1UAJA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
254
structure length
241
Chain Sequence
GLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 62
structure length 241
sequence length 254
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uajA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uajA01
3BBHA 1UAMA 4YVKA 5D9FA 1NXZA 4YQDA 3IEFA 3GYQA 3OINA 3BBEA 1X7OA 3AXZA 3KY7A 4YPXA 1MXIA 4J3CA 1V2XA 4H3ZA 3NK6A 4YQ6A 3DCMX 4YQ4A 4YQCA 5CO4A 5FAIA 1VHYA 1GZ0A 4X3LA 3NK7A 1NS5A 4YVIA 1TO0A 1UAKA 1P9PA 4YQ2A 3E5YA 4YQGA 3BBDA 3IC6A 4YQLA 4YQIA 3OIIA 3L8UA 2EGVA 3AI9X 3KW2A 4YQSA 4RG1A 4YQ1A 3N4KA 4E8BA 4CNDA 4YQ5A 4IG6A 4MCBA 2EGWA 4YVHA 3KTYA 1VHKA 2I6DA 4KDZA 4YQ9A 4YVJA 4CNFA 2YY8A 3QUVA 4H3YA 1Z85A 4X3MA 4CNEA 2HA8A 3ILKA 5GMBA 4PZKA 1ZJRA 2V3JA 4YQKA 4YQ0A 4YQQA 5GM8A 2CX8A 2O3AA 4YQPA 4YQRA 3ONPA 4CNGA 4YPZA 4JAKA 4YQNA 4FAKA 1J85A 4YQOA 3O7BA 1UALA 4MCDA 4KGNA 3AIAA 4YPWA 4L69A 1X7PA 4XBOA 4YQ3A 3N4JA 1K3RA 5GMCA 2QMMA 4YVGA 1UAJA 4YQJA 2QWVA 4YQBA 1OY5A 3KNUA 1O6DA 1V6ZA 4YQTA 4YQAA 2Z0YA 1VH0A 4YPYA 3OIJA 4JALA 1IPAA 4YQ8A 2V3KA 4YQ7A 4MCCA
chains in the Genus database with same CATH superfamily
1WRPR 3BBHA 1UAMA 4YVKA 5D9FA 2OZ9R 1NXZA 4YQDA 3IEFA 3GYQA 3OINA 1JHGA 3BBEA 1X7OA 3AXZA 3KY7A 4YPXA 1WRTR 1MXIA 4J3CA 1V2XA 4H3ZA 3NK6A 4YQ6A 3DCMX 4YQ4A 4JWGA 4YQCA 5CO4A 5FAIA 1VHYA 1GZ0A 4X3LA 3NK7A 1NS5A 4YVIA 1TO0A 1UAKA 1P9PA 4YQ2A 3E5YA 4YQGA 3BBDA 3IC6A 3FRWA 4YQLA 4FMWA 1RCSA 4YQIA 3OIIA 1WRSR 3G1CA 3L8UA 2EGVA 3AI9X 3KW2A 4YQSA 4RG1A 4YQ1A 3N4KA 4E8BA 4CNDA 4YQ5A 1ZT9A 4IG6A 4MCBA 2EGWA 4YVHA 3KTYA 1VHKA 2I6DA 4KDZA 4YQ9A 4YVJA 4JWJA 1MI7R 4CNFA 2YY8A 3QUVA 4H3YA 1Z85A 4X3MA 4CNEA 2HA8A 3ILKA 5GMBA 4PZKA 4JWHA 1ZJRA 2V3JA 4YQKA 4YQ0A 4YQQA 5GM8A 2CX8A 2O3AA 4YQPA 4YQRA 3ONPA 4CNGA 3SSXN 4YPZA 4JAKA 4YQNA 4FAKA 1J85A 4YQOA 3O7BA 1UALA 3KORA 4MCDA 4JWFA 4KGNA 3AIAA 1TRRA 4YPWA 4L69A 1X7PA 4XBOA 4YQ3A 3N4JA 1K3RA 5GMCA 2QMMA 4YVGA 1CO0A 1UAJA 4YQJA 2QWVA 4YQBA 1OY5A 3KNUA 1O6DA 1V6ZA 4YQTA 4YQAA 2Z0YA 1VH0A 4YPYA 3WRPA 3OIJA 4JALA 2XDIA 1IPAA 4YQ8A 1TROA 2V3KA 4YQ7A 4MCCA 3SSWN
chains in the Genus database with same CATH topology
3BBHA 1UAMA 4YVKA 5D9FA 1NXZA 4YQDA 3IEFA 3GYQA 3OINA 3BBEA 1X7OA 3AXZA 3KY7A 4YPXA 1MXIA 4J3CA 1V2XA 4H3ZA 3NK6A 4YQ6A 3DCMX 4YQ4A 4JWGA 4YQCA 5CO4A 5FAIA 1VHYA 1GZ0A 4X3LA 3NK7A 1NS5A 4YVIA 1TO0A 1UAKA 1P9PA 4YQ2A 3E5YA 4YQGA 3BBDA 3IC6A 4YQLA 4FMWA 4YQIA 3OIIA 3L8UA 2EGVA 3AI9X 3KW2A 4YQSA 4RG1A 4YQ1A 3N4KA 4E8BA 4CNDA 4YQ5A 4IG6A 4MCBA 2EGWA 4YVHA 3KTYA 1VHKA 2I6DA 4KDZA 4YQ9A 4YVJA 4JWJA 4CNFA 2YY8A 3QUVA 4H3YA 1Z85A 4X3MA 4CNEA 2HA8A 3ILKA 5GMBA 4PZKA 4JWHA 1ZJRA 2V3JA 4YQKA 4YQ0A 4YQQA 5GM8A 2CX8A 2O3AA 4YQPA 4YQRA 3ONPA 4CNGA 4YPZA 4JAKA 4YQNA 4FAKA 1J85A 4YQOA 3O7BA 1UALA 4MCDA 4JWFA 4KGNA 3AIAA 4YPWA 4L69A 1X7PA 4XBOA 4YQ3A 3N4JA 1K3RA 5GMCA 2QMMA 4YVGA 1UAJA 4YQJA 2QWVA 4YQBA 1OY5A 3KNUA 1O6DA 1V6ZA 4YQTA 4YQAA 2Z0YA 1VH0A 4YPYA 3OIJA 4JALA 1IPAA 4YQ8A 2V3KA 4YQ7A 4MCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBH A;  1UAM A;  4YVK A;  5D9F A;  1NXZ A;  4YQD A;  3IEF A;  3GYQ A;  3OIN A;  3BBE A;  1X7O A;  3AXZ A;  3KY7 A;  4YPX A;  1MXI A;  4J3C A;  1V2X A;  4H3Z A;  3NK6 A;  4YQ6 A;  3DCM X;  4YQ4 A;  4YQC A;  5CO4 A;  5FAI A;  1VHY A;  1GZ0 A;  4X3L A;  3NK7 A;  1NS5 A;  4YVI A;  1TO0 A;  1UAK A;  1P9P A;  4YQ2 A;  3E5Y A;  4YQG A;  3BBD A;  3IC6 A;  4YQL A;  4YQI A;  3OII A;  3L8U A;  2EGV A;  3AI9 X;  3KW2 A;  4YQS A;  4RG1 A;  4YQ1 A;  3N4K A;  4E8B A;  4CND A;  4YQ5 A;  4IG6 A;  4MCB A;  2EGW A;  4YVH A;  3KTY A;  1VHK A;  2I6D A;  4KDZ A;  4YQ9 A;  4YVJ A;  4CNF A;  2YY8 A;  3QUV A;  4H3Y A;  1Z85 A;  4X3M A;  4CNE A;  2HA8 A;  3ILK A;  5GMB A;  4PZK A;  1ZJR A;  2V3J A;  4YQK A;  4YQ0 A;  4YQQ A;  5GM8 A;  2CX8 A;  2O3A A;  4YQP A;  4YQR A;  3ONP A;  4CNG A;  4YPZ A;  4JAK A;  4YQN A;  4FAK A;  1J85 A;  4YQO A;  3O7B A;  1UAL A;  4MCD A;  4KGN A;  3AIA A;  4YPW A;  4L69 A;  1X7P A;  4XBO A;  4YQ3 A;  3N4J A;  1K3R A;  5GMC A;  2QMM A;  4YVG A;  1UAJ A;  4YQJ A;  2QWV A;  4YQB A;  1OY5 A;  3KNU A;  1O6D A;  1V6Z A;  4YQT A;  4YQA A;  2Z0Y A;  1VH0 A;  4YPY A;  3OIJ A;  4JAL A;  1IPA A;  4YQ8 A;  2V3K A;  4YQ7 A;  4MCC A; 
#chains in the Genus database with same CATH topology
 1WRP R;  3BBH A;  1UAM A;  4YVK A;  5D9F A;  2OZ9 R;  1NXZ A;  4YQD A;  3IEF A;  3GYQ A;  3OIN A;  1JHG A;  3BBE A;  1X7O A;  3AXZ A;  3KY7 A;  4YPX A;  1WRT R;  1MXI A;  4J3C A;  1V2X A;  4H3Z A;  3NK6 A;  4YQ6 A;  3DCM X;  4YQ4 A;  4JWG A;  4YQC A;  5CO4 A;  5FAI A;  1VHY A;  1GZ0 A;  4X3L A;  3NK7 A;  1NS5 A;  4YVI A;  1TO0 A;  1UAK A;  1P9P A;  4YQ2 A;  3E5Y A;  4YQG A;  3BBD A;  3IC6 A;  3FRW A;  4YQL A;  4FMW A;  1RCS A;  4YQI A;  3OII A;  1WRS R;  3G1C A;  3L8U A;  2EGV A;  3AI9 X;  3KW2 A;  4YQS A;  4RG1 A;  4YQ1 A;  3N4K A;  4E8B A;  4CND A;  4YQ5 A;  1ZT9 A;  4IG6 A;  4MCB A;  2EGW A;  4YVH A;  3KTY A;  1VHK A;  2I6D A;  4KDZ A;  4YQ9 A;  4YVJ A;  4JWJ A;  1MI7 R;  4CNF A;  2YY8 A;  3QUV A;  4H3Y A;  1Z85 A;  4X3M A;  4CNE A;  2HA8 A;  3ILK A;  5GMB A;  4PZK A;  4JWH A;  1ZJR A;  2V3J A;  4YQK A;  4YQ0 A;  4YQQ A;  5GM8 A;  2CX8 A;  2O3A A;  4YQP A;  4YQR A;  3ONP A;  4CNG A;  3SSX N;  4YPZ A;  4JAK A;  4YQN A;  4FAK A;  1J85 A;  4YQO A;  3O7B A;  1UAL A;  3KOR A;  4MCD A;  4JWF A;  4KGN A;  3AIA A;  1TRR A;  4YPW A;  4L69 A;  1X7P A;  4XBO A;  4YQ3 A;  3N4J A;  1K3R A;  5GMC A;  2QMM A;  4YVG A;  1CO0 A;  1UAJ A;  4YQJ A;  2QWV A;  4YQB A;  1OY5 A;  3KNU A;  1O6D A;  1V6Z A;  4YQT A;  4YQA A;  2Z0Y A;  1VH0 A;  4YPY A;  3WRP A;  3OIJ A;  4JAL A;  2XDI A;  1IPA A;  4YQ8 A;  1TRO A;  2V3K A;  4YQ7 A;  4MCC A;  3SSW N; 
#chains in the Genus database with same CATH homology
 3BBH A;  1UAM A;  4YVK A;  5D9F A;  1NXZ A;  4YQD A;  3IEF A;  3GYQ A;  3OIN A;  3BBE A;  1X7O A;  3AXZ A;  3KY7 A;  4YPX A;  1MXI A;  4J3C A;  1V2X A;  4H3Z A;  3NK6 A;  4YQ6 A;  3DCM X;  4YQ4 A;  4JWG A;  4YQC A;  5CO4 A;  5FAI A;  1VHY A;  1GZ0 A;  4X3L A;  3NK7 A;  1NS5 A;  4YVI A;  1TO0 A;  1UAK A;  1P9P A;  4YQ2 A;  3E5Y A;  4YQG A;  3BBD A;  3IC6 A;  4YQL A;  4FMW A;  4YQI A;  3OII A;  3L8U A;  2EGV A;  3AI9 X;  3KW2 A;  4YQS A;  4RG1 A;  4YQ1 A;  3N4K A;  4E8B A;  4CND A;  4YQ5 A;  4IG6 A;  4MCB A;  2EGW A;  4YVH A;  3KTY A;  1VHK A;  2I6D A;  4KDZ A;  4YQ9 A;  4YVJ A;  4JWJ A;  4CNF A;  2YY8 A;  3QUV A;  4H3Y A;  1Z85 A;  4X3M A;  4CNE A;  2HA8 A;  3ILK A;  5GMB A;  4PZK A;  4JWH A;  1ZJR A;  2V3J A;  4YQK A;  4YQ0 A;  4YQQ A;  5GM8 A;  2CX8 A;  2O3A A;  4YQP A;  4YQR A;  3ONP A;  4CNG A;  4YPZ A;  4JAK A;  4YQN A;  4FAK A;  1J85 A;  4YQO A;  3O7B A;  1UAL A;  4MCD A;  4JWF A;  4KGN A;  3AIA A;  4YPW A;  4L69 A;  1X7P A;  4XBO A;  4YQ3 A;  3N4J A;  1K3R A;  5GMC A;  2QMM A;  4YVG A;  1UAJ A;  4YQJ A;  2QWV A;  4YQB A;  1OY5 A;  3KNU A;  1O6D A;  1V6Z A;  4YQT A;  4YQA A;  2Z0Y A;  1VH0 A;  4YPY A;  3OIJ A;  4JAL A;  1IPA A;  4YQ8 A;  2V3K A;  4YQ7 A;  4MCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...