1UAJA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
254
structure length
241
Chain Sequence
GLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 62
structure length 241
sequence length 254
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uajA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uajA01
3NK7A 5FAIA 3OINA 3E5YA 1J85A 3NK6A 2YY8A 4MCDA 3KNUA 4PZKA 4FAKA 4JAKA 1GZ0A 4YQKA 3IC6A 1NXZA 4YQJA 4RG1A 4CNGA 4YVIA 2EGWA 1TO0A 4MCCA 4YQTA 3DCMX 3QUVA 4YQ4A 4MCBA 1V6ZA 4H3YA 1X7OA 4YQCA 4L69A 3KY7A 3KTYA 3AI9X 2EGVA 2I6DA 4YQBA 1X7PA 4CNDA 4YQIA 1UAJA 4JALA 4YVHA 3ONPA 2HA8A 3BBEA 3BBHA 2Z0YA 4YQ0A 4YPYA 1OY5A 5GMCA 4H3ZA 1UAMA 4YQ8A 3N4JA 3AIAA 1VH0A 4YQ7A 3KW2A 4YQPA 4J3CA 4YQDA 4CNFA 4YQLA 1P9PA 1Z85A 4YQ6A 1VHYA 4X3MA 1IPAA 1ZJRA 5GM8A 3OIJA 3ILKA 5GMBA 4CNEA 4E8BA 4YPXA 4YQAA 1K3RA 2CX8A 4YQNA 3O7BA 4YQSA 4YQ5A 2QWVA 2V3JA 2QMMA 3GYQA 5CO4A 4YQ3A 4YQOA 2O3AA 3L8UA 3N4KA 1VHKA 1O6DA 1V2XA 1UAKA 4YQ9A 4YQQA 4YVJA 4YQRA 4XBOA 4IG6A 4YQ1A 4YVGA 4X3LA 3IEFA 4KDZA 4YPWA 2V3KA 5D9FA 3OIIA 4YQGA 1MXIA 4YPZA 3BBDA 1UALA 4KGNA 4YQ2A 4YVKA 1NS5A 3AXZA
chains in the Genus database with same CATH superfamily
3NK7A 5FAIA 3OINA 3E5YA 1J85A 3NK6A 2YY8A 1CO0A 4MCDA 3KNUA 1MI7R 4PZKA 4FAKA 4JAKA 1GZ0A 4YQKA 3IC6A 1NXZA 4YQJA 1WRPR 4RG1A 4CNGA 4YVIA 2OZ9R 2EGWA 1TO0A 4MCCA 4YQTA 3DCMX 4JWHA 3QUVA 4YQ4A 4MCBA 1V6ZA 4H3YA 1X7OA 4YQCA 4L69A 3KY7A 3KTYA 4JWFA 3AI9X 2EGVA 2I6DA 4YQBA 1X7PA 4JWJA 4CNDA 4YQIA 1UAJA 3SSWN 1TROA 4JALA 3KORA 4YVHA 3ONPA 2HA8A 3BBEA 3BBHA 2Z0YA 4YQ0A 4YPYA 1OY5A 5GMCA 4FMWA 4H3ZA 1UAMA 4YQ8A 3N4JA 3AIAA 1TRRA 1VH0A 3G1CA 4YQ7A 3KW2A 4YQPA 4J3CA 4YQDA 4CNFA 4YQLA 1P9PA 1Z85A 4YQ6A 1VHYA 4X3MA 1WRTR 1IPAA 1ZJRA 5GM8A 3OIJA 3ILKA 5GMBA 4CNEA 4E8BA 4YPXA 4YQAA 1K3RA 2CX8A 4YQNA 3O7BA 4YQSA 4YQ5A 2QWVA 2V3JA 2QMMA 3GYQA 3FRWA 4YQ3A 4YQOA 1WRSR 5CO4A 2O3AA 3L8UA 3SSXN 3N4KA 2XDIA 4JWGA 1VHKA 1O6DA 1V2XA 1UAKA 4YQ9A 4YQQA 4YVJA 4YQRA 4XBOA 4IG6A 4YQ1A 1ZT9A 4YVGA 4X3LA 3IEFA 4KDZA 4YPWA 2V3KA 5D9FA 1RCSA 3OIIA 4YQGA 1MXIA 4YPZA 3BBDA 1UALA 1JHGA 4KGNA 3WRPA 4YQ2A 4YVKA 1NS5A 3AXZA
chains in the Genus database with same CATH topology
3NK7A 5FAIA 3OINA 3E5YA 1J85A 3NK6A 2YY8A 4MCDA 3KNUA 4PZKA 4FAKA 4JAKA 1GZ0A 4YQKA 3IC6A 1NXZA 4YQJA 4RG1A 4CNGA 4YVIA 2EGWA 1TO0A 4MCCA 4YQTA 3DCMX 4JWHA 3QUVA 4YQ4A 4MCBA 1V6ZA 4H3YA 1X7OA 4YQCA 4L69A 3KY7A 3KTYA 4JWFA 3AI9X 2EGVA 2I6DA 4YQBA 1X7PA 4JWJA 4CNDA 4YQIA 1UAJA 4JALA 4YVHA 3ONPA 2HA8A 3BBEA 3BBHA 2Z0YA 4YQ0A 4YPYA 1OY5A 5GMCA 4FMWA 4H3ZA 1UAMA 4YQ8A 3N4JA 3AIAA 1VH0A 4YQ7A 3KW2A 4YQPA 4J3CA 4YQDA 4CNFA 4YQLA 1P9PA 1Z85A 4YQ6A 1VHYA 4X3MA 1IPAA 1ZJRA 5GM8A 3OIJA 3ILKA 5GMBA 4CNEA 4E8BA 4YPXA 4YQAA 1K3RA 2CX8A 4YQNA 3O7BA 4YQSA 4YQ5A 2QWVA 2V3JA 2QMMA 3GYQA 5CO4A 4YQ3A 4YQOA 2O3AA 3L8UA 3N4KA 4JWGA 1VHKA 1O6DA 1V2XA 1UAKA 4YQ9A 4YQQA 4YVJA 4YQRA 4XBOA 4IG6A 4YQ1A 4YVGA 4X3LA 3IEFA 4KDZA 4YPWA 2V3KA 5D9FA 3OIIA 4YQGA 1MXIA 4YPZA 3BBDA 1UALA 4KGNA 4YQ2A 4YVKA 1NS5A 3AXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK7 A;  5FAI A;  3OIN A;  3E5Y A;  1J85 A;  3NK6 A;  2YY8 A;  4MCD A;  3KNU A;  4PZK A;  4FAK A;  4JAK A;  1GZ0 A;  4YQK A;  3IC6 A;  1NXZ A;  4YQJ A;  4RG1 A;  4CNG A;  4YVI A;  2EGW A;  1TO0 A;  4MCC A;  4YQT A;  3DCM X;  3QUV A;  4YQ4 A;  4MCB A;  1V6Z A;  4H3Y A;  1X7O A;  4YQC A;  4L69 A;  3KY7 A;  3KTY A;  3AI9 X;  2EGV A;  2I6D A;  4YQB A;  1X7P A;  4CND A;  4YQI A;  1UAJ A;  4JAL A;  4YVH A;  3ONP A;  2HA8 A;  3BBE A;  3BBH A;  2Z0Y A;  4YQ0 A;  4YPY A;  1OY5 A;  5GMC A;  4H3Z A;  1UAM A;  4YQ8 A;  3N4J A;  3AIA A;  1VH0 A;  4YQ7 A;  3KW2 A;  4YQP A;  4J3C A;  4YQD A;  4CNF A;  4YQL A;  1P9P A;  1Z85 A;  4YQ6 A;  1VHY A;  4X3M A;  1IPA A;  1ZJR A;  5GM8 A;  3OIJ A;  3ILK A;  5GMB A;  4CNE A;  4E8B A;  4YPX A;  4YQA A;  1K3R A;  2CX8 A;  4YQN A;  3O7B A;  4YQS A;  4YQ5 A;  2QWV A;  2V3J A;  2QMM A;  3GYQ A;  5CO4 A;  4YQ3 A;  4YQO A;  2O3A A;  3L8U A;  3N4K A;  1VHK A;  1O6D A;  1V2X A;  1UAK A;  4YQ9 A;  4YQQ A;  4YVJ A;  4YQR A;  4XBO A;  4IG6 A;  4YQ1 A;  4YVG A;  4X3L A;  3IEF A;  4KDZ A;  4YPW A;  2V3K A;  5D9F A;  3OII A;  4YQG A;  1MXI A;  4YPZ A;  3BBD A;  1UAL A;  4KGN A;  4YQ2 A;  4YVK A;  1NS5 A;  3AXZ A; 
#chains in the Genus database with same CATH topology
 3NK7 A;  5FAI A;  3OIN A;  3E5Y A;  1J85 A;  3NK6 A;  2YY8 A;  1CO0 A;  4MCD A;  3KNU A;  1MI7 R;  4PZK A;  4FAK A;  4JAK A;  1GZ0 A;  4YQK A;  3IC6 A;  1NXZ A;  4YQJ A;  1WRP R;  4RG1 A;  4CNG A;  4YVI A;  2OZ9 R;  2EGW A;  1TO0 A;  4MCC A;  4YQT A;  3DCM X;  4JWH A;  3QUV A;  4YQ4 A;  4MCB A;  1V6Z A;  4H3Y A;  1X7O A;  4YQC A;  4L69 A;  3KY7 A;  3KTY A;  4JWF A;  3AI9 X;  2EGV A;  2I6D A;  4YQB A;  1X7P A;  4JWJ A;  4CND A;  4YQI A;  1UAJ A;  3SSW N;  1TRO A;  4JAL A;  3KOR A;  4YVH A;  3ONP A;  2HA8 A;  3BBE A;  3BBH A;  2Z0Y A;  4YQ0 A;  4YPY A;  1OY5 A;  5GMC A;  4FMW A;  4H3Z A;  1UAM A;  4YQ8 A;  3N4J A;  3AIA A;  1TRR A;  1VH0 A;  3G1C A;  4YQ7 A;  3KW2 A;  4YQP A;  4J3C A;  4YQD A;  4CNF A;  4YQL A;  1P9P A;  1Z85 A;  4YQ6 A;  1VHY A;  4X3M A;  1WRT R;  1IPA A;  1ZJR A;  5GM8 A;  3OIJ A;  3ILK A;  5GMB A;  4CNE A;  4E8B A;  4YPX A;  4YQA A;  1K3R A;  2CX8 A;  4YQN A;  3O7B A;  4YQS A;  4YQ5 A;  2QWV A;  2V3J A;  2QMM A;  3GYQ A;  3FRW A;  4YQ3 A;  4YQO A;  1WRS R;  5CO4 A;  2O3A A;  3L8U A;  3SSX N;  3N4K A;  2XDI A;  4JWG A;  1VHK A;  1O6D A;  1V2X A;  1UAK A;  4YQ9 A;  4YQQ A;  4YVJ A;  4YQR A;  4XBO A;  4IG6 A;  4YQ1 A;  1ZT9 A;  4YVG A;  4X3L A;  3IEF A;  4KDZ A;  4YPW A;  2V3K A;  5D9F A;  1RCS A;  3OII A;  4YQG A;  1MXI A;  4YPZ A;  3BBD A;  1UAL A;  1JHG A;  4KGN A;  3WRP A;  4YQ2 A;  4YVK A;  1NS5 A;  3AXZ A; 
#chains in the Genus database with same CATH homology
 3NK7 A;  5FAI A;  3OIN A;  3E5Y A;  1J85 A;  3NK6 A;  2YY8 A;  4MCD A;  3KNU A;  4PZK A;  4FAK A;  4JAK A;  1GZ0 A;  4YQK A;  3IC6 A;  1NXZ A;  4YQJ A;  4RG1 A;  4CNG A;  4YVI A;  2EGW A;  1TO0 A;  4MCC A;  4YQT A;  3DCM X;  4JWH A;  3QUV A;  4YQ4 A;  4MCB A;  1V6Z A;  4H3Y A;  1X7O A;  4YQC A;  4L69 A;  3KY7 A;  3KTY A;  4JWF A;  3AI9 X;  2EGV A;  2I6D A;  4YQB A;  1X7P A;  4JWJ A;  4CND A;  4YQI A;  1UAJ A;  4JAL A;  4YVH A;  3ONP A;  2HA8 A;  3BBE A;  3BBH A;  2Z0Y A;  4YQ0 A;  4YPY A;  1OY5 A;  5GMC A;  4FMW A;  4H3Z A;  1UAM A;  4YQ8 A;  3N4J A;  3AIA A;  1VH0 A;  4YQ7 A;  3KW2 A;  4YQP A;  4J3C A;  4YQD A;  4CNF A;  4YQL A;  1P9P A;  1Z85 A;  4YQ6 A;  1VHY A;  4X3M A;  1IPA A;  1ZJR A;  5GM8 A;  3OIJ A;  3ILK A;  5GMB A;  4CNE A;  4E8B A;  4YPX A;  4YQA A;  1K3R A;  2CX8 A;  4YQN A;  3O7B A;  4YQS A;  4YQ5 A;  2QWV A;  2V3J A;  2QMM A;  3GYQ A;  5CO4 A;  4YQ3 A;  4YQO A;  2O3A A;  3L8U A;  3N4K A;  4JWG A;  1VHK A;  1O6D A;  1V2X A;  1UAK A;  4YQ9 A;  4YQQ A;  4YVJ A;  4YQR A;  4XBO A;  4IG6 A;  4YQ1 A;  4YVG A;  4X3L A;  3IEF A;  4KDZ A;  4YPW A;  2V3K A;  5D9F A;  3OII A;  4YQG A;  1MXI A;  4YPZ A;  3BBD A;  1UAL A;  4KGN A;  4YQ2 A;  4YVK A;  1NS5 A;  3AXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...