3J80R

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
120
Chain Sequence
GRVRTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPDVSHSNDVLNVDTQTAELVNSLGLKLPLSVSSVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 25
structure length 120
sequence length 125
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00833 Ribosomal_S17e Ribosomal S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.20 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Ribosomal protein S17e-like 3j80R01
5FLXR 1RQ6A 3J80R 5A2QR 3J7AW 3J81R 5IT9R 3JAMR
chains in the Genus database with same CATH superfamily
3R60A 1RQ6A 2EV6A 2QQ9A 4HV5A 1G3YA 2HYGD 1G3TA 2P0TA 2MUNA 3J7AW 3J81R 4O5VA 1B1BA 2F5CA 1BI0A 3JAMR 2M35A 1FX7A 1DPRA 1C0WA 2EV5A 3A52A 1BI3A 2HYFA 2QQAA 2MVTA 1DDNA 2QQBA 3GLXA 2F5EA 1XCVA 1BI2A 1F5TA 5IT9R 2DTRA 5FLXR 1G3SA 4HX7A 2EV0A 2F5FA 1G3WA 3R61A 5A2QR 1P92A 2F5DA 1ON1A 1BI1A 2X98A 1ON2A 2ISZA 4O6JA 3J80R 1FWZA 1U8RA 2MZ4A 4HV6A 2H09A 2TDXA 4HX8A 4HX4A
chains in the Genus database with same CATH topology
5FLXR 1RQ6A 3J80R 5A2QR 3J7AW 3J81R 5IT9R 3JAMR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX R;  1RQ6 A;  3J80 R;  5A2Q R;  3J7A W;  3J81 R;  5IT9 R;  3JAM R; 
#chains in the Genus database with same CATH topology
 3R60 A;  1RQ6 A;  2EV6 A;  2QQ9 A;  4HV5 A;  1G3Y A;  2HYG D;  1G3T A;  2P0T A;  2MUN A;  3J7A W;  3J81 R;  4O5V A;  1B1B A;  2F5C A;  1BI0 A;  3JAM R;  2M35 A;  1FX7 A;  1DPR A;  1C0W A;  2EV5 A;  3A52 A;  1BI3 A;  2HYF A;  2QQA A;  2MVT A;  1DDN A;  2QQB A;  3GLX A;  2F5E A;  1XCV A;  1BI2 A;  1F5T A;  5IT9 R;  2DTR A;  5FLX R;  1G3S A;  4HX7 A;  2EV0 A;  2F5F A;  1G3W A;  3R61 A;  5A2Q R;  1P92 A;  2F5D A;  1ON1 A;  1BI1 A;  2X98 A;  1ON2 A;  2ISZ A;  4O6J A;  3J80 R;  1FWZ A;  1U8R A;  2MZ4 A;  4HV6 A;  2H09 A;  2TDX A;  4HX8 A;  4HX4 A; 
#chains in the Genus database with same CATH homology
 5FLX R;  1RQ6 A;  3J80 R;  5A2Q R;  3J7A W;  3J81 R;  5IT9 R;  3JAM R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...