1UALA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
Knots found
sequence length
252
structure length
243
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 70
structure length 243
sequence length 252
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1ualA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1ualA01
3KTYA 5D9FA 4YQ3A 4YQGA 2CX8A 4CNEA 2V3KA 3AXZA 4CNGA 3NK7A 3IEFA 3N4KA 4X3LA 4YQ2A 2O3AA 4YQRA 4YQIA 3AI9X 5GMCA 4YQNA 4KDZA 4YQQA 4YQOA 3OIJA 3KY7A 2EGWA 4PZKA 2V3JA 4YQ6A 3BBHA 3KNUA 4H3ZA 4L69A 4X3MA 4E8BA 4YQ5A 1OY5A 1P9PA 1X7PA 4YQ9A 1UAMA 1K3RA 4JAKA 1UAJA 4J3CA 1V6ZA 4YQPA 4JALA 4YVIA 4YQJA 3L8UA 4YPYA 2YY8A 1UALA 4IG6A 1NXZA 4KGNA 4YQBA 4YVJA 3N4JA 4CNFA 2EGVA 2Z0YA 3QUVA 4YQCA 1MXIA 1UAKA 3DCMX 2QMMA 4YQDA 4MCDA 5FAIA 4YPXA 3ILKA 1VH0A 2QWVA 3O7BA 4YPZA 5GM8A 4YQKA 3OINA 3BBDA 1ZJRA 4YQAA 4YVHA 4FAKA 1NS5A 4MCCA 2HA8A 3IC6A 4YQTA 1X7OA 3ONPA 1O6DA 1GZ0A 3OIIA 4YPWA 4YQLA 4YVKA 5CO4A 4XBOA 4YQ0A 4H3YA 3E5YA 3AIAA 3BBEA 3NK6A 4YQSA 1TO0A 4RG1A 3KW2A 1V2XA 4YQ7A 1Z85A 3GYQA 2I6DA 5GMBA 1VHKA 1IPAA 4YVGA 4YQ1A 4YQ8A 1J85A 4CNDA 4YQ4A 4MCBA 1VHYA
chains in the Genus database with same CATH superfamily
3KTYA 5D9FA 4YQ3A 4YQGA 2CX8A 3SSWN 4CNEA 2V3KA 3AXZA 4CNGA 3NK7A 1MI7R 3IEFA 3N4KA 4X3LA 4YQ2A 1CO0A 2O3AA 4YQRA 4YQIA 3AI9X 5GMCA 4YQNA 4KDZA 4YQQA 4JWGA 4YQOA 3OIJA 3KY7A 2EGWA 4PZKA 2V3JA 4YQ6A 3BBHA 2OZ9R 3KNUA 1RCSA 4H3ZA 4L69A 4X3MA 4E8BA 4YQ5A 1OY5A 1P9PA 1X7PA 4YQ9A 1UAMA 1K3RA 4JAKA 1UAJA 4J3CA 1V6ZA 4YQPA 4JALA 4YVIA 4YQJA 3L8UA 4YPYA 2YY8A 1UALA 4IG6A 1NXZA 4KGNA 3KORA 3SSXN 4YQBA 4JWFA 4YVJA 3N4JA 4CNFA 2EGVA 2Z0YA 1TROA 3QUVA 4YQCA 1MXIA 4FMWA 1UAKA 3DCMX 2QMMA 4YQDA 4MCDA 5FAIA 4YPXA 3ILKA 3WRPA 1VH0A 2QWVA 3O7BA 4YPZA 5GM8A 4YQKA 3OINA 3BBDA 1ZJRA 4YQAA 1WRTR 4YVHA 2XDIA 4FAKA 1NS5A 4MCCA 1JHGA 2HA8A 3IC6A 4YQTA 3G1CA 1X7OA 3ONPA 1O6DA 1GZ0A 3OIIA 1TRRA 4YPWA 3FRWA 1WRPR 4YQLA 4YVKA 5CO4A 4XBOA 4YQ0A 4H3YA 4JWHA 3E5YA 3AIAA 3BBEA 3NK6A 4YQSA 1TO0A 4RG1A 3KW2A 1V2XA 4YQ7A 1Z85A 3GYQA 1ZT9A 2I6DA 5GMBA 1WRSR 1VHKA 1IPAA 4JWJA 4YVGA 4YQ1A 4YQ8A 1J85A 4CNDA 4YQ4A 4MCBA 1VHYA
chains in the Genus database with same CATH topology
3KTYA 5D9FA 4YQ3A 4YQGA 2CX8A 4CNEA 2V3KA 3AXZA 4CNGA 3NK7A 3IEFA 3N4KA 4X3LA 4YQ2A 2O3AA 4YQRA 4YQIA 3AI9X 5GMCA 4YQNA 4KDZA 4YQQA 4JWGA 4YQOA 3OIJA 3KY7A 2EGWA 4PZKA 2V3JA 4YQ6A 3BBHA 3KNUA 4H3ZA 4L69A 4X3MA 4E8BA 4YQ5A 1OY5A 1P9PA 1X7PA 4YQ9A 1UAMA 1K3RA 4JAKA 1UAJA 4J3CA 1V6ZA 4YQPA 4JALA 4YVIA 4YQJA 3L8UA 4YPYA 2YY8A 1UALA 4IG6A 1NXZA 4KGNA 4YQBA 4JWFA 4YVJA 3N4JA 4CNFA 2EGVA 2Z0YA 3QUVA 4YQCA 1MXIA 4FMWA 1UAKA 3DCMX 2QMMA 4YQDA 4MCDA 5FAIA 4YPXA 3ILKA 1VH0A 2QWVA 3O7BA 4YPZA 5GM8A 4YQKA 3OINA 3BBDA 1ZJRA 4YQAA 4YVHA 4FAKA 1NS5A 4MCCA 2HA8A 3IC6A 4YQTA 1X7OA 3ONPA 1O6DA 1GZ0A 3OIIA 4YPWA 4YQLA 4YVKA 5CO4A 4XBOA 4YQ0A 4H3YA 4JWHA 3E5YA 3AIAA 3BBEA 3NK6A 4YQSA 1TO0A 4RG1A 3KW2A 1V2XA 4YQ7A 1Z85A 3GYQA 2I6DA 5GMBA 1VHKA 1IPAA 4JWJA 4YVGA 4YQ1A 4YQ8A 1J85A 4CNDA 4YQ4A 4MCBA 1VHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTY A;  5D9F A;  4YQ3 A;  4YQG A;  2CX8 A;  4CNE A;  2V3K A;  3AXZ A;  4CNG A;  3NK7 A;  3IEF A;  3N4K A;  4X3L A;  4YQ2 A;  2O3A A;  4YQR A;  4YQI A;  3AI9 X;  5GMC A;  4YQN A;  4KDZ A;  4YQQ A;  4YQO A;  3OIJ A;  3KY7 A;  2EGW A;  4PZK A;  2V3J A;  4YQ6 A;  3BBH A;  3KNU A;  4H3Z A;  4L69 A;  4X3M A;  4E8B A;  4YQ5 A;  1OY5 A;  1P9P A;  1X7P A;  4YQ9 A;  1UAM A;  1K3R A;  4JAK A;  1UAJ A;  4J3C A;  1V6Z A;  4YQP A;  4JAL A;  4YVI A;  4YQJ A;  3L8U A;  4YPY A;  2YY8 A;  1UAL A;  4IG6 A;  1NXZ A;  4KGN A;  4YQB A;  4YVJ A;  3N4J A;  4CNF A;  2EGV A;  2Z0Y A;  3QUV A;  4YQC A;  1MXI A;  1UAK A;  3DCM X;  2QMM A;  4YQD A;  4MCD A;  5FAI A;  4YPX A;  3ILK A;  1VH0 A;  2QWV A;  3O7B A;  4YPZ A;  5GM8 A;  4YQK A;  3OIN A;  3BBD A;  1ZJR A;  4YQA A;  4YVH A;  4FAK A;  1NS5 A;  4MCC A;  2HA8 A;  3IC6 A;  4YQT A;  1X7O A;  3ONP A;  1O6D A;  1GZ0 A;  3OII A;  4YPW A;  4YQL A;  4YVK A;  5CO4 A;  4XBO A;  4YQ0 A;  4H3Y A;  3E5Y A;  3AIA A;  3BBE A;  3NK6 A;  4YQS A;  1TO0 A;  4RG1 A;  3KW2 A;  1V2X A;  4YQ7 A;  1Z85 A;  3GYQ A;  2I6D A;  5GMB A;  1VHK A;  1IPA A;  4YVG A;  4YQ1 A;  4YQ8 A;  1J85 A;  4CND A;  4YQ4 A;  4MCB A;  1VHY A; 
#chains in the Genus database with same CATH topology
 3KTY A;  5D9F A;  4YQ3 A;  4YQG A;  2CX8 A;  3SSW N;  4CNE A;  2V3K A;  3AXZ A;  4CNG A;  3NK7 A;  1MI7 R;  3IEF A;  3N4K A;  4X3L A;  4YQ2 A;  1CO0 A;  2O3A A;  4YQR A;  4YQI A;  3AI9 X;  5GMC A;  4YQN A;  4KDZ A;  4YQQ A;  4JWG A;  4YQO A;  3OIJ A;  3KY7 A;  2EGW A;  4PZK A;  2V3J A;  4YQ6 A;  3BBH A;  2OZ9 R;  3KNU A;  1RCS A;  4H3Z A;  4L69 A;  4X3M A;  4E8B A;  4YQ5 A;  1OY5 A;  1P9P A;  1X7P A;  4YQ9 A;  1UAM A;  1K3R A;  4JAK A;  1UAJ A;  4J3C A;  1V6Z A;  4YQP A;  4JAL A;  4YVI A;  4YQJ A;  3L8U A;  4YPY A;  2YY8 A;  1UAL A;  4IG6 A;  1NXZ A;  4KGN A;  3KOR A;  3SSX N;  4YQB A;  4JWF A;  4YVJ A;  3N4J A;  4CNF A;  2EGV A;  2Z0Y A;  1TRO A;  3QUV A;  4YQC A;  1MXI A;  4FMW A;  1UAK A;  3DCM X;  2QMM A;  4YQD A;  4MCD A;  5FAI A;  4YPX A;  3ILK A;  3WRP A;  1VH0 A;  2QWV A;  3O7B A;  4YPZ A;  5GM8 A;  4YQK A;  3OIN A;  3BBD A;  1ZJR A;  4YQA A;  1WRT R;  4YVH A;  2XDI A;  4FAK A;  1NS5 A;  4MCC A;  1JHG A;  2HA8 A;  3IC6 A;  4YQT A;  3G1C A;  1X7O A;  3ONP A;  1O6D A;  1GZ0 A;  3OII A;  1TRR A;  4YPW A;  3FRW A;  1WRP R;  4YQL A;  4YVK A;  5CO4 A;  4XBO A;  4YQ0 A;  4H3Y A;  4JWH A;  3E5Y A;  3AIA A;  3BBE A;  3NK6 A;  4YQS A;  1TO0 A;  4RG1 A;  3KW2 A;  1V2X A;  4YQ7 A;  1Z85 A;  3GYQ A;  1ZT9 A;  2I6D A;  5GMB A;  1WRS R;  1VHK A;  1IPA A;  4JWJ A;  4YVG A;  4YQ1 A;  4YQ8 A;  1J85 A;  4CND A;  4YQ4 A;  4MCB A;  1VHY A; 
#chains in the Genus database with same CATH homology
 3KTY A;  5D9F A;  4YQ3 A;  4YQG A;  2CX8 A;  4CNE A;  2V3K A;  3AXZ A;  4CNG A;  3NK7 A;  3IEF A;  3N4K A;  4X3L A;  4YQ2 A;  2O3A A;  4YQR A;  4YQI A;  3AI9 X;  5GMC A;  4YQN A;  4KDZ A;  4YQQ A;  4JWG A;  4YQO A;  3OIJ A;  3KY7 A;  2EGW A;  4PZK A;  2V3J A;  4YQ6 A;  3BBH A;  3KNU A;  4H3Z A;  4L69 A;  4X3M A;  4E8B A;  4YQ5 A;  1OY5 A;  1P9P A;  1X7P A;  4YQ9 A;  1UAM A;  1K3R A;  4JAK A;  1UAJ A;  4J3C A;  1V6Z A;  4YQP A;  4JAL A;  4YVI A;  4YQJ A;  3L8U A;  4YPY A;  2YY8 A;  1UAL A;  4IG6 A;  1NXZ A;  4KGN A;  4YQB A;  4JWF A;  4YVJ A;  3N4J A;  4CNF A;  2EGV A;  2Z0Y A;  3QUV A;  4YQC A;  1MXI A;  4FMW A;  1UAK A;  3DCM X;  2QMM A;  4YQD A;  4MCD A;  5FAI A;  4YPX A;  3ILK A;  1VH0 A;  2QWV A;  3O7B A;  4YPZ A;  5GM8 A;  4YQK A;  3OIN A;  3BBD A;  1ZJR A;  4YQA A;  4YVH A;  4FAK A;  1NS5 A;  4MCC A;  2HA8 A;  3IC6 A;  4YQT A;  1X7O A;  3ONP A;  1O6D A;  1GZ0 A;  3OII A;  4YPW A;  4YQL A;  4YVK A;  5CO4 A;  4XBO A;  4YQ0 A;  4H3Y A;  4JWH A;  3E5Y A;  3AIA A;  3BBE A;  3NK6 A;  4YQS A;  1TO0 A;  4RG1 A;  3KW2 A;  1V2X A;  4YQ7 A;  1Z85 A;  3GYQ A;  2I6D A;  5GMB A;  1VHK A;  1IPA A;  4JWJ A;  4YVG A;  4YQ1 A;  4YQ8 A;  1J85 A;  4CND A;  4YQ4 A;  4MCB A;  1VHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...