
pubmed doi rcsb
source organism Haemophilus influenzae rd kw20
total genus 69
structure length 237
sequence length 246
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4mcdA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4mcdA01
4YQIA 1X7PA 1O6DA 4YQ1A 2O3AA 4PZKA 4YQDA 3DCMX 4MCBA 2V3KA 4JALA 2EGVA 1NXZA 2Z0YA 4YPXA 1UAKA 3OIIA 4YQKA 1TO0A 4YQRA 1VH0A 4RG1A 3NK6A 1UALA 4H3ZA 4YQJA 1X7OA 4MCDA 4CNDA 4CNEA 4YQLA 4XBOA 4YQ6A 3NK7A 4YQOA 2CX8A 4H3YA 3E5YA 1NS5A 1IPAA 4X3MA 1J85A 3ILKA 4YVGA 4YVHA 4YQ9A 4YVKA 4YQNA 3AXZA 5D9FA 4X3LA 3QUVA 2HA8A 1GZ0A 3AI9X 5CO4A 4JAKA 4YQ2A 4YQ4A 3BBDA 1OY5A 2YY8A 5FAIA 3KY7A 4J3CA 1VHYA 5GM8A 4YPYA 4YVJA 4YQ8A 3O7BA 4MCCA 2QMMA 4YQTA 4YQSA 4YQ3A 4YVIA 4E8BA 3BBHA 1K3RA 2V3JA 1P9PA 4YPZA 3IC6A 3BBEA 3KTYA 3N4JA 3IEFA 3KW2A 3AIAA 3ONPA 4L69A 4YQAA 5GMCA 4YQPA 4CNFA 4KDZA 4YQCA 3KNUA 1UAJA 4YPWA 2I6DA 1UAMA 4YQBA 1MXIA 2QWVA 3GYQA 3N4KA 4CNGA 1V2XA 4FAKA 3L8UA 4YQ0A 4YQQA 3OIJA 3OINA 1Z85A 1VHKA 4YQGA 4YQ7A 4IG6A 4YQ5A 4KGNA 5GMBA 1ZJRA 2EGWA 1V6ZA
chains in the Genus database with same CATH superfamily
4YQIA 1X7PA 1O6DA 4YQ1A 2O3AA 4PZKA 4JWGA 4YQDA 3DCMX 4MCBA 2V3KA 4JALA 1NXZA 2EGVA 1WRSR 2Z0YA 4YPXA 1UAKA 3OIIA 4YQKA 1TO0A 4YQRA 1VH0A 4RG1A 3NK6A 1UALA 4H3ZA 4YQJA 1X7OA 4MCDA 1TROA 4CNDA 4CNEA 4YQLA 4XBOA 4YQ6A 3NK7A 4YQOA 2CX8A 4H3YA 1WRTR 3E5YA 1NS5A 1IPAA 3SSWN 4X3MA 1J85A 1RCSA 3ILKA 4YVGA 4YVHA 4YQ9A 4YVKA 4JWHA 4YQNA 3AXZA 5D9FA 4X3LA 3QUVA 2HA8A 1WRPR 1GZ0A 3AI9X 5CO4A 4JAKA 4YQ2A 1CO0A 3FRWA 1ZT9A 4YQ4A 2OZ9R 3BBDA 1OY5A 2YY8A 5FAIA 3KY7A 3SSXN 4J3CA 1VHYA 5GM8A 4YPYA 4YVJA 4YQ8A 3O7BA 4MCCA 2QMMA 4YQTA 4YQSA 4YQ3A 4YVIA 4E8BA 3BBHA 2XDIA 1K3RA 2V3JA 1P9PA 4YPZA 3IC6A 3WRPA 3BBEA 3KTYA 1JHGA 3N4JA 3IEFA 3KW2A 3AIAA 3G1CA 3ONPA 4L69A 4YQAA 5GMCA 3KORA 4YQPA 4CNFA 4KDZA 4YQCA 3KNUA 1UAJA 4YPWA 2I6DA 1UAMA 4YQBA 1MXIA 2QWVA 3GYQA 3N4KA 4CNGA 1V2XA 4FMWA 4FAKA 3L8UA 4YQ0A 4YQQA 3OIJA 3OINA 1Z85A 4YQGA 1VHKA 1TRRA 4YQ7A 4IG6A 4YQ5A 4JWJA 4KGNA 1ZJRA 5GMBA 2EGWA 4JWFA 1MI7R 1V6ZA
chains in the Genus database with same CATH topology
4YQIA 1X7PA 1O6DA 4YQ1A 2O3AA 4PZKA 4JWGA 4YQDA 3DCMX 4MCBA 2V3KA 4JALA 2EGVA 1NXZA 2Z0YA 4YPXA 1UAKA 3OIIA 4YQKA 1TO0A 4YQRA 1VH0A 4RG1A 3NK6A 1UALA 4H3ZA 4YQJA 1X7OA 4MCDA 4CNDA 4CNEA 4YQLA 4XBOA 4YQ6A 3NK7A 4YQOA 2CX8A 4H3YA 3E5YA 1NS5A 1IPAA 4X3MA 1J85A 3ILKA 4YVGA 4YVHA 4YQ9A 4YVKA 4JWHA 4YQNA 3AXZA 5D9FA 4X3LA 3QUVA 2HA8A 1GZ0A 3AI9X 5CO4A 4JAKA 4YQ2A 4YQ4A 3BBDA 1OY5A 2YY8A 5FAIA 3KY7A 4J3CA 1VHYA 5GM8A 4YPYA 4YVJA 4YQ8A 3O7BA 4MCCA 2QMMA 4YQTA 4YQSA 4YQ3A 4YVIA 4E8BA 3BBHA 1K3RA 2V3JA 1P9PA 4YPZA 3IC6A 3BBEA 3KTYA 3N4JA 3IEFA 3KW2A 3AIAA 3ONPA 4L69A 4YQAA 5GMCA 4YQPA 4CNFA 4KDZA 4YQCA 3KNUA 1UAJA 4YPWA 2I6DA 1UAMA 4YQBA 1MXIA 2QWVA 3GYQA 3N4KA 4CNGA 1V2XA 4FMWA 4FAKA 3L8UA 4YQ0A 4YQQA 3OIJA 3OINA 1Z85A 1VHKA 4YQGA 4YQ7A 4JWJA 4IG6A 4YQ5A 4KGNA 5GMBA 1ZJRA 2EGWA 4JWFA 1V6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQI A;  1X7P A;  1O6D A;  4YQ1 A;  2O3A A;  4PZK A;  4YQD A;  3DCM X;  4MCB A;  2V3K A;  4JAL A;  2EGV A;  1NXZ A;  2Z0Y A;  4YPX A;  1UAK A;  3OII A;  4YQK A;  1TO0 A;  4YQR A;  1VH0 A;  4RG1 A;  3NK6 A;  1UAL A;  4H3Z A;  4YQJ A;  1X7O A;  4MCD A;  4CND A;  4CNE A;  4YQL A;  4XBO A;  4YQ6 A;  3NK7 A;  4YQO A;  2CX8 A;  4H3Y A;  3E5Y A;  1NS5 A;  1IPA A;  4X3M A;  1J85 A;  3ILK A;  4YVG A;  4YVH A;  4YQ9 A;  4YVK A;  4YQN A;  3AXZ A;  5D9F A;  4X3L A;  3QUV A;  2HA8 A;  1GZ0 A;  3AI9 X;  5CO4 A;  4JAK A;  4YQ2 A;  4YQ4 A;  3BBD A;  1OY5 A;  2YY8 A;  5FAI A;  3KY7 A;  4J3C A;  1VHY A;  5GM8 A;  4YPY A;  4YVJ A;  4YQ8 A;  3O7B A;  4MCC A;  2QMM A;  4YQT A;  4YQS A;  4YQ3 A;  4YVI A;  4E8B A;  3BBH A;  1K3R A;  2V3J A;  1P9P A;  4YPZ A;  3IC6 A;  3BBE A;  3KTY A;  3N4J A;  3IEF A;  3KW2 A;  3AIA A;  3ONP A;  4L69 A;  4YQA A;  5GMC A;  4YQP A;  4CNF A;  4KDZ A;  4YQC A;  3KNU A;  1UAJ A;  4YPW A;  2I6D A;  1UAM A;  4YQB A;  1MXI A;  2QWV A;  3GYQ A;  3N4K A;  4CNG A;  1V2X A;  4FAK A;  3L8U A;  4YQ0 A;  4YQQ A;  3OIJ A;  3OIN A;  1Z85 A;  1VHK A;  4YQG A;  4YQ7 A;  4IG6 A;  4YQ5 A;  4KGN A;  5GMB A;  1ZJR A;  2EGW A;  1V6Z A; 
#chains in the Genus database with same CATH topology
 4YQI A;  1X7P A;  1O6D A;  4YQ1 A;  2O3A A;  4PZK A;  4JWG A;  4YQD A;  3DCM X;  4MCB A;  2V3K A;  4JAL A;  1NXZ A;  2EGV A;  1WRS R;  2Z0Y A;  4YPX A;  1UAK A;  3OII A;  4YQK A;  1TO0 A;  4YQR A;  1VH0 A;  4RG1 A;  3NK6 A;  1UAL A;  4H3Z A;  4YQJ A;  1X7O A;  4MCD A;  1TRO A;  4CND A;  4CNE A;  4YQL A;  4XBO A;  4YQ6 A;  3NK7 A;  4YQO A;  2CX8 A;  4H3Y A;  1WRT R;  3E5Y A;  1NS5 A;  1IPA A;  3SSW N;  4X3M A;  1J85 A;  1RCS A;  3ILK A;  4YVG A;  4YVH A;  4YQ9 A;  4YVK A;  4JWH A;  4YQN A;  3AXZ A;  5D9F A;  4X3L A;  3QUV A;  2HA8 A;  1WRP R;  1GZ0 A;  3AI9 X;  5CO4 A;  4JAK A;  4YQ2 A;  1CO0 A;  3FRW A;  1ZT9 A;  4YQ4 A;  2OZ9 R;  3BBD A;  1OY5 A;  2YY8 A;  5FAI A;  3KY7 A;  3SSX N;  4J3C A;  1VHY A;  5GM8 A;  4YPY A;  4YVJ A;  4YQ8 A;  3O7B A;  4MCC A;  2QMM A;  4YQT A;  4YQS A;  4YQ3 A;  4YVI A;  4E8B A;  3BBH A;  2XDI A;  1K3R A;  2V3J A;  1P9P A;  4YPZ A;  3IC6 A;  3WRP A;  3BBE A;  3KTY A;  1JHG A;  3N4J A;  3IEF A;  3KW2 A;  3AIA A;  3G1C A;  3ONP A;  4L69 A;  4YQA A;  5GMC A;  3KOR A;  4YQP A;  4CNF A;  4KDZ A;  4YQC A;  3KNU A;  1UAJ A;  4YPW A;  2I6D A;  1UAM A;  4YQB A;  1MXI A;  2QWV A;  3GYQ A;  3N4K A;  4CNG A;  1V2X A;  4FMW A;  4FAK A;  3L8U A;  4YQ0 A;  4YQQ A;  3OIJ A;  3OIN A;  1Z85 A;  4YQG A;  1VHK A;  1TRR A;  4YQ7 A;  4IG6 A;  4YQ5 A;  4JWJ A;  4KGN A;  1ZJR A;  5GMB A;  2EGW A;  4JWF A;  1MI7 R;  1V6Z A; 
#chains in the Genus database with same CATH homology
 4YQI A;  1X7P A;  1O6D A;  4YQ1 A;  2O3A A;  4PZK A;  4JWG A;  4YQD A;  3DCM X;  4MCB A;  2V3K A;  4JAL A;  2EGV A;  1NXZ A;  2Z0Y A;  4YPX A;  1UAK A;  3OII A;  4YQK A;  1TO0 A;  4YQR A;  1VH0 A;  4RG1 A;  3NK6 A;  1UAL A;  4H3Z A;  4YQJ A;  1X7O A;  4MCD A;  4CND A;  4CNE A;  4YQL A;  4XBO A;  4YQ6 A;  3NK7 A;  4YQO A;  2CX8 A;  4H3Y A;  3E5Y A;  1NS5 A;  1IPA A;  4X3M A;  1J85 A;  3ILK A;  4YVG A;  4YVH A;  4YQ9 A;  4YVK A;  4JWH A;  4YQN A;  3AXZ A;  5D9F A;  4X3L A;  3QUV A;  2HA8 A;  1GZ0 A;  3AI9 X;  5CO4 A;  4JAK A;  4YQ2 A;  4YQ4 A;  3BBD A;  1OY5 A;  2YY8 A;  5FAI A;  3KY7 A;  4J3C A;  1VHY A;  5GM8 A;  4YPY A;  4YVJ A;  4YQ8 A;  3O7B A;  4MCC A;  2QMM A;  4YQT A;  4YQS A;  4YQ3 A;  4YVI A;  4E8B A;  3BBH A;  1K3R A;  2V3J A;  1P9P A;  4YPZ A;  3IC6 A;  3BBE A;  3KTY A;  3N4J A;  3IEF A;  3KW2 A;  3AIA A;  3ONP A;  4L69 A;  4YQA A;  5GMC A;  4YQP A;  4CNF A;  4KDZ A;  4YQC A;  3KNU A;  1UAJ A;  4YPW A;  2I6D A;  1UAM A;  4YQB A;  1MXI A;  2QWV A;  3GYQ A;  3N4K A;  4CNG A;  1V2X A;  4FMW A;  4FAK A;  3L8U A;  4YQ0 A;  4YQQ A;  3OIJ A;  3OIN A;  1Z85 A;  1VHK A;  4YQG A;  4YQ7 A;  4JWJ A;  4IG6 A;  4YQ5 A;  4KGN A;  5GMB A;  1ZJR A;  2EGW A;  4JWF A;  1V6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...