1ON1A

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ab conformation.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
135
structure length
130
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title Structure of the Manganese-Bound Manganese Transport Regulator of Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 52
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1on1A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1on1A02
3MEXA 1Z1DA 1EH7A 2VODA 1HBXG 1W5TA 1S7OA 4CHUA 1KU2A 3WTWC 1KYWA 2DQRA 3HRSA 3OOPA 2HOEA 3D5LA 2A68F 4GO1A 3IL2A 1UCRA 1BC7C 3GO5A 1MD0A 3K1PA 2NYXA 3E6BA 1WWXA 2F5CA 1BIBA 1GHCA 5DDGA 4EM1A 3NEUA 4L9TA 3BPVA 1O3RA 2VBXA 4UNOA 2EB7A 5LRRA 4I02A 4MQ9F 4M73A 5ILSA 4QWQA 2FMYA 1J59A 1NHAA 5HDGA 3GZ5A 3TO6A 4MEXF 2K7LA 1FBUA 2IW5A 2NS0A 3B02A 5LHIA 3F8NA 5E1WA 2V1UA 4BNCA 3QP5A 4WXCA 4HDVA 1ONVA 2NNYA 1T38A 3GXOA 2DT5A 4A12A 2XROA 2FXAA 2HEOA 1QO0D 1HW1A 3T8RA 3IC7A 4MTDA 4G7ZF 5L3CA 1W5SA 4HLXA 4Y15A 5DUIA 3I59A 5ICFA 1SD6A 4L0ZB 2L3DA 3L2CA 2ZCWA 4KN4X 4KNYA 3V7SA 5FB2A 2ZNYA 1D8KA 2HDCA 3KETA 5L3DA 4PGGA 3FWEA 3F22A 3T5XA 1USSA 1ZLJA 2EWNA 4AD9A 1R7JA 5CVJA 5HDKA 5E8IA 3ISPA 5HS8A 2H6BA 5JI6A 4M74A 5DEQA 1QPMA 3S2WA 4EMSA 3RPUA 3WGIA 3VFZA 3F6OA 2CYYA 1YTYA 5K5RA 2KKOA 1HW2A 5AIQA 4A2UA 2G9WA 4EQQA 2BYVE 1BIAA 1TQIA 1T2KA 4U7BA 4OIOF 1XN7A 3ZMTA 3CO7C 3N4MA 2JPCA 2EFNA 2CG4A 3HTSB 2EJRA 2L54A 4HF2A 4KIBA 4HDUA 2W25A 1LDDA 3E97A 3HOTA 3T0YA 1XDSA 1FSHA 4ON0A 5LRSA 5LGUA 2UXXA 2DI3A 3CUQA 4IF4A 1B4AA 5F1RA 4XLPF 4KUMA 4BHBA 5JVTA 3I58A 3CTAA 1H0MA 4MQVA 1FYKA 1G3SA 1D5VA 1SAXA 1AOYA 1TNTA 2VBZA 1IUYA 3G3ZA 1XSXA 1ZHFA 2BEOA 2QM3A 1BM9A 2RV8A 3FF5A 2HTSA 2PBIA 4I7HA 3JAMZ 3TDUC 1BOAA 4ZYHA 3CUOA 3F8FA 2RNJA 3TQNA 4ASNA 5ILVA 1FYLA 1FOKA 2A6EF 4L0YB 4I0AA 3GFIA 3AAFA 2H6CA 2HR3A 1VTNC 5DYMA 1XD7A 2JSCA 2OA4A 4B09A 3QU3A 1J2XA 5HDNA 5ED4A 1MGTA 1FY7A 1D3YA 3BZ6A 4GXOA 1OR7A 2EV5A 3JSPA 2VE9A 2VC0A 3GW2A 2XAJA 4LJZF 4BAYA 3L9FA 4L9JA 4CXFA 1IW7F 3DKWA 4O3MA 3J81Z 2PQ8A 1SMTA 3HYIA 2X4HA 2P5KA 3WODF 4GYIA 2D1HA 1ZAOA 2ZXJA 3PQKA 4KA4A 1ZRFA 3DV8A 4LGWA 5E1ZB 2BE5F 1BI1A 2XUBA 5D5XB 1I6XA 4HQMA 5D6FA 4M9XA 3E5XA 3H92A 2KJBA 3DEUA 3HSEA 2EFOA 3REOA 5D4RA 4S05A 2P5VA 1S8NA 2AS5F 4EJOA 4ZYDA 1J75A 2MD5A 3PFIA 4LK0F 1Q1HA 4HAMA 1K79A 4G9YA 1FC3A 2V1DA 1G4DA 4S04A 5JFRA 2XAHA 2BV6A 5D5UB 3V8KA 3KP4A 2Z3YA 3SHFA 2PJPA 2Y75A 5FGMA 1E2XA 1P2FA 2BGCA 1R23A 1FYMA 4EJUA 3U1DA 1HSJA 2Z5UA 3GEZA 1IN6A 2HZTA 1V4RA 4PDKA 4CYDA 4M6XA 3WTTC 2DAOA 4LG0B 3LAPA 5CVVA 2EK5A 5L3FA 2ISYA 2HQNA 2ADUA 3HSRA 2RC4A 3WE2A 1I1SA 3RKYA 2M30A 2YSRA 1Z91A 2A5YB 2XHKA 4FHTA 4LLGF 3HSFA 4ENNA 5HLGA 3IHUA 3LQRA 1A04A 2O61A 3IKVA 1F4KA 3P9IA 1LB2A 5D8LB 1Z05A 2P8TA 3KCCA 3CLOA 2WV0A 3H3ZA 2QYOA 1UHWA 5A2QZ 1G3YA 1LEAA 4IVNA 2JTVA 1USTA 3FXQA 2XAGA 4AIKA 5ICCA 4HBLA 3EUHA 3TO7A 3C3WA 1HKQA 4LD5A 4CICA 2Z9OA 1YW8A 1REPC 3TO9A 2A6HF 3N97A 1I5ZA 1DPUA 2Y48A 4HW0A 3LQQA 3LAJA 4ZH4F 3K0LA 1R1VA 2PMHA 1LVAA 4XRFA 5ERIA 4LK1F 2FF4A 5FFZA 1BN5A 1B9MA 2ZNZA 1W7PA 5CVIA 1LDKB 3M8EA 2LKPA 2IRFG 3K9TA 3FX3A 1MZBA 2LNBA 1ODDA 2PG4A 1XGMA 2FU4A 4BHPA 1GVJA 2QZ8A 3FMQA 5CVRA 4L9NA 1LNWA 2KIMA 3M8FA 1TW2A 2R3SA 3E5QA 3ERED 1SD4A 4RB3C 3F6VA 5F6FA 1ZREA 2PLYA 4A5NA 4ZYEA 1XMKA 3BPXA 1Z6TA 3RKWA 2ISZA 2VXZA 4Q5SF 3WTXC 2LDUA 4KICA 1RUNA 1ZG5A 1IRFA 5J8FA 1JXSA 4FT8A 1XGNA 5DD4A 3GFMA 1ZGJA 1MDMB 4OIPF 1EV7A 1P4XA 2UZKA 5HLHA 1QBJA 4G7OF 2LF8A 3EYYA 3GZ6A 1K78B 2ZMEA 4WCGA 3R0AA 1W4MA 1ZG3A 2V9VA 2WTEA 1YYVA 2LF7A 2RVCA 1SMYF 4IPAA 4LLLA 2O3FA 4PZJA 3CUQB 2DPUA 3FMSA 2FNAA 5L3GA 3DPTA 1R22A 1XSVA 2HGCA 3RYRA 4ESFA 2V79A 1ZLKA 1WQ2A 3HHHA 3OV8A 3Q5FA 3IKTA 2PN6A 3MZYA 3JAMK 1LEBA 5LEKA 1J0RA 4Z2YA 3NRVA 1T98A 1T0FA 2DO7A 1U2WA 1LQ1A 1S3JA 2ETHA 2C6YA 2F2EA 3LSTA 3SQNA 2Q2EA 3KP2A 4BXUA 3HTUA 2GA2A 3HOSA 1YS7A 5J6XA 1KU7A 1R58A 2VBYA 2H27A 5LHHA 3J81K 1HXDA 2OU2A 3U9GA 4RGRA 4R8HA 3WU0A 3ABUA 1BI0A 1FSEA 5DCMB 4KIFA 4N9HA 1IN5A 4P9FA 2G7HA 2NAZA 3WE3A 4HX7A 5ICEA 3LFKA 1XB4A 4K2EA 3J7AO 3ZMUA 3ROUA 4MEYF 4E70A 3QPTA 4R1HA 2R7FA 5IT9Z 1Z6RA 3I53A 4M9SA 4OU0A 3RYPA 1U5TB 2VT2A 4KIGA 4M72A 2MH9A 4YG2F 1YW7A 2NNNA 3CO6C 1ZGAA 2DK5A 5DCFA 1YQAA 1B59A 1TW3A 1KQ0A 3ZMVA 3KP3A 2QBYA 2QQBA 1E17A 2GQQA 3VEPA 1W7PD 1PP7U 2IT0A 4H0EA 3HUGA 5BPDA 2GXBA 2IA0A 2YX7A 1XSDA 1SFXA 2DFIA 1G3WA 5EEHA 3SZPA 4RS8A 5BS6A 1KQ8A 4LFUA 4ENMA 3NQOA 4UVBA 5L3BA 1IRGA 2DTRA 2Z33A 2O6GE 3CJNA 2XGXA 2E7WA 4UV9A 4OOIA 2FA5A 2ESNA 3G73A 3E5UA 1OKRA 1DPRA 1R5HA 4Q47A 5DV5A 4BQAA 2EV0A 2DQLA 5A2QK 4G6QA 4HZFA 3O2PE 3QP6A 1FWZA 3BOQA 1IN4A 3CDHA 1O3QA 3W6JB 4Y17A 2RDPA 4LB6B 1WI9A 3KP7A 1FPQA 3KEQA 5IT3A 2GWRA 3L7WA 4M6YA 2O8XA 4GCVA 2DU9A 2A3SA 5K1YA 2A69F 2YPRA 5H20A 3WGHA 2HFHA 1RNLA 2J5OA 2JT1A 4JK1X 4L5JA 2UWMA 4EM0B 1IZ1A 2K86A 2VOOA 5DD8A 2DLLA 4IHSA 2FSWA 3ZP5A 1O57A 1R1TA 3RDIA 1T6SA 3BY6A 1G6NA 2FRHA 1CF7B 1QZZA 4JBAA 2VBWA 4UVAA 3DP7A 1GXQA 1TQPA 1J5YA 3ZQ7A 4AIHA 2W57A 1L3LA 4ZZLA 3BWGA 3MWMA 2AXLA 4EV0A 3BJOA 2M1BA 4WXHA 3V8LA 1Z9CA 2J5PA 4Q48A 5H6QA 3KP5A 1ZRCA 1FP2A 3ULQB 2CWEA 3F72A 1RI7A 1MKMA 2L02A 3M7GA 3MFKA 1H9GA 1TLHB 1XDUA 2E7XA 2O03A 3P9KA 2HS5A 4UXNA 2RN7A 1C0WA 2VT3A 2ZBKA 3FXRA 3ECHA 1HW5A 4WK8F 1FP1D 4KN7X 3E6DA 2ZJ2A 4KDPA 4LMYA 3R0JA 4ZZDA 4RAZA 4M71A 2XKOA 4A0ZA 4P5OA 1LDJA 3COAC 2VE8A 1JE8A 2H09A 4U7DA 2XVCA 4I98B 3JSOA 2PI0A 5HLIA 2IJLA 5TRDA 4DNCA 3IRQA 2OQRA 3F8MA 4XLNF 1SFEA 2GZWA 3K69A 3F23A 1BBYA 1R36A 4G7HF 1RUOA 4OIQF 3B73A 2WWYA 2IA2A 3VODA 5CJ9A 5FFXA 1ULYA 5K5QA 4MHGA 2P4WA 3KLOA 2NRAC 3J80Z 2V1XA 2QQAA 3VOEA 5D4SA 3QRFF 4U88A 4PCQA 1P92A 5HS9A 4D0PA 1DUXC 4HF1A 5BPIA 3DF8A 4GYGA 3GWZA 3L00A 3MZHA 3WG9A 2PFBA 1IF1A 5AONA 4G94A 4Q4ZF 2D2WA 3KFWX 2EFQA 1PUEE 4ESJA 3KEOA 4OMYA 1F1ZA 3ZPLA 1MJBA 5FD5A 4U0WA 5BMZA 3HHGA 1J9IA 3TOBA 2W24A 3F21A 2KJCA 1HKSA 4IRIA 5ILUA 2LSOA 4Y13A 5LGNA 2ZO4A 2HTJA 3KP6A 4WX9A 3BP8A 2M45A 1LJ9A 2K27A 4YFNF 3I59B 4HQEA 4A6DA 1ZARA 5E20A 3LA3A 3O3KA 3CUQC 4RGSA 3ZN1A 2E1CA 1UHMA 5IT9K 1IAWA 4CDGA 5ICGA 3V4GA 3R6SA 2XRNA 2E1NA 3QAHA 3I71A 1G3TA 2F5DA 2CSOA 4P96A 4L18B 3TOAA 5CVUA 3RPQA 1OYIA 2IPQX 4I09A 2CQKA 1AWCA 4AIJA 4HV5A 2CFXA 1JGSA 2YX4A 3KZYA 3GVAA 3RIRA 2QWWA 3MCZA 2EA2A 1FBSA 5K5OA 5HOOA 4MNUA 3ECOA 3P7NA 4LG0A 2QBYB 3TGNA 2PEXA 3SFZA 3EETA 2HKXA 4EJVA 2MLKA 2MBFA 5FLXZ 3BJAA 5D5WB 4FX0A 3GYHX 1MJ9A 4AWXB 4N0BA 2HKOA 3RI4A 2M8EA 1FX7A 1S6LA 3GFLA 4P55A 2M87A 4UV8A 4LB5A 2Y0MA 3LA2A 2YR2A 5D8KB 4EM2A 4NHJA 4HX8A 1KA8A 5E1XA 3KLNA 1YS6A 3FMRA 3WU1B 1FZPB 2P7CB 4G8XA 3Q9VA 1IXRC 2STTA 5FD6A 4YFKF 1U5TC 1FBQA 2A61A 3TDZC 4IHTA 1L0OC 4XSXF 2CO5A 4U0VA 1SFUA 2O0YA 4QLCU 3HRMA 4G6DA 2VC1A 4BH9A 4RGUA 2HWVA 3ZMSA 2R7DA 1KU9A 1XGOA 3H3UA 3C1DA 2VOPA 3R4KA 4EGZA 3DXJF 1RIOH 3E6CC 1H9TA 4I0BA 3QU6A 1J7KA 1EH8A 3M1EA 3EYIA 3FM3A 4KMFA 3BDDA 1FNNA 1XGSA 4NQWA 3T8TA 4GGGA 4YIFA 2STWA 2V6CA 3JW4A 1O3SA 3KE2A 2FNPA 5H6RA 1TNSA 4EJTA 1QNTA 3ML6A 6PAXA 1EH6A 3K2ZA 2KIUA 5DUKA 4MTEA 4WWCA 2K02A 3U2RA 2QENA 5D6EA 2ESHA 3K1MA 1JHFA 2XAQA 3GFJA 1KQ9A 5F64A 4ZYGA 3W6KB 1BI3A 2G7UA 4O5VA 3V8JA 4EGYA 3V7RA 4HV6A 4B8XA 3C18A 1FLIA 2Q8KA 2XV4S 2K4JA 1MDMA 3Q9SA 4WXDA 1YW9A 1QQIA 2KIFA 4RB0A 4EJWA 3WTZA 1STZA 1F5TA 1MJAA 1R00A 1U8RA 2PMUA 2DW4A 2ZKZA 5CLSA 2FBIA 2OD5A 4CZZA 1P4WA 1K78A 4I2OA 5CYVA 5BQTA 3I54A 4U0YA 4LLNA 2XKPA 3BROA 5LHGA 1JHHA 2OAZA 1XCBA 4HA8A 3WTVC 3V7CA 2RKHA 1R1UA 1YG2A 4AVPA 1O3TA 2COMA 3KZZA 1V3FA 2P6SA 3FZVA 4IRGA 2F5FA 5JR3A 4ENJA 4O6JA 3J80K 2XAFA 3EQLF 1YO5C 5LGTA 1P6RA 2OZ6A 1O7LA 5J8CA 1XMAA 4L9VA 2CW0F 2RGVA 2MA3A 4L5IA 1WRJA 3HRTA 2JZYA 2FOKA 1TQMA 4FX4A 4ESBA 2XIGA 1OPCA 1BI2A 4KT5C 4BYYA 4OINF 1FT9A 4IRHA 2ELHA 5AIPA 2K4BA 4KYWA 1UFMA 3RKXA 5FO5A 3F3XA 3TKYA 2RQPA 1U78A 1WKMA 3ZN0A 2QUFA 4WF2A 1P4AA 2IVMA 2KRFA 3K1NA 5KVRA 1X3UA 1RZ4A 1ZH5A 2IP2A 4OIRF 5HS7A 1W7PB 4HX4A 2FBHA 4JQFA 5DCMA 1YIOA 4A0XA 1ON1A 3VB2A 1GXPA 4YIIA 1K7AA 3RJPA 1TTYA 3GF2A 2QVOA 3GX4X 3ABTA 2M5WA 1ZYRF 3R61A 1QZYA 1DP7P 1YFHA 3LWFA 4R79A 4UUVA 2MH2A 4ENKA 1CGPA 5L3EA 1U5TA 4BHCA 1U6GA 3HRUA 3I0TA 3MQ0A 5LLQA 2X0LA 4IXAA 4A5MA 4P9UA 2DBBA 2WC2A 4RB1A 3FHZA 4HF0A 2EFPA 5KK1A 2ZFWA 4HLYA 2B0LA 3QPHA 2P5LC 1KU3A 2HYGD 1OMIA 4OMZA 3I5UA 2OBPA 3JTGA 4UVCA 2L4MA 1R5GA 2D1VA 2MLGA 3ZMDA 2GAUA 4YFXF 2FQ3A 1T39A 1SD5A 2L01A 4CGZA 2JPBA 3FM5A 4MGRA 5E18F 1S7AA 1S29A 4UHTA 2D45A 1HQCA 5HVQC 4PGHA 3IRRA 1ZN2A 1TBXA 5D5VB 4I01A 3LA7A 5FLXK 4KFCA 2GIVA 3O6BB 2ZMEB 3E6MA 1KGSA 1PP8F 3FXUA 3GLXA 1B9NA 2OZUA 2IA1A 2DPDA 4HYEA 5JHUA 3R60A 3ZMZA 2YU3A 2QLZA 3C7JA 5EEGA 2DK8A 4EVIA 3WTYC 2FEZA 2EV6A 3WTSC 5TJJA 2HYFA 2FMLA 2FE3A 1ZRDA 1ON2A 2MC3A 3HIFA 2W85A 4KMUX 2EA4A 4N9IA 3E3VA 3D0SA 3WTUC 4HOBA 1U3EM 4RB2C 1K6OA 1I1GA 1BC8C 2BBYA 2P7VB 1XCVA 1Z7UA 2HQRA 2QQ9A 1B6AA 2P6TA 3PQJA 1KYZA 2OQGA 1IN7A 1IXSB 4XSZF 1OYYA 4M9ZA 1PDNC 2XASA 4IJAA 3M9AA 2GA1A 1CF7A 3F8BA 4NB5A 2L4AA 1HKTA 3I64A 1UB9A 3JTHA 3ELKA 3GUDA 1WSUA 5LEJA 1YLFA 3I4PA 1HSTA 4RAYA 4CO8A 1D8JA 2H94A 1IN8A 2EFWA 3T1BA 2UXNA 2Q0OA 4RGXA 5E8GA 4DQ2A 1O7FA 4A6EA 3EDPA 2A07F 3SZTA 2TDXA 3L09A 2ACJA 1OYWA 1DDNA 1B1BA 2F5EA 2VONA 3DQVC 4TV7A 4A0YA 3QOPA 1IXCA 2GXGA 2W84A 2CGPA 2Z99A 3P9CA 3BJ6A 3IWFA 3MAJA 3DFGA 1F9NA 4F7ZA 3IWZA 1I27A 1Y0UA 3SXYA 1SD7A 1ZG1A 3WGGA 5E17F 2FBKA 3DPLC 3F8CA 3RTRA 5BOXA 1BJAA 2JRTA 5LBQA 4XBFA 2VN2A 4ETSA 1QGPA
chains in the Genus database with same CATH superfamily
3MEXA 3SEQA 3A0HC 1Z1DA 4II2A 5J4VA 1EH7A 2VODA 1HBXG 2E1OA 1W5TA 3CCQI 1S7OA 4CHUA 1Y8QB 1KU2A 3A01B 5FLMJ 2L7FP 3WTWC 3S93A 2HVSA 1KYWA 2JN6A 2DQRA 4JX6A 5J47A 1H89C 4CA0A 3HKZN 2K9MA 5KCMA 3HRSA 3OOPA 2HOEA 2ZFUA 3D5LA 1DQUA 1PVEA 2A68F 4GO1A 4ANJA 3JRGA 3FK7A 3IL2A 1UCRA 1BC7C 2FJ1A 2VQHA 3GO5A 1MD0A 2DOAA 2DA5A 3K1PA 3VYSB 3RQ4A 2XC7A 2YU9J 2NYXA 3E6BA 1WWXA 4A3MJ 2F5CA 3OYLA 3SFIA 1BIBA 1GHCA 3QPSA 5DDGA 4EM1A 3NEUA 4L9TA 2A05A 2Y2ZA 3BPVA 4BE1A 1MNDA 1AU7A 1D1BA 1MMNA 1Z3YA 1BOBA 1O3RA 2CUJA 2X85A 2VBXA 4UNOA 3K4NA 2EB7A 3H3VK 3BR1A 5LRRA 4I02A 4MQ9F 2DODA 3ZQIA 2XGDA 4M73A 3Q0WA 5ILSA 3JREA 1WJFA 2KRCA 4IEJA 1I3AA 4QWQA 4ZDPA 2FMYA 1J59A 1NHAA 5HDGA 3GLLA 3MKYB 3MKWB 3S1MJ 1WCMJ 3G4SI 2XB5A 3GZ5A 1HLVA 3TO6A 4MEXF 2K7LA 1FBUA 2IW5A 1XPXA 2NS0A 3B02A 5LHIA 3F8NA 5E1WA 2M0MA 2V1UA 4BNCA 2K9NA 3QP5A 1ZQ3P 1D0ZA 3ZOBA 1MBKA 4JOMA 5HLTA 2M35A 2L9RA 4WXCA 1WGXA 1ONVA 3JCUC 2NNYA 4HDVA 1T38A 3GXOA 3MZ8A 2JA6J 4BL0B 2F4MB 2DT5A 4A12A 2XROA 5C44J 1FIPA 1DU0A 3LNQA 2FXAA 1Y8RB 1IDYA 3HM5A 3S32A 3BT9A 2HEOA 2L9VA 2M0CA 2V1NA 1QO0D 4Y33A 4C3JJ 1HW1A 2QKLB 3T8RA 3IC7A 4MTDA 3ABLH 4G7ZF 3OS0A 3OYMA 5L3CA 2DDBA 2DOEA 1W5SA 4HLXA 4Y15A 3LOCA 2CQNA 5DUIA 2HOAA 3I59A 2DYSH 5ICFA 3SEZA 1SD6A 3CC7I 1SEUA 4U87A 4L0ZB 4CCOA 2L3DA 1OCZH 3L2CA 3H0GJ 5IP9J 2ZCWA 4KN4X 2LP0A 4KNYA 4V2GA 3V7SA 3G6EI 5FB2A 2ZNYA 4PK4A 4C2UA 1D8KA 2R5ZB 3RZOJ 4FQGA 3H1CA 3TEDA 2HDCA 1FEXA 3KETA 2MZ4A 5L3DA 4PGGA 1RR8C 3FWEA 3OYJA 3F22A 3T5XA 2DJNA 1USSA 2VXDA 5EZHA 1ZLJA 3J7YJ 4OAZA 2EWNA 1NG6A 4AD9A 1R7JA 1RR7A 5CVJA 2L7ZA 3EUHC 5HDKA 3G1LA 5E8IA 4D9JA 3EUAA 3ISPA 5HS8A 2H6BA 5JI6A 3HPHA 2CUFA 4M74A 5DEQA 1QPMA 3S2WA 3IH4A 2XSDC 4EMSA 2QKMB 2R7WA 1ETOA 2O5RA 3RPUA 3HXLA 2LG4A 5F0HA 3VFZA 3WGIA 3F6OA 4NC6A 5DS9A 2DA3A 2CYYA 1UG2A 1IJWC 2R7SA 1YTYA 1X4PA 5E3NA 2DJIA 1X4OA 2EQRA 5K5RA 4C2TA 2KKOA 5M5XJ 2LFBA 1HW2A 5AIQA 4A2UA 2G9WA 4EQQA 2BYVE 3LSIA 1BIAA 1TQIA 2NOJB 1T2KA 5GPAA 4U7BA 2CS3A 4OIOF 1XN7A 3ZMTA 3ZQCA 2R7TA 3CO7C 3S2DJ 3N4MA 2JMWA 3VSKA 2JPCA 2EFNA 4XLAA 2BZTA 2CG4A 3HTSB 1RPWA 2EJRA 3OYIA 2L54A 1MH4A 4LOCA 4HF2A 4KIBA 4CYCA 3CJTB 4D5FA 4HDUA 2W25A 1LDDA 3E97A 2VB6A 3LL7A 3HOTA 2XGCA 3T0YA 1XDSA 3CCYA 4Z6YA 4ON0A 1FSHA 1UELB 5LRSA 5LGUA 2UXXA 2DI3A 2MD0A 3QOEA 3CUQA 4CCKA 4IF4A 1B4AA 4BEHB 5F1RA 1R6RA 4B3AA 4XLPF 4KUMA 4BHBA 5JVTA 3I58A 2NVXJ 3CTAA 3OS1A 1UAAA 1H0MA 4GFBA 4MQVA 1FYKA 1G3SA 1VQ9I 1D5VA 1SAXA 1QHGA 1AOYA 2LLKA 2LRDA 2QSHX 1TNTA 2VBZA 3L2RA 2FUG2 3ZQFA 1IUYA 3G3ZA 1ENHA 2NS8A 1XSXA 3BG6A 3FXOA 5JVGF 1ZHFA 4MFEA 4CCJA 2BEOA 3OR1C 2HOSA 2QM3A 1BM9A 2RV8A 3FF5A 4DOZA 3PO2J 2HTSA 2PBIA 4I7HA 3JAMZ 2JK3A 4A3GJ 3TDUC 1BOAA 4ABZA 4ZYHA 3CUOA 1FMVA 3F8FA 2RNJA 2R7RA 1ZR4A 3DU5A 1X2NA 3TQNA 4ASNA 1MMAA 5ILVA 4D1QA 1FYLA 1E3PA 2NS7A 1FOKA 2A6EF 2VJ4A 4L0YB 2QEXI 4I0AA 3MKZA 3AAFA 3GFIA 5J1UA 2H6CA 2HR3A 2OPTA 1ETXA 3G1MA 1VTNC 3HG9A 3LSMA 5DYMA 5IYDJ 1XD7A 3JRDA 3H5RA 3AFHA 3TW6A 1SVMA 2JSCA 2OA4A 3BCBA 4B4CA 4NUBA 4B09A 3QU3A 2JVGA 1J2XA 5HDNA 1MGTA 1FY7A 5ED4A 2VJ5A 1D3YA 3F9KA 3BZ6A 4GXOA 4XRSA 1OR7A 2EV5A 3DLLF 4A3CJ 3VWBA 3JSPA 2VE9A 2VC0A 3GW2A 5B3SH 2XAJA 4LJZF 3PIPF 4BAYA 3L9FA 4C9YA 2E5NA 4L9JA 2O9LA 1OCCH 4CXFA 3KX2A 2CQ7A 3BCAA 1B8IB 1IW7F 3DKWA 4E7KA 4O3MA 3J81Z 2GXAA 4XNFA 3L1PA 4BQOA 2PQ8A 2LREA 1SMTA 3S3MA 2BXZA 3HYIA 2X4HA 3AL0C 1O4XA 2P5KA 3WODF 1ETYA 3PJRA 4GYIA 1WJEA 2D1HA 3FKJA 1ZAOA 4FCYA 4NC7A 2ZXJA 5M5YJ 2CRGA 3PQKA 4KA4A 1ZRFA 3DV8A 4LGWA 5E1ZB 1APLC 2BE5F 3CF2A 1BI1A 2XUBA 4BS9A 5D5XB 4N4OB 5GADJ 1I6XA 4HQMA 5D6FA 3OYEA 4M9XA 3E5XA 1AKHB 3H92A 2X6OA 3CMEI 1S5LC 1TWAJ 4IX7A 4A3KJ 1VQKI 2KJBA 3K2AA 3DEUA 3HSEA 1N25A 1A6QA 1IC8A 2EFOA 4CCNA 3RCOA 2JA8J 3REOA 4L5EA 2QCOA 3K4CA 2P5VA 3ZRGA 4S05A 5D4RA 1S8NA 2AS5F 4EJOA 4ZYDA 1J75A 1YOVB 2MD5A 3PFIA 1Q1HA 4HAMA 4LK0F 1K79A 4G9YA 1FC3A 2V1DA 1G4DA 4S04A 3DBHB 5JFRA 2XAHA 2BV6A 2VJIA 5H2FC 3V8KA 5D5UB 1N78A 1JUPA 3KP4A 2FOWA 3AG3H 2Z3YA 3SHFA 2N8GA 2PJPA 3S17J 2CV2A 2HVQA 2Y75A 5FGMA 1K83J 1U9OA 2LMDA 3W3CA 1YJWI 1E2XA 1P2FA 2BGCA 1R23A 1T0FC 1FYMA 4RAGA 4EJUA 3U1DA 1ZKGA 2KLOA 1HSJA 2Z5UA 3FXLA 3GEZA 1IN6A 2HZTA 1V4RA 4PDKA 3OYGA 4CYDA 5TISC 3G1OA 1I3QJ 1V55H 4M6XA 3WTTC 3K70C 2DFFA 4A3LJ 1TT0A 2DAOA 4DW6A 1MIJA 5GP9A 4LG0B 2RREA 3VSLA 3LAPA 3J81R 5CVVA 1IV8A 2MYSA 4ZTFA 2EK5A 5L3FA 2ISYA 2QA4I 1TWFJ 2HQNA 2R0QC 4XKCA 2ADUA 3HSRA 2X1EA 4BJ5C 2RC4A 3WE2A 3BTCA 1M1EB 1I1SA 2EBIA 4BE2A 3RKYA 2M30A 2YSRA 5EG0B 2VL8A 4ZYAA 3WHBA 1Z91A 2A5YB 2XHKA 3PNYA 4E6KG 4FHTA 4PUSA 4LLGF 3OYDA 3HSFA 4ENNA 2WV1A 5HLGA 1FTTA 3IHUA 1VQ4I 3LQRA 1A04A 2O61A 3IAM2 4KT6A 2HDDA 2I10A 4AYBA 3IKVA 3JRAA 5IOYA 3P9IA 3QWLA 1F4KA 2H8RA 1LB2A 3NWTA 1Z05A 5D8LB 2P8TA 3CDIA 3KCCA 3CLOA 1BR1A 2M3AA 2XPVA 4YEJA 1WPKA 2WV0A 3H3ZA 3PNVA 2QYOA 1UHWA 5A2QZ 3FXJA 3RZDJ 4A69C 1G3YA 1LEAA 2JTVA 4IVNA 1USTA 1XC5A 4JX5A 4BUPA 3OYAA 1BJZA 3FXQA 2XAGA 3IAS2 4AIKA 3RPUD 3HEFA 3D5SC 5ICCA 3QYEA 1BW6A 4HBLA 3EUHA 4BXXJ 3TO7A 3C3WA 4XN3A 1HKQA 3TBIA 2QQ8A 5C4XJ 4LD5A 1A31A 2ME6A 4CICA 1JT0A 1X1BA 3K10A 4C30A 3OR2C 2Z9OA 3CCRI 1VQ8I 1YW8A 2DFHA 2DN0A 1REPC 3QQAA 2JA5J 3TO9A 3OS2A 2A6HF 4RM2A 1D0XA 3N97A 1I5ZA 3TMOA 1DPUA 2Y48A 4HW0A 2PMZA 3LQQA 1S72I 1S7EA 5CKTA 3LAJA 4ZH4F 2K40A 4C3IJ 3K0LA 4IOCF 2KDOA 1S9HA 2CH0A 5M3MJ 2OF7A 3AG4H 1EJ9A 1GDTA 3BC8A 1TWHJ 1R1VA 2PMHA 1LVAA 4XRFA 5ERIA 5KNLA 3BR2A 4LK1F 2DMUA 2FF4A 5FFZA 1BN5A 1B9MA 1MBFA 2ZNZA 1W7PA 3K4LA 2DA4A 5CVIA 2HVRA 1LDKB 3M8EA 4DZPA 2LKPA 3OYBA 1H88C 4NQWB 2IRFG 3K9TA 1FMWA 3FX3A 1MZBA 1QZEA 2ZXHA 1LUJB 1ODDA 2LNBA 3OOUA 2PG4A 4JYKA 4XRSG 1XGMA 2FU4A 1G59A 4BHPA 1GVJA 2QZ8A 3CC4I 1MBGA 1U9NA 3FMQA 4MFDA 5CVRA 4L9NA 1LNWA 2O8KA 1VQNI 4BBRJ 1MMSA 1TZLA 2KIMA 3M8FA 1TW2A 4AIDA 2R3SA 2LD5A 2IAIA 3E5QA 4PSWA 3H9JA 4AYBN 3DTKA 3DWLE 3ERED 1SD4A 2WAFA 1VQLI 4I76A 4RB3C 2HQ5A 4E4HA 2V9PA 5CPRB 2R5YB 3F6VA 5F6FA 1ZTRA 3DCFA 2BY2A 1JJ8C 1ZREA 5GAHJ 2PLYA 4A5NA 2FD5A 4ZYEA 4Y52J 5EZGA 2Y9ZA 1XMKA 4XONA 2H8WA 2LY1A 1QU3A 1HOMA 1Y0NA 3BPXA 1Z6TA 3RKWA 2ISZA 4N4NB 2VKHA 1Z21A 2VXZA 4Q5SF 2IXSA 4EATA 2LBFB 4FETA 1VQOI 3WTXC 3GCMA 2LDUA 2IS2A 2EZKA 1JTYA 3EUKL 1Y6IA 4KICA 3CMMA 4XMYA 1WJDA 1RUNA 1ZG5A 1D1AA 1KONA 2XRLA 3HOXJ 4CH7A 1IRFA 2R7XA 1AA7A 1Z3XA 3HB9A 5J8FA 1JXSA 4FT8A 2BVLA 3E0JB 3DEEA 5EJCA 1XGNA 2BW3B 5DD4A 3GFMA 1ZGJA 1MDMB 4UY8I 2PMZN 2VKDA 4OIPF 3HGGA 2B63J 1EV7A 1P4XA 2UZKA 2ID6A 1IUFA 4XQFA 2OTLI 3SDGA 4XL9A 5HLHA 1QBJA 3ONQA 4G7OF 2LF8A 3M07A 4HRIA 1HC8A 1FOYA 1RESA 2Q1ZB 4IHVA 1EF4A 1WZ2A 5HODA 3EYYA 3GZ6A 1F43A 1ERDA 1SVOA 2YS9A 5B5EC 1FIAA 1K78B 3I4NJ 2XAUA 2ZMEA 4WCGA 3W2VA 3R0AA 5EYRA 1W4MA 3DLAA 4FE4A 4Y7NJ 1ZG3A 1E0EA 4CYCB 2V9VA 2XDVA 2XSJC 4X0GA 2WTEA 1A5JA 1YYVA 3IP4B 2LF7A 3GTGJ 2CU7A 2LYCA 1SMYF 2RVCA 4IPAA 2O3FA 4LLLA 1IG7A 4E7ZA 1J09A 4PZJA 3CUQB 4OWRB 4B1RA 2DPUA 3FMSA 1D1CA 3OWTA 1IRXA 2FNAA 5HNFA 5L3GA 3DPTA 2K5CA 1R22A 1XSVA 2HGCA 2JJ7A 3RYRA 3BG9A 2EIMH 2V79A 4ESFA 4ITVA 4F52A 1ZLKA 2R92J 1WQ2A 3HZJA 3IH3A 2LVSA 3HHHA 3OV8A 2I8DA 3C2HA 3Q5FA 2JQ7A 3IKTA 2PN6A 3MZYA 5FRMA 3JAMK 3A1YA 2V4JC 1LEBA 5LEKA 1VQ5I 1J0RA 3FXKA 3I4MJ 3HPGA 4Z2YA 3KYLA 4KITB 3NRVA 1T98A 3JRIA 2M34A 1GT0C 1NK3P 1DP3A 2TCTA 1T0FA 2E5ZA 2NOGA 1QRYA 2DO7A 1U2WA 4A3BJ 4RMNA 2BHYA 2OC6A 1LQ1A 1IV6A 4Y3OA 2CJJA 3KEYA 1S3JA 3PSFA 2ETHA 2E2IJ 2C6YA 2F2EA 5FJ8J 1YX3A 3LSTA 3G2BA 3SQNA 2Q2EA 3KP2A 4BXUA 2MUNA 3HTUA 2E36A 2GA2A 1V5FA 2X98A 3MMYB 3HOSA 1RKWA 4I6ZA 2M8GX 4ZC3A 2R7OA 1YS7A 5LD2C 3I56I 2MABA 2LY9A 1ZELA 5J6XA 2HNHA 1P7JA 1KU7A 1R58A 4PJJA 1W5CC 2VBYA 3BTJA 2HYJA 3LSKA 4PFOA 2H27A 5FRNA 5LHHA 3J81K 2CUZA 1JUMA 1HXDA 2BY0A 2ZSIB 3HDDA 2OU2A 5EDNA 3U9GA 4RGRA 2Y69H 4R8HA 3WU0A 3ABUA 1BI0A 1FSEA 5DCMB 3UKGA 4XKVA 4KIFA 4N9HA 1IN5A 4P9FA 1OJLA 2G7HA 3UR3C 1R49A 3FISA 2NAZA 2DT7B 2KIQA 1U0JA 1X1DA 1H8AC 1CQTA 3WE3A 4HX7A 5ICEA 3LFKA 5K7FA 1OCTC 1XB4A 4K2EA 3J7AO 5J40A 3ZMUA 1NK2P 3ROUA 4MEYF 4E70A 3VYRB 3QPTA 4HG2A 4R1HA 2R7FA 5IT9Z 3TP0A 1Z6RA 2LKXA 3VDXA 2AQEA 3WG7H 4CUGA 1MSEC 1BW5A 3I53A 4LB5A 4M9SA 4OU0A 1E3HA 3RYPA 1U5TB 3K7AJ 2PX9A 1X19A 2VT2A 3FBIB 4KIGA 3SDBA 4D7NA 1FTZA 1G8XA 4DBRA 4M72A 2MH9A 4YG2F 1YW7A 1LFBA 2QSFX 3KZIC 1YJ9I 2NNNA 1PUFB 3CO6C 2UV1A 1ZGAA 4C3HJ 2R7VA 3CMYA 3S2HJ 2DK5A 3IUOA 4FE7A 4F92B 2X51A 5DCFA 1YQAA 1B59A 4J19A 1TW3A 1KQ0A 1LFPA 3ZMVA 3GTMJ 3TP3A 3KP3A 2QBYA 3OY9A 5F1JA 2QQBA 4E7SA 1E17A 2GQQA 3VEPA 1W7PD 1PP7U 2IT0A 3DBLB 4H0EA 3HUGA 3ASOH 5BPDA 2GXBA 2IA0A 2YX7A 3IV5A 2V7FA 3QYBA 2M4KA 1VFCA 1OISA 1TP4A 1XSDA 4XIDA 2Y30A 1SFXA 4M6VA 2DFIA 1OCOH 1G3WA 2COBA 5EEHA 4RS8A 3SZPA 5BS6A 1KQ8A 4LFUA 3A01A 2MGQA 4BDZA 4ENMA 1B72B 2ZB9A 5CQGA 3NQOA 2R7QA 4UUSB 4UVBA 2M9HA 3ASNH 1A35A 1GVDA 5EGOB 3K4BA 1POGA 2KMUA 5L3BA 1IRGA 1I39A 5HNHA 2DTRA 2LH9A 3OIOA 1OLTA 3ZR8X 2Z33A 2O6GE 3CJNA 2XGXA 4LITA 2NVYJ 2JRMA 4XM3A 2E7WA 4UV9A 4B3XA 4OOIA 2Z2SB 2FA5A 1X3ZB 2ESNA 3G73A 3DTEA 3E5UA 2IGMA 3F0CA 1OKRA 1DPRA 2IGOA 2JUGA 1YRNB 2CW7A 1R5HA 4Q47A 5DV5A 3L2QA 4XR6A 4BQAA 2EV0A 2DQLA 5F04A 2DMPA 5A2QK 4A3FJ 4G6QA 3CZ6A 4HZFA 4CZCA 1ZR2A 5IOZA 3O2PE 4IKFA 3QP6A 1FWZA 3BOQA 4CSWA 1K4TA 1IN4A 3CDHA 1VQMI 3W6JB 1O3QA 4G12A 4HSRA 1F36A 4Y17A 4HNTA 2RDPA 4LB6B 1WI9A 3KP7A 1FPQA 3AG2H 3KEQA 5IT3A 2GWRA 3BR3A 3L7WA 4M6YA 2O8XA 4GCVA 2DU9A 3FKIJ 2A3SA 4E7LA 4HNVA 5K1YA 4PJMA 2EINH 2A69F 1BR4A 2KL4A 2YPRA 5H20A 3WGHA 2HFHA 1RNLA 2J5OA 2JT1A 2BY3A 4JK1X 4L5JA 2UWMA 3ABKH 2XB0X 4EM0B 1IZ1A 1T95A 2K86A 1R9TJ 2CQXA 2WB1A 3P5JA 5EF6A 2VOOA 5DD8A 3PUFA 3QODA 5DM6F 1OCRH 2DLLA 2VQGA 3X2QH 3ERMA 3S8PA 4IHSA 1OQYA 2FSWA 2IS6A 3HL2A 3U21A 3ZP5A 3C2GA 2DFEA 4GDFA 1O57A 3RQIA 1R1TA 3RDIA 1Z0XA 2DA6A 4XKBA 1T6SA 3BY6A 1G6NA 4F55A 2ECCA 3K4MA 2FRHA 2W48A 4DGWB 1CF7B 1QZZA 4JBAA 3LSPA 2VBWA 4UVAA 4RBOA 1TWCJ 3DP7A 4E7IA 1GXQA 1TQPA 1J5YA 3ZQ7A 4AIHA 1MMGA 4DYCA 2W57A 1L3LA 2WY8Q 5JLWA 4XKWA 2K9LA 3VYUB 1LE8B 2DA1A 4ZZLA 5BNGA 3BWGA 3MWMA 3JAMR 2AXLA 3OIPA 3SJMA 4EV0A 3BJOA 3K4KA 2R5ZA 2EZLA 2M1BA 1ITYA 4WXHA 3V8LA 1IDZA 1V54H 2OCEA 1Z9CA 2J5PA 4Q48A 5H6QA 3KP5A 1ZRCA 2DA7A 1AHDP 1FP2A 5K7HA 1Y1VJ 2F6CA 2E35A 1UMQA 3ULQB 2CWEA 3F72A 1RI7A 1D5YA 2CMPA 3K70D 1MKMA 5GAEJ 2L02A 2P0WA 2M2EA 1GUUA 2ELJA 1GV2A 4B47A 3M7GA 4PJLA 3MFKA 3CLQA 1H9GA 1TLHB 4DIQA 1XDUA 3UNGC 2E7XA 2O03A 3P9KA 2HS5A 2X9DA 2A5WA 4UXNA 3TL4X 5J4YA 4IHYA 2RN7A 1C0WA 2H1LA 2VT3A 2VKEA 2KDZA 3J7AW 2ZBKA 3FXRA 3ECHA 2ZSHB 1GLNA 1HW5A 2GIZA 4WK8F 1FP1D 2LK2A 4KN7X 3GTPJ 2DMQA 2CFOA 3E6DA 3BZKA 1FOWA 2KT0A 2ZJ2A 2E1MB 4QPQA 1EA3A 4KDPA 4LMYA 4LIUA 3E7LA 3R0JA 4RAZA 4ZZDA 4BBSJ 4M71A 1Z7LA 3OMYA 4BQQA 2R4GA 2XKOA 4A0ZA 1W0TA 3CP8A 2L7MP 4M3GA 4P5OA 1LDJA 2WB1N 3COAC 2VE8A 1JE8A 4X6AJ 2H09A 3V42A 2DCEA 4U7DA 2XVCA 4I98B 3JSOA 2PI0A 5C4JJ 2VJJA 4BJ6C 4MO7A 4RLFA 5HLIA 3SYTA 2IJLA 2JA2A 1SC7A 2E2HJ 1Y56A 5TRDA 3GTLJ 2DXIA 1OCPA 1WFXA 4DNCA 3IRQA 1RC9A 1BR2A 2LTPA 2OQRA 3F8MA 4ZJZA 4NDLA 1SAUA 1LKXA 4XLNF 1SFEA 2GZWA 3O8GA 3K69A 3F23A 1BBYA 1R36A 4G7HF 1RUOA 1WVRA 4OIQF 1FJLA 3B73A 2WWYA 2IA2A 3VODA 5CJ9A 2G0EA 5FFXA 1ULYA 2KP6A 4DZJA 3PL8A 5K5QA 1JJ6C 3HJEA 3CF5F 2WADA 3CJQB 4MHGA 4QIWN 2P4WA 3KLOA 2NRAC 3J80Z 2KPMA 1Y39A 2V1XA 2QQAA 3VOEA 5D4SA 3S16J 2M4GA 3QRFF 4U88A 4PCQA 1P92A 5HS9A 4BACA 3BR5A 3JRBA 4D0PA 1T08B 1DUXC 4HF1A 4ZTJA 1VF9A 5FKLA 4HSTA 3DF8A 2KQRA 4GYGA 5BPIA 3GWZA 3L00A 2EILH 1VQPI 1VI0A 1R71A 3HC7A 3J7AY 3HOUJ 2JUCA 2KZGA 2Z16A 3MZHA 3ZCOA 5K7ZA 2LR8A 3FK6A 3MD2A 3WG9A 2PFBA 2GLOA 1IF1A 1KZHA 4IOAF 3CCMI 3JRFA 3S15J 2TRTA 9ANTA 5AONA 4G94A 2GBYA 2L2OA 3MKLA 4Q4ZF 2ELKA 2HXOA 4W1UA 4AM3A 2D2WA 1RKTA 1YI2I 4HPQA 3KFWX 3OSFA 4PFPA 2EFQA 3AG1H 4AUXA 3GTJJ 3E1SA 3PNTA 1PUEE 1W36C 5IP6A 2F48A 4ESJA 3KEOA 4OMYA 1F1ZA 2M7AA 5M5WJ 1RETA 3PSIA 3H9QA 3ZPLA 1MJBA 4PSXA 4RLQA 3D5RC 5FD5A 4U0WA 1WH5A 2D5VA 3WU2C 2IS1A 1JGGA 4XN0A 1B8IA 1ETVA 5BMZA 5KAIC 3HHGA 1J9IA 3TOBA 3VYTB 2ID3A 3CP2A 1P9QC 1XMXA 3L2VA 2BOLA 2W24A 3F21A 2L5QA 2XF5A 2KJCA 2OUMA 2XPUA 3GMEA 3GZNB 1HKSA 1JKRC 1YE9A 4IRIA 5ILUA 4FASD 3C2BA 4ZDLA 3PUBA 4BXFA 5A2QR 2LSOA 4Y13A 5LGNA 2ZO4A 2HTJA 3KP6A 4WX9A 2HDWA 2WY7Q 1X1PA 3BP8A 3LMMA 5E3MA 1HF0A 2M45A 3J80R 1LJ9A 2F5VA 2K27A 4YFNF 1X1AA 2KHMA 1AKHA 3I59B 5C3EJ 4IO9F 4HQEA 4A6DA 1ZARA 5E20A 2DMTA 3LA3A 3DPUA 3O3KA 3BLYA 1K6YA 2VUMJ 3CUQC 3K6GA 4RGSA 5F27A 4V2FA 3ZN1A 3KYCB 3S3NA 2E1CA 2ME0A 1UHMA 5IT9K 2Z1DA 1IAWA 3DU6A 4CDGA 5ICGA 3V4GA 3R6SA 4KISA 2XRNA 2E1NA 3QAHA 3I71A 1TWGJ 1G3TA 1MBEA 1NG7A 2F5DA 4JP0A 3HOZJ 2RNGA 1RQ6A 3LSGA 3K4JA 2CSOA 4D5CA 4V19K 4P96A 1UZCA 1TC3C 2AQFA 4L18B 3TOAA 5CVUA 3ZGKA 1JKQC 3RPQA 1OYIA 5FKMA 2IPQX 3OL4A 2X1DA 4I09A 2CQKA 1EKEA 1AWCA 4AIJA 4M3FA 4HV5A 2CFXA 2BY1A 2KISA 1JGSA 3OSGA 3S1QJ 2YX4A 2AHQA 4NNJA 1Y1WJ 1G2HA 3KZYA 2W1OA 3GVAA 3RIRA 2QWWA 3MCZA 2EA2A 1GV5A 1FBSA 5K5OA 5HOOA 2DDAA 2HXIA 4MNUA 2IEKA 3ECOA 3P7NA 5CQEA 5FKNA 4LG0A 4IHWA 2QBYB 4DJAA 2WA0A 2RAEA 3TGNA 2PEXA 3MN2A 3SFZA 2OV7A 4E7JA 3EETA 2HKXA 2PJRA 1OFCX 4EJVA 2CV1A 2MLKA 3CC2I 1Z77A 1A36A 2MBFA 1OR7C 3PFYA 5FLXZ 3S1NJ 1JKPC 1MSFC 3BJAA 2IGNA 2XGEA 2DMNA 5D5WB 4FX0A 3GYHX 5EG0A 1MJ9A 3NARA 4AWXB 1DGRM 4N0BA 5IPAA 4UUTA 1SANA 2HKOA 2VASA 2M8EA 3RI4A 1FX7A 1S6LA 3GFLA 2LKSA 2K85A 2M87A 4P55A 4UV8A 2Y0MA 4AC0A 5IY5H 3LA2A 2YR2A 3J7ZI 1V5EA 2L9NA 5D8KB 4EM2A 2UUZA 4NHJA 4HX8A 4IHXA 1XTAA 1KA8A 4M3BA 5E1XA 3KLNA 1YS6A 3FMRA 3WU1B 2NXNB 2EIJH 1FZPB 2P7CB 2L9SA 3A4CA 4G8XA 3Q9VA 1IGNA 1IXRC 2STTA 5FD6A 4YFKF 1U5TC 1FBQA 2A61A 3TDZC 4J01A 4QTRA 2DT6A 3OYCA 3CMAI 4IHTA 1L0OC 2ECBA 4XSXF 2CO5A 2QF7A 4U0VA 1SFUA 3PIOF 2O0YA 2GOMA 4QLCU 3ESWB 2WAQN 3BR0A 4A3JJ 3HRMA 4G6DA 2VC1A 2W82A 3H36A 4BH9A 4M3EA 4RGUA 5DTDA 2HWVA 4NC8A 2E34A 1LFUP 3ZMSA 2HOTA 2R7DA 3LSHA 1UG0A 1KU9A 5KHDA 2MVTA 1XGOA 1W0UA 3H3UA 3C1DA 2VOPA 2HPMA 1XG1A 3R4KA 4J00A 4EGZA 3DXJF 5FLXR 1RIOH 3DEWA 3E6CC 1W1WE 1H9TA 4I0BA 4PJNA 3QU6A 1J7KA 1JI8A 1R5ID 5F0CA 3HBLA 1EH8A 3M1EA 3EYIA 3FM3A 4KMFA 2JA7J 1XX5A 3BDDA 1FNNA 1XGSA 4NQWA 3T8TA 1WJ5A 2JVHA 2X48A 4GGGA 4YIFA 2STWA 1QA6A 2V6CA 1WHUA 4XLFA 3JW4A 1O3SA 3KE2A 2CUEA 2FNPA 2HPIA 5H6RA 4A3DJ 2DOFA 1TNSA 5KAFC 4EJTA 1QNTA 3ML6A 6PAXA 4A93J 1EH6A 2MFZA 2B7EA 4RA2A 2ZJRF 3K2ZA 3HOYJ 2L7KA 4M3DA 2LC2A 2R5YA 4LIVA 2KIUA 5DUKA 1UHSA 1N77A 3BQYA 1X58A 4FISA 4MTEA 3HGYA 4WWCA 2K02A 3U2RA 3A52A 3RSNA 1DGWY 3AKZA 3L2WA 5GPCA 2QENA 4DYQA 5D6EA 2EIKH 2ESHA 1DU6A 3K1MA 2LBFA 1JHFA 2XAQA 2V6EA 3GFJA 1KQ9A 5F64A 2K9QA 4ZYGA 1VQ7I 4E7HA 3W6KB 1BI3A 4F3QA 2LOOA 1P7IA 1BA5A 2M7BA 2G7UA 4O5VA 3BTLA 3Q0VA 3V8JA 4EGYA 3V7RA 4HV6A 4BU2A 4MIMA 3ZQLA 4B8XA 3C18A 3OIQA 2BW3A 3VPRA 2Q8KA 1FLIA 2XV4S 2K4JA 2I5UA 1MDMA 3Q9SA 4WXDA 3BZCA 1YW9A 1QQIA 2E19A 2KIFA 3TW7A 4RB0A 4EJWA 3WTZA 3S14J 1STZA 4RAFA 1F5TA 1MJAA 3KYDB 1R00A 3BQZA 4EEFG 2PMUA 1U8RA 1PJRA 1YITI 3OL3A 1D0YA 2DW4A 2P81A 3BTIA 2ZKZA 3FHNA 5CLSA 2P0TA 2FBIA 3GTQJ 2OD5A 4CZZA 1P4WA 1K78A 4I2OA 2X6XA 2HI3A 2WBMA 1MH3A 4UB6C 5CYVA 1R4NB 2Y9YA 5BQTA 3I54A 4U0YA 4LLNA 2XKPA 3BROA 1TT5B 5LHGA 2E2JJ 5IT9R 2ZXWH 1JHHA 4AVZA 2OAZA 1XCBA 2KZVA 2NVTJ 3KIOA 4HA8A 1ACIA 3WTVC 4QPOA 4XK4A 1JKOC 3BG3A 2RKHA 3V7CA 1R1UA 1YG2A 2EZIA 3NAUA 4AVPA 3CCLI 1O3TA 2COMA 2ICWG 3KZZA 4HNUA 4OAYA 1V3FA 2P6SA 3FZVA 3M1CA 4IRGA 3U1KA 4F93B 2F5FA 5JR3A 4ENJA 5J3LA 5IP7J 1VZ0A 4O6JA 1TL8A 3J80K 3G71I 3CCEI 2XAFA 3EQLF 5E3OA 1U8BA 4CCMA 5LGTA 1P6RA 1YO5C 2OZ6A 1IRZA 1BL0A 1O7LA 5J8CA 5GTIC 1XMAA 2DYRH 2ZJPF 4L9VA 2HZDA 3SZGA 2CW0F 2RGVA 4Y4RA 2MA3A 4L5IA 1WRJA 3M3YJ 2VI6A 3HRTA 2XF6A 5F0FA 3CCUI 2JZYA 2QSGX 1JT6A 2FOKA 3H5AA 1TQMA 4FX4A 4LG3A 4ESBA 2XIGA 1OPCA 4BY7J 1ETQA 1BI2A 3RKQA 2B9SA 4KT5C 2IGKA 3FBNB 4BYYA 4OINF 1FT9A 4IRHA 2ELHA 5AIPA 2K4BA 4KYWA 1HCRA 1I6HJ 1UFMA 2XPWA 3RKXA 1K61A 1Q1VA 5FKKA 2E1MC 1QVTA 3F3XA 5FO5A 3TKYA 4X1EA 1K4SA 2RQPA 4BE0A 1U78A 4XLCA 1WKMA 3ZN0A 1JUSA 2VPLA 2QUFA 4UB8C 4WF2A 4F91B 1P4AA 1XS9A 2IVMA 2GM4A 2KRFA 1X2MA 2F4OB 1NH3A 3K1NA 5FROA 1FOXA 5KVRA 3A2KA 1X3UA 2MC4A 3LFUA 4G6TB 2OJED 1RZ4A 1ZH5A 2IP2A 4OIRF 5HS7A 1W7PB 3FIWA 4XORA 4HX4A 3S1RJ 2FBHA 2AXTC 4JQFA 5DCMA 2KFDA 3CCSI 1YIOA 4A0XA 3N05A 1LPQA 4YELA 1ON1A 3VB2A 1GXPA 1WJCA 4YIIA 1K7AA 2BVMA 2DTZA 3LSJA 3RJPA 1TTYA 3GF2A 2ZMEC 2QVOA 3GX4X 3ABTA 2VLAA 2M5WA 1ZYRF 3R61A 1QZYA 1DP7P 4A3EJ 5DM7F 2RQQA 1YFHA 3LWFA 2FQ4A 1ORKA 4R79A 4UUVA 3BR6A 1JTXA 2MH2A 4ENKA 5L3EA 1CGPA 1U5TA 4BHCA 1V5GA 1ZGWA 1MBJA 1U6GA 3HRUA 2R7ZJ 3I0TA 3MQ0A 2ZXIA 1MW7A 2E71A 5LLQA 2X0LA 4IXAA 4A5MA 3JR9A 1PUFA 4P9UA 4DYRA 2DBBA 2WC2A 4RB1A 3JRHA 4P1WA 3FHZA 2X6YA 4HF0A 2EFPA 2OCCH 5KK1A 2YUSA 2ZFWA 4ZDOA 4XLHA 4HLYA 2B0LA 3FXMA 2EH3A 3QPHA 3EPZA 2P5LC 1KU3A 1HA8A 2HYGD 4YRVA 1OMIA 4OMZA 3I5UA 2CV0A 4H4KC 2K3FA 3OYKA 2OBPA 3JTGA 4UVCA 1R4MB 3OYHA 1MNMC 3JRCA 2L4MA 3PO3J 1R5GA 5F08A 2DA2A 2VKVA 2D1VA 3L2UA 3ABMH 1NTCA 2MLGA 3ZMDA 2GAUA 2CQQA 2MW8A 4YFXF 1VQ6I 2FQ3A 3DKXA 1T39A 3QPLA 2Y31A 1T33A 1SD5A 1IO2A 2L01A 4CGZA 2JPBA 3FM5A 4MGRA 5E18F 2AO9A 1S7AA 1S29A 4UHTA 2D45A 2IS4A 2H1KA 2V26A 1HQCA 1SFOJ 5HVQC 4PGHA 3IH2A 3IRRA 1ZN2A 5JLXA 1B72A 1TBXA 5D5VB 4I01A 1SVLA 3LA7A 2PJRB 1WJAA 5FLXK 3AL0B 2Y0SA 4UUSA 4KFCA 3CDLA 2GIVA 3O6BB 3HOWJ 5EGOA 4BEHA 2K3PA 3ZQGA 2ZMEB 3OYNA 3E6MA 1KGSA 4HEA2 4B48A 3D1NI 3OYFA 1PP8F 2EZHA 5LFAA 2VQLA 2R7UA 3FXUA 2A6TA 4XOPA 3GLXA 5E79C 2E60A 1B9NA 2VPRA 1QVUA 2OZUA 4IQJA 2IA1A 2DPDA 4HYEA 5JHUA 3R60A 4PJ0C 2YU3A 3ZMZA 1YRNA 2QLZA 3DKYA 3C7JA 3HOVJ 1HDPA 5EEAA 5EEGA 2DK8A 4EVIA 2HU9A 4NBQA 3WTYC 2FEZA 2EV6A 2V9KA 2HQAA 3WTSC 4XOTA 5TJJA 2FX0A 3I9V2 2HYFA 2FMLA 2R93J 3CD6I 1MNEA 4A3IJ 2FE3A 4RDUA 3S3OA 1HDDC 1ZRDA 1ON2A 2L0KA 2MSYA 4IL6C 2WAEA 1W36D 2MC3A 3HIFA 2W85A 4KMUX 3I55I 3CCJI 5TGTA 3LSRA 1A6IA 2EA4A 4N9IA 4I99C 3E3VA 3WHCA 3CCVI 3D0SA 3BG5A 5JHFA 1YIJI 3WTUC 3A03A 4BY1J 4HOBA 5B1BH 4YIRX 4FTHA 1U3EM 4RB2C 3B6AA 1K6OA 3M4OJ 1I1GA 1BC8C 2BBYA 2W00A 3CQZJ 2P7VB 1N75A 4D7MA 1XCVA 3H5NA 5B66C 4CCLA 2ZJQF 5J1RA 1Z7UA 1RRJA 2HQRA 2QQ9A 2BHZA 1ETKA 1B6AA 2Q2EB 3H0DA 1LVKA 3Q3SA 4JX4A 2NVQJ 2P6TA 3PQJA 1YHQI 1KYZA 2OQGA 4IZZA 1IN7A 1IXSB 4XSZF 3A0BC 1UJ8A 1T56A 1OYYA 4M9ZA 4XLEA 1PDNC 2W4SA 1T8IA 2LY2A 3CJRB 3A02A 1YX5A 2XASA 4IJAA 3W2WA 3FDYA 3M9AA 1I50J 3BG7A 3PM1A 2GA1A 3HKZA 1MMDA 1ETWA 3I3LA 1CF7A 4KJZA 4GRIA 3F8BA 4NB5A 2L4AA 5M3FJ 1MBHA 2QGUA 1QHHD 3I64A 1HKTA 1UB9A 2X1CA 5GTHC 3JTHA 4BJTA 4DBQA 3ELKA 4MLOA 1X1CA 2K9SA 2Y0SN 4IQ4A 3GUDA 1WSUA 3ZQQA 5LEJA 3DBRB 1YLFA 5GAGJ 1LE8A 3I4PA 3MVPA 1HSTA 3CESA 3O8HA 4RAYA 4RM3A 2JSPA 4CO8A 4S0HB 2MG4A 1D8JA 3H35A 3Q0UA 1E3OC 2H94A 1IN8A 2EFWA 2O7OA 3T1BA 2UXNA 2Q0OA 4RGXA 5J1YA 3NWSA 5E8GA 1PYVA 4DQ2A 1O7FA 2X6WA 4A6EA 4AU7A 3EDPA 1VNDA 2WAQA 2A07F 2F4IA 2TDXA 3DTIA 3L09A 3SZTA 4B44A 2ACJA 1OYWA 4XICA 1DDNA 1B1BA 2F5EA 2VONA 2VIXA 2ZC2A 3DQVC 5FKOA 5FLVA 1Z67A 4TV7A 4A0YA 3GBGA 3QYFA 3QOPA 2XF7A 1IXCA 2GXGA 2OTJI 2W84A 3GTOJ 3ZQHA 4XRMA 2CGPA 2Z99A 1WJBA 2BXYA 5IYCJ 4QSHA 3P9CA 2CW8A 4BQNA 2NVUB 3BJ6A 3W2AA 3IWFA 3MAJA 2JWTA 2VQCA 3DFGA 1F9NA 4F7ZA 3GTKJ 1WI3A 1X3WB 2EPFA 4BGDA 3H9GA 3KPHA 1SFKA 3IWZA 4B43A 1I27A 3M8JA 1Y0UA 1ZK8A 5B1AH 2W7NA 3SXYA 1SD7A 2IBDA 1ZG1A 1QPIA 4BKXA 3WGGA 3W6VA 4II3A 4W97A 5E17F 2FBKA 5IYBJ 1YJNI 3DPLC 1WH7A 4BDYA 3B6CA 2GOXB 3F8CA 3RTRA 5BOXA 1BJAA 2JRTA 5LBQA 4C2MJ 4XBFA 2VN2A 3HUGB 4ETSA 2KRHA 1QGPA 3ZXSA 5E3LA
chains in the Genus database with same CATH topology
3MEXA 1Z1DA 1EH7A 2VODA 1HBXG 1W5TA 1S7OA 4CHUA 1KU2A 3WTWC 1KYWA 2DQRA 3HRSA 3OOPA 2HOEA 3D5LA 2A68F 4GO1A 3IL2A 1UCRA 1BC7C 3GO5A 1MD0A 3K1PA 2NYXA 3E6BA 1WWXA 2F5CA 1BIBA 1GHCA 5DDGA 4EM1A 3NEUA 4L9TA 3BPVA 1O3RA 2VBXA 4UNOA 2EB7A 5LRRA 4I02A 4MQ9F 4M73A 5ILSA 4QWQA 2FMYA 1J59A 1NHAA 5HDGA 3GZ5A 3TO6A 4MEXF 2K7LA 1FBUA 2IW5A 2NS0A 3B02A 5LHIA 3F8NA 5E1WA 2V1UA 4BNCA 3QP5A 4WXCA 4HDVA 1ONVA 2NNYA 1T38A 3GXOA 2DT5A 4A12A 2XROA 2FXAA 2HEOA 1QO0D 1HW1A 3T8RA 3IC7A 4MTDA 4G7ZF 5L3CA 1W5SA 4HLXA 4Y15A 5DUIA 3I59A 5ICFA 1SD6A 4L0ZB 2L3DA 3L2CA 2ZCWA 4KN4X 4KNYA 3V7SA 5FB2A 2ZNYA 1D8KA 2HDCA 3KETA 5L3DA 4PGGA 3FWEA 3F22A 3T5XA 1USSA 1ZLJA 2EWNA 4AD9A 1R7JA 5CVJA 5HDKA 5E8IA 3ISPA 5HS8A 2H6BA 5JI6A 4M74A 5DEQA 1QPMA 3S2WA 4EMSA 3RPUA 3WGIA 3VFZA 3F6OA 2CYYA 1YTYA 5K5RA 2KKOA 1HW2A 5AIQA 4A2UA 2G9WA 4EQQA 2BYVE 1BIAA 1TQIA 1T2KA 4U7BA 4OIOF 1XN7A 3ZMTA 3CO7C 3N4MA 2JPCA 2EFNA 2CG4A 3HTSB 2EJRA 2L54A 4HF2A 4KIBA 4HDUA 2W25A 1LDDA 3E97A 3HOTA 3T0YA 1XDSA 1FSHA 4ON0A 5LRSA 5LGUA 2UXXA 2DI3A 3CUQA 4IF4A 1B4AA 5F1RA 4XLPF 4KUMA 4BHBA 5JVTA 3I58A 3CTAA 1H0MA 4MQVA 1FYKA 1G3SA 1D5VA 1SAXA 1AOYA 1TNTA 2VBZA 1IUYA 3G3ZA 1XSXA 1ZHFA 2BEOA 2QM3A 1BM9A 2RV8A 3FF5A 2HTSA 2PBIA 4I7HA 3JAMZ 3TDUC 1BOAA 4ZYHA 3CUOA 3F8FA 2RNJA 3TQNA 4ASNA 5ILVA 1FYLA 1FOKA 2A6EF 4L0YB 4I0AA 3GFIA 3AAFA 2H6CA 2HR3A 1VTNC 5DYMA 1XD7A 2JSCA 2OA4A 4B09A 3QU3A 1J2XA 5HDNA 5ED4A 1MGTA 1FY7A 1D3YA 3BZ6A 4GXOA 1OR7A 2EV5A 3JSPA 2VE9A 2VC0A 3GW2A 2XAJA 4LJZF 4BAYA 3L9FA 4L9JA 4CXFA 1IW7F 3DKWA 4O3MA 3J81Z 2PQ8A 1SMTA 3HYIA 2X4HA 2P5KA 3WODF 4GYIA 2D1HA 1ZAOA 2ZXJA 3PQKA 4KA4A 1ZRFA 3DV8A 4LGWA 5E1ZB 2BE5F 1BI1A 2XUBA 5D5XB 1I6XA 4HQMA 5D6FA 4M9XA 3E5XA 3H92A 2KJBA 3DEUA 3HSEA 2EFOA 3REOA 5D4RA 4S05A 2P5VA 1S8NA 2AS5F 4EJOA 4ZYDA 1J75A 2MD5A 3PFIA 4LK0F 1Q1HA 4HAMA 1K79A 4G9YA 1FC3A 2V1DA 1G4DA 4S04A 5JFRA 2XAHA 2BV6A 5D5UB 3V8KA 3KP4A 2Z3YA 3SHFA 2PJPA 2Y75A 5FGMA 1E2XA 1P2FA 2BGCA 1R23A 1FYMA 4EJUA 3U1DA 1HSJA 2Z5UA 3GEZA 1IN6A 2HZTA 1V4RA 4PDKA 4CYDA 4M6XA 3WTTC 2DAOA 4LG0B 3LAPA 5CVVA 2EK5A 5L3FA 2ISYA 2HQNA 2ADUA 3HSRA 2RC4A 3WE2A 1I1SA 3RKYA 2M30A 2YSRA 1Z91A 2A5YB 2XHKA 4FHTA 4LLGF 3HSFA 4ENNA 5HLGA 3IHUA 3LQRA 1A04A 2O61A 3IKVA 1F4KA 3P9IA 1LB2A 5D8LB 1Z05A 2P8TA 3KCCA 3CLOA 2WV0A 3H3ZA 2QYOA 1UHWA 5A2QZ 1G3YA 1LEAA 4IVNA 2JTVA 1USTA 3FXQA 2XAGA 4AIKA 5ICCA 4HBLA 3EUHA 3TO7A 3C3WA 1HKQA 4LD5A 4CICA 2Z9OA 1YW8A 1REPC 3TO9A 2A6HF 3N97A 1I5ZA 1DPUA 2Y48A 4HW0A 3LQQA 3LAJA 4ZH4F 3K0LA 1R1VA 2PMHA 1LVAA 4XRFA 5ERIA 4LK1F 2FF4A 5FFZA 1BN5A 1B9MA 2ZNZA 1W7PA 5CVIA 1LDKB 3M8EA 2LKPA 2IRFG 3K9TA 3FX3A 1MZBA 2LNBA 1ODDA 2PG4A 1XGMA 2FU4A 4BHPA 1GVJA 2QZ8A 3FMQA 5CVRA 4L9NA 1LNWA 2KIMA 3M8FA 1TW2A 2R3SA 3E5QA 3ERED 1SD4A 4RB3C 3F6VA 5F6FA 1ZREA 2PLYA 4A5NA 4ZYEA 1XMKA 3BPXA 1Z6TA 3RKWA 2ISZA 2VXZA 4Q5SF 3WTXC 2LDUA 4KICA 1RUNA 1ZG5A 1IRFA 5J8FA 1JXSA 4FT8A 1XGNA 5DD4A 3GFMA 1ZGJA 1MDMB 4OIPF 1EV7A 1P4XA 2UZKA 5HLHA 1QBJA 4G7OF 2LF8A 3EYYA 3GZ6A 1K78B 2ZMEA 4WCGA 3R0AA 1W4MA 1ZG3A 2V9VA 2WTEA 1YYVA 2LF7A 2RVCA 1SMYF 4IPAA 4LLLA 2O3FA 4PZJA 3CUQB 2DPUA 3FMSA 2FNAA 5L3GA 3DPTA 1R22A 1XSVA 2HGCA 3RYRA 4ESFA 2V79A 1ZLKA 1WQ2A 3HHHA 3OV8A 3Q5FA 3IKTA 2PN6A 3MZYA 3JAMK 1LEBA 5LEKA 1J0RA 4Z2YA 3NRVA 1T98A 1T0FA 2DO7A 1U2WA 1LQ1A 1S3JA 2ETHA 2C6YA 2F2EA 3LSTA 3SQNA 2Q2EA 3KP2A 4BXUA 3HTUA 2GA2A 3HOSA 1YS7A 5J6XA 1KU7A 1R58A 2VBYA 2H27A 5LHHA 3J81K 1HXDA 2OU2A 3U9GA 4RGRA 4R8HA 3WU0A 3ABUA 1BI0A 1FSEA 5DCMB 4KIFA 4N9HA 1IN5A 4P9FA 2G7HA 2NAZA 3WE3A 4HX7A 5ICEA 3LFKA 1XB4A 4K2EA 3J7AO 3ZMUA 3ROUA 4MEYF 4E70A 3QPTA 4R1HA 2R7FA 5IT9Z 1Z6RA 3I53A 4M9SA 4OU0A 3RYPA 1U5TB 2VT2A 4KIGA 4M72A 2MH9A 4YG2F 1YW7A 2NNNA 3CO6C 1ZGAA 2DK5A 5DCFA 1YQAA 1B59A 1TW3A 1KQ0A 3ZMVA 3KP3A 2QBYA 2QQBA 1E17A 2GQQA 3VEPA 1W7PD 1PP7U 2IT0A 4H0EA 3HUGA 5BPDA 2GXBA 2IA0A 2YX7A 1XSDA 1SFXA 2DFIA 1G3WA 5EEHA 3SZPA 4RS8A 5BS6A 1KQ8A 4LFUA 4ENMA 3NQOA 4UVBA 5L3BA 1IRGA 2DTRA 2Z33A 2O6GE 3CJNA 2XGXA 2E7WA 4UV9A 4OOIA 2FA5A 2ESNA 3G73A 3E5UA 1OKRA 1DPRA 1R5HA 4Q47A 5DV5A 4BQAA 2EV0A 2DQLA 5A2QK 4G6QA 4HZFA 3O2PE 3QP6A 1FWZA 3BOQA 1IN4A 3CDHA 1O3QA 3W6JB 4Y17A 2RDPA 4LB6B 1WI9A 3KP7A 1FPQA 3KEQA 5IT3A 2GWRA 3L7WA 4M6YA 2O8XA 4GCVA 2DU9A 2A3SA 5K1YA 2A69F 2YPRA 5H20A 3WGHA 2HFHA 1RNLA 2J5OA 2JT1A 4JK1X 4L5JA 2UWMA 4EM0B 1IZ1A 2K86A 2VOOA 5DD8A 2DLLA 4IHSA 2FSWA 3ZP5A 1O57A 1R1TA 3RDIA 1T6SA 3BY6A 1G6NA 2FRHA 1CF7B 1QZZA 4JBAA 2VBWA 4UVAA 3DP7A 1GXQA 1TQPA 1J5YA 3ZQ7A 4AIHA 2W57A 1L3LA 4ZZLA 3BWGA 3MWMA 2AXLA 4EV0A 3BJOA 2M1BA 4WXHA 3V8LA 1Z9CA 2J5PA 4Q48A 5H6QA 3KP5A 1ZRCA 1FP2A 3ULQB 2CWEA 3F72A 1RI7A 1MKMA 2L02A 3M7GA 3MFKA 1H9GA 1TLHB 1XDUA 2E7XA 2O03A 3P9KA 2HS5A 4UXNA 2RN7A 1C0WA 2VT3A 2ZBKA 3FXRA 3ECHA 1HW5A 4WK8F 1FP1D 4KN7X 3E6DA 2ZJ2A 4KDPA 4LMYA 3R0JA 4ZZDA 4RAZA 4M71A 2XKOA 4A0ZA 4P5OA 1LDJA 3COAC 2VE8A 1JE8A 2H09A 4U7DA 2XVCA 4I98B 3JSOA 2PI0A 5HLIA 2IJLA 5TRDA 4DNCA 3IRQA 2OQRA 3F8MA 4XLNF 1SFEA 2GZWA 3K69A 3F23A 1BBYA 1R36A 4G7HF 1RUOA 4OIQF 3B73A 2WWYA 2IA2A 3VODA 5CJ9A 5FFXA 1ULYA 5K5QA 4MHGA 2P4WA 3KLOA 2NRAC 3J80Z 2V1XA 2QQAA 3VOEA 5D4SA 3QRFF 4U88A 4PCQA 1P92A 5HS9A 4D0PA 1DUXC 4HF1A 5BPIA 3DF8A 4GYGA 3GWZA 3L00A 3MZHA 3WG9A 2PFBA 1IF1A 5AONA 4G94A 4Q4ZF 2D2WA 3KFWX 2EFQA 1PUEE 4ESJA 3KEOA 4OMYA 1F1ZA 3ZPLA 1MJBA 5FD5A 4U0WA 5BMZA 3HHGA 1J9IA 3TOBA 2W24A 3F21A 2KJCA 1HKSA 4IRIA 5ILUA 2LSOA 4Y13A 5LGNA 2ZO4A 2HTJA 3KP6A 4WX9A 3BP8A 2M45A 1LJ9A 2K27A 4YFNF 3I59B 4HQEA 4A6DA 1ZARA 5E20A 3LA3A 3O3KA 3CUQC 4RGSA 3ZN1A 2E1CA 1UHMA 5IT9K 1IAWA 4CDGA 5ICGA 3V4GA 3R6SA 2XRNA 2E1NA 3QAHA 3I71A 1G3TA 2F5DA 2CSOA 4P96A 4L18B 3TOAA 5CVUA 3RPQA 1OYIA 2IPQX 4I09A 2CQKA 1AWCA 4AIJA 4HV5A 2CFXA 1JGSA 2YX4A 3KZYA 3GVAA 3RIRA 2QWWA 3MCZA 2EA2A 1FBSA 5K5OA 5HOOA 4MNUA 3ECOA 3P7NA 4LG0A 2QBYB 3TGNA 2PEXA 3SFZA 3EETA 2HKXA 4EJVA 2MLKA 2MBFA 5FLXZ 3BJAA 5D5WB 4FX0A 3GYHX 1MJ9A 4AWXB 4N0BA 2HKOA 3RI4A 2M8EA 1FX7A 1S6LA 3GFLA 4P55A 2M87A 4UV8A 4LB5A 2Y0MA 3LA2A 2YR2A 5D8KB 4EM2A 4NHJA 4HX8A 1KA8A 5E1XA 3KLNA 1YS6A 3FMRA 3WU1B 1FZPB 2P7CB 4G8XA 3Q9VA 1IXRC 2STTA 5FD6A 4YFKF 1U5TC 1FBQA 2A61A 3TDZC 4IHTA 1L0OC 4XSXF 2CO5A 4U0VA 1SFUA 2O0YA 4QLCU 3HRMA 4G6DA 2VC1A 4BH9A 4RGUA 2HWVA 3ZMSA 2R7DA 1KU9A 1XGOA 3H3UA 3C1DA 2VOPA 3R4KA 4EGZA 3DXJF 1RIOH 3E6CC 1H9TA 4I0BA 3QU6A 1J7KA 1EH8A 3M1EA 3EYIA 3FM3A 4KMFA 3BDDA 1FNNA 1XGSA 4NQWA 3T8TA 4GGGA 4YIFA 2STWA 2V6CA 3JW4A 1O3SA 3KE2A 2FNPA 5H6RA 1TNSA 4EJTA 1QNTA 3ML6A 6PAXA 1EH6A 3K2ZA 2KIUA 5DUKA 4MTEA 4WWCA 2K02A 3U2RA 2QENA 5D6EA 2ESHA 3K1MA 1JHFA 2XAQA 3GFJA 1KQ9A 5F64A 4ZYGA 3W6KB 1BI3A 2G7UA 4O5VA 3V8JA 4EGYA 3V7RA 4HV6A 4B8XA 3C18A 1FLIA 2Q8KA 2XV4S 2K4JA 1MDMA 3Q9SA 4WXDA 1YW9A 1QQIA 2KIFA 4RB0A 4EJWA 3WTZA 1STZA 1F5TA 1MJAA 1R00A 1U8RA 2PMUA 2DW4A 2ZKZA 5CLSA 2FBIA 2OD5A 4CZZA 1P4WA 1K78A 4I2OA 5CYVA 5BQTA 3I54A 4U0YA 4LLNA 2XKPA 3BROA 5LHGA 1JHHA 2OAZA 1XCBA 4HA8A 3WTVC 3V7CA 2RKHA 1R1UA 1YG2A 4AVPA 1O3TA 2COMA 3KZZA 1V3FA 2P6SA 3FZVA 4IRGA 2F5FA 5JR3A 4ENJA 4O6JA 3J80K 2XAFA 3EQLF 1YO5C 5LGTA 1P6RA 2OZ6A 1O7LA 5J8CA 1XMAA 4L9VA 2CW0F 2RGVA 2MA3A 4L5IA 1WRJA 3HRTA 2JZYA 2FOKA 1TQMA 4FX4A 4ESBA 2XIGA 1OPCA 1BI2A 4KT5C 4BYYA 4OINF 1FT9A 4IRHA 2ELHA 5AIPA 2K4BA 4KYWA 1UFMA 3RKXA 5FO5A 3F3XA 3TKYA 2RQPA 1U78A 1WKMA 3ZN0A 2QUFA 4WF2A 1P4AA 2IVMA 2KRFA 3K1NA 5KVRA 1X3UA 1RZ4A 1ZH5A 2IP2A 4OIRF 5HS7A 1W7PB 4HX4A 2FBHA 4JQFA 5DCMA 1YIOA 4A0XA 1ON1A 3VB2A 1GXPA 4YIIA 1K7AA 3RJPA 1TTYA 3GF2A 2QVOA 3GX4X 3ABTA 2M5WA 1ZYRF 3R61A 1QZYA 1DP7P 1YFHA 3LWFA 4R79A 4UUVA 2MH2A 4ENKA 1CGPA 5L3EA 1U5TA 4BHCA 1U6GA 3HRUA 3I0TA 3MQ0A 5LLQA 2X0LA 4IXAA 4A5MA 4P9UA 2DBBA 2WC2A 4RB1A 3FHZA 4HF0A 2EFPA 5KK1A 2ZFWA 4HLYA 2B0LA 3QPHA 2P5LC 1KU3A 2HYGD 1OMIA 4OMZA 3I5UA 2OBPA 3JTGA 4UVCA 2L4MA 1R5GA 2D1VA 2MLGA 3ZMDA 2GAUA 4YFXF 2FQ3A 1T39A 1SD5A 2L01A 4CGZA 2JPBA 3FM5A 4MGRA 5E18F 1S7AA 1S29A 4UHTA 2D45A 1HQCA 5HVQC 4PGHA 3IRRA 1ZN2A 1TBXA 5D5VB 4I01A 3LA7A 5FLXK 4KFCA 2GIVA 3O6BB 2ZMEB 3E6MA 1KGSA 1PP8F 3FXUA 3GLXA 1B9NA 2OZUA 2IA1A 2DPDA 4HYEA 5JHUA 3R60A 3ZMZA 2YU3A 2QLZA 3C7JA 5EEGA 2DK8A 4EVIA 3WTYC 2FEZA 2EV6A 3WTSC 5TJJA 2HYFA 2FMLA 2FE3A 1ZRDA 1ON2A 2MC3A 3HIFA 2W85A 4KMUX 2EA4A 4N9IA 3E3VA 3D0SA 3WTUC 4HOBA 1U3EM 4RB2C 1K6OA 1I1GA 1BC8C 2BBYA 2P7VB 1XCVA 1Z7UA 2HQRA 2QQ9A 1B6AA 2P6TA 3PQJA 1KYZA 2OQGA 1IN7A 1IXSB 4XSZF 1OYYA 4M9ZA 1PDNC 2XASA 4IJAA 3M9AA 2GA1A 1CF7A 3F8BA 4NB5A 2L4AA 1HKTA 3I64A 1UB9A 3JTHA 3ELKA 3GUDA 1WSUA 5LEJA 1YLFA 3I4PA 1HSTA 4RAYA 4CO8A 1D8JA 2H94A 1IN8A 2EFWA 3T1BA 2UXNA 2Q0OA 4RGXA 5E8GA 4DQ2A 1O7FA 4A6EA 3EDPA 2A07F 3SZTA 2TDXA 3L09A 2ACJA 1OYWA 1DDNA 1B1BA 2F5EA 2VONA 3DQVC 4TV7A 4A0YA 3QOPA 1IXCA 2GXGA 2W84A 2CGPA 2Z99A 3P9CA 3BJ6A 3IWFA 3MAJA 3DFGA 1F9NA 4F7ZA 3IWZA 1I27A 1Y0UA 3SXYA 1SD7A 1ZG1A 3WGGA 5E17F 2FBKA 3DPLC 3F8CA 3RTRA 5BOXA 1BJAA 2JRTA 5LBQA 4XBFA 2VN2A 4ETSA 1QGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEX A;  1Z1D A;  1EH7 A;  2VOD A;  1HBX G;  1W5T A;  1S7O A;  4CHU A;  1KU2 A;  3WTW C;  1KYW A;  2DQR A;  3HRS A;  3OOP A;  2HOE A;  3D5L A;  2A68 F;  4GO1 A;  3IL2 A;  1UCR A;  1BC7 C;  3GO5 A;  1MD0 A;  3K1P A;  2NYX A;  3E6B A;  1WWX A;  2F5C A;  1BIB A;  1GHC A;  5DDG A;  4EM1 A;  3NEU A;  4L9T A;  3BPV A;  1O3R A;  2VBX A;  4UNO A;  2EB7 A;  5LRR A;  4I02 A;  4MQ9 F;  4M73 A;  5ILS A;  4QWQ A;  2FMY A;  1J59 A;  1NHA A;  5HDG A;  3GZ5 A;  3TO6 A;  4MEX F;  2K7L A;  1FBU A;  2IW5 A;  2NS0 A;  3B02 A;  5LHI A;  3F8N A;  5E1W A;  2V1U A;  4BNC A;  3QP5 A;  4WXC A;  4HDV A;  1ONV A;  2NNY A;  1T38 A;  3GXO A;  2DT5 A;  4A12 A;  2XRO A;  2FXA A;  2HEO A;  1QO0 D;  1HW1 A;  3T8R A;  3IC7 A;  4MTD A;  4G7Z F;  5L3C A;  1W5S A;  4HLX A;  4Y15 A;  5DUI A;  3I59 A;  5ICF A;  1SD6 A;  4L0Z B;  2L3D A;  3L2C A;  2ZCW A;  4KN4 X;  4KNY A;  3V7S A;  5FB2 A;  2ZNY A;  1D8K A;  2HDC A;  3KET A;  5L3D A;  4PGG A;  3FWE A;  3F22 A;  3T5X A;  1USS A;  1ZLJ A;  2EWN A;  4AD9 A;  1R7J A;  5CVJ A;  5HDK A;  5E8I A;  3ISP A;  5HS8 A;  2H6B A;  5JI6 A;  4M74 A;  5DEQ A;  1QPM A;  3S2W A;  4EMS A;  3RPU A;  3WGI A;  3VFZ A;  3F6O A;  2CYY A;  1YTY A;  5K5R A;  2KKO A;  1HW2 A;  5AIQ A;  4A2U A;  2G9W A;  4EQQ A;  2BYV E;  1BIA A;  1TQI A;  1T2K A;  4U7B A;  4OIO F;  1XN7 A;  3ZMT A;  3CO7 C;  3N4M A;  2JPC A;  2EFN A;  2CG4 A;  3HTS B;  2EJR A;  2L54 A;  4HF2 A;  4KIB A;  4HDU A;  2W25 A;  1LDD A;  3E97 A;  3HOT A;  3T0Y A;  1XDS A;  1FSH A;  4ON0 A;  5LRS A;  5LGU A;  2UXX A;  2DI3 A;  3CUQ A;  4IF4 A;  1B4A A;  5F1R A;  4XLP F;  4KUM A;  4BHB A;  5JVT A;  3I58 A;  3CTA A;  1H0M A;  4MQV A;  1FYK A;  1G3S A;  1D5V A;  1SAX A;  1AOY A;  1TNT A;  2VBZ A;  1IUY A;  3G3Z A;  1XSX A;  1ZHF A;  2BEO A;  2QM3 A;  1BM9 A;  2RV8 A;  3FF5 A;  2HTS A;  2PBI A;  4I7H A;  3JAM Z;  3TDU C;  1BOA A;  4ZYH A;  3CUO A;  3F8F A;  2RNJ A;  3TQN A;  4ASN A;  5ILV A;  1FYL A;  1FOK A;  2A6E F;  4L0Y B;  4I0A A;  3GFI A;  3AAF A;  2H6C A;  2HR3 A;  1VTN C;  5DYM A;  1XD7 A;  2JSC A;  2OA4 A;  4B09 A;  3QU3 A;  1J2X A;  5HDN A;  5ED4 A;  1MGT A;  1FY7 A;  1D3Y A;  3BZ6 A;  4GXO A;  1OR7 A;  2EV5 A;  3JSP A;  2VE9 A;  2VC0 A;  3GW2 A;  2XAJ A;  4LJZ F;  4BAY A;  3L9F A;  4L9J A;  4CXF A;  1IW7 F;  3DKW A;  4O3M A;  3J81 Z;  2PQ8 A;  1SMT A;  3HYI A;  2X4H A;  2P5K A;  3WOD F;  4GYI A;  2D1H A;  1ZAO A;  2ZXJ A;  3PQK A;  4KA4 A;  1ZRF A;  3DV8 A;  4LGW A;  5E1Z B;  2BE5 F;  1BI1 A;  2XUB A;  5D5X B;  1I6X A;  4HQM A;  5D6F A;  4M9X A;  3E5X A;  3H92 A;  2KJB A;  3DEU A;  3HSE A;  2EFO A;  3REO A;  5D4R A;  4S05 A;  2P5V A;  1S8N A;  2AS5 F;  4EJO A;  4ZYD A;  1J75 A;  2MD5 A;  3PFI A;  4LK0 F;  1Q1H A;  4HAM A;  1K79 A;  4G9Y A;  1FC3 A;  2V1D A;  1G4D A;  4S04 A;  5JFR A;  2XAH A;  2BV6 A;  5D5U B;  3V8K A;  3KP4 A;  2Z3Y A;  3SHF A;  2PJP A;  2Y75 A;  5FGM A;  1E2X A;  1P2F A;  2BGC A;  1R23 A;  1FYM A;  4EJU A;  3U1D A;  1HSJ A;  2Z5U A;  3GEZ A;  1IN6 A;  2HZT A;  1V4R A;  4PDK A;  4CYD A;  4M6X A;  3WTT C;  2DAO A;  4LG0 B;  3LAP A;  5CVV A;  2EK5 A;  5L3F A;  2ISY A;  2HQN A;  2ADU A;  3HSR A;  2RC4 A;  3WE2 A;  1I1S A;  3RKY A;  2M30 A;  2YSR A;  1Z91 A;  2A5Y B;  2XHK A;  4FHT A;  4LLG F;  3HSF A;  4ENN A;  5HLG A;  3IHU A;  3LQR A;  1A04 A;  2O61 A;  3IKV A;  1F4K A;  3P9I A;  1LB2 A;  5D8L B;  1Z05 A;  2P8T A;  3KCC A;  3CLO A;  2WV0 A;  3H3Z A;  2QYO A;  1UHW A;  5A2Q Z;  1G3Y A;  1LEA A;  4IVN A;  2JTV A;  1UST A;  3FXQ A;  2XAG A;  4AIK A;  5ICC A;  4HBL A;  3EUH A;  3TO7 A;  3C3W A;  1HKQ A;  4LD5 A;  4CIC A;  2Z9O A;  1YW8 A;  1REP C;  3TO9 A;  2A6H F;  3N97 A;  1I5Z A;  1DPU A;  2Y48 A;  4HW0 A;  3LQQ A;  3LAJ A;  4ZH4 F;  3K0L A;  1R1V A;  2PMH A;  1LVA A;  4XRF A;  5ERI A;  4LK1 F;  2FF4 A;  5FFZ A;  1BN5 A;  1B9M A;  2ZNZ A;  1W7P A;  5CVI A;  1LDK B;  3M8E A;  2LKP A;  2IRF G;  3K9T A;  3FX3 A;  1MZB A;  2LNB A;  1ODD A;  2PG4 A;  1XGM A;  2FU4 A;  4BHP A;  1GVJ A;  2QZ8 A;  3FMQ A;  5CVR A;  4L9N A;  1LNW A;  2KIM A;  3M8F A;  1TW2 A;  2R3S A;  3E5Q A;  3ERE D;  1SD4 A;  4RB3 C;  3F6V A;  5F6F A;  1ZRE A;  2PLY A;  4A5N A;  4ZYE A;  1XMK A;  3BPX A;  1Z6T A;  3RKW A;  2ISZ A;  2VXZ A;  4Q5S F;  3WTX C;  2LDU A;  4KIC A;  1RUN A;  1ZG5 A;  1IRF A;  5J8F A;  1JXS A;  4FT8 A;  1XGN A;  5DD4 A;  3GFM A;  1ZGJ A;  1MDM B;  4OIP F;  1EV7 A;  1P4X A;  2UZK A;  5HLH A;  1QBJ A;  4G7O F;  2LF8 A;  3EYY A;  3GZ6 A;  1K78 B;  2ZME A;  4WCG A;  3R0A A;  1W4M A;  1ZG3 A;  2V9V A;  2WTE A;  1YYV A;  2LF7 A;  2RVC A;  1SMY F;  4IPA A;  4LLL A;  2O3F A;  4PZJ A;  3CUQ B;  2DPU A;  3FMS A;  2FNA A;  5L3G A;  3DPT A;  1R22 A;  1XSV A;  2HGC A;  3RYR A;  4ESF A;  2V79 A;  1ZLK A;  1WQ2 A;  3HHH A;  3OV8 A;  3Q5F A;  3IKT A;  2PN6 A;  3MZY A;  3JAM K;  1LEB A;  5LEK A;  1J0R A;  4Z2Y A;  3NRV A;  1T98 A;  1T0F A;  2DO7 A;  1U2W A;  1LQ1 A;  1S3J A;  2ETH A;  2C6Y A;  2F2E A;  3LST A;  3SQN A;  2Q2E A;  3KP2 A;  4BXU A;  3HTU A;  2GA2 A;  3HOS A;  1YS7 A;  5J6X A;  1KU7 A;  1R58 A;  2VBY A;  2H27 A;  5LHH A;  3J81 K;  1HXD A;  2OU2 A;  3U9G A;  4RGR A;  4R8H A;  3WU0 A;  3ABU A;  1BI0 A;  1FSE A;  5DCM B;  4KIF A;  4N9H A;  1IN5 A;  4P9F A;  2G7H A;  2NAZ A;  3WE3 A;  4HX7 A;  5ICE A;  3LFK A;  1XB4 A;  4K2E A;  3J7A O;  3ZMU A;  3ROU A;  4MEY F;  4E70 A;  3QPT A;  4R1H A;  2R7F A;  5IT9 Z;  1Z6R A;  3I53 A;  4M9S A;  4OU0 A;  3RYP A;  1U5T B;  2VT2 A;  4KIG A;  4M72 A;  2MH9 A;  4YG2 F;  1YW7 A;  2NNN A;  3CO6 C;  1ZGA A;  2DK5 A;  5DCF A;  1YQA A;  1B59 A;  1TW3 A;  1KQ0 A;  3ZMV A;  3KP3 A;  2QBY A;  2QQB A;  1E17 A;  2GQQ A;  3VEP A;  1W7P D;  1PP7 U;  2IT0 A;  4H0E A;  3HUG A;  5BPD A;  2GXB A;  2IA0 A;  2YX7 A;  1XSD A;  1SFX A;  2DFI A;  1G3W A;  5EEH A;  3SZP A;  4RS8 A;  5BS6 A;  1KQ8 A;  4LFU A;  4ENM A;  3NQO A;  4UVB A;  5L3B A;  1IRG A;  2DTR A;  2Z33 A;  2O6G E;  3CJN A;  2XGX A;  2E7W A;  4UV9 A;  4OOI A;  2FA5 A;  2ESN A;  3G73 A;  3E5U A;  1OKR A;  1DPR A;  1R5H A;  4Q47 A;  5DV5 A;  4BQA A;  2EV0 A;  2DQL A;  5A2Q K;  4G6Q A;  4HZF A;  3O2P E;  3QP6 A;  1FWZ A;  3BOQ A;  1IN4 A;  3CDH A;  1O3Q A;  3W6J B;  4Y17 A;  2RDP A;  4LB6 B;  1WI9 A;  3KP7 A;  1FPQ A;  3KEQ A;  5IT3 A;  2GWR A;  3L7W A;  4M6Y A;  2O8X A;  4GCV A;  2DU9 A;  2A3S A;  5K1Y A;  2A69 F;  2YPR A;  5H20 A;  3WGH A;  2HFH A;  1RNL A;  2J5O A;  2JT1 A;  4JK1 X;  4L5J A;  2UWM A;  4EM0 B;  1IZ1 A;  2K86 A;  2VOO A;  5DD8 A;  2DLL A;  4IHS A;  2FSW A;  3ZP5 A;  1O57 A;  1R1T A;  3RDI A;  1T6S A;  3BY6 A;  1G6N A;  2FRH A;  1CF7 B;  1QZZ A;  4JBA A;  2VBW A;  4UVA A;  3DP7 A;  1GXQ A;  1TQP A;  1J5Y A;  3ZQ7 A;  4AIH A;  2W57 A;  1L3L A;  4ZZL A;  3BWG A;  3MWM A;  2AXL A;  4EV0 A;  3BJO A;  2M1B A;  4WXH A;  3V8L A;  1Z9C A;  2J5P A;  4Q48 A;  5H6Q A;  3KP5 A;  1ZRC A;  1FP2 A;  3ULQ B;  2CWE A;  3F72 A;  1RI7 A;  1MKM A;  2L02 A;  3M7G A;  3MFK A;  1H9G A;  1TLH B;  1XDU A;  2E7X A;  2O03 A;  3P9K A;  2HS5 A;  4UXN A;  2RN7 A;  1C0W A;  2VT3 A;  2ZBK A;  3FXR A;  3ECH A;  1HW5 A;  4WK8 F;  1FP1 D;  4KN7 X;  3E6D A;  2ZJ2 A;  4KDP A;  4LMY A;  3R0J A;  4ZZD A;  4RAZ A;  4M71 A;  2XKO A;  4A0Z A;  4P5O A;  1LDJ A;  3COA C;  2VE8 A;  1JE8 A;  2H09 A;  4U7D A;  2XVC A;  4I98 B;  3JSO A;  2PI0 A;  5HLI A;  2IJL A;  5TRD A;  4DNC A;  3IRQ A;  2OQR A;  3F8M A;  4XLN F;  1SFE A;  2GZW A;  3K69 A;  3F23 A;  1BBY A;  1R36 A;  4G7H F;  1RUO A;  4OIQ F;  3B73 A;  2WWY A;  2IA2 A;  3VOD A;  5CJ9 A;  5FFX A;  1ULY A;  5K5Q A;  4MHG A;  2P4W A;  3KLO A;  2NRA C;  3J80 Z;  2V1X A;  2QQA A;  3VOE A;  5D4S A;  3QRF F;  4U88 A;  4PCQ A;  1P92 A;  5HS9 A;  4D0P A;  1DUX C;  4HF1 A;  5BPI A;  3DF8 A;  4GYG A;  3GWZ A;  3L00 A;  3MZH A;  3WG9 A;  2PFB A;  1IF1 A;  5AON A;  4G94 A;  4Q4Z F;  2D2W A;  3KFW X;  2EFQ A;  1PUE E;  4ESJ A;  3KEO A;  4OMY A;  1F1Z A;  3ZPL A;  1MJB A;  5FD5 A;  4U0W A;  5BMZ A;  3HHG A;  1J9I A;  3TOB A;  2W24 A;  3F21 A;  2KJC A;  1HKS A;  4IRI A;  5ILU A;  2LSO A;  4Y13 A;  5LGN A;  2ZO4 A;  2HTJ A;  3KP6 A;  4WX9 A;  3BP8 A;  2M45 A;  1LJ9 A;  2K27 A;  4YFN F;  3I59 B;  4HQE A;  4A6D A;  1ZAR A;  5E20 A;  3LA3 A;  3O3K A;  3CUQ C;  4RGS A;  3ZN1 A;  2E1C A;  1UHM A;  5IT9 K;  1IAW A;  4CDG A;  5ICG A;  3V4G A;  3R6S A;  2XRN A;  2E1N A;  3QAH A;  3I71 A;  1G3T A;  2F5D A;  2CSO A;  4P96 A;  4L18 B;  3TOA A;  5CVU A;  3RPQ A;  1OYI A;  2IPQ X;  4I09 A;  2CQK A;  1AWC A;  4AIJ A;  4HV5 A;  2CFX A;  1JGS A;  2YX4 A;  3KZY A;  3GVA A;  3RIR A;  2QWW A;  3MCZ A;  2EA2 A;  1FBS A;  5K5O A;  5HOO A;  4MNU A;  3ECO A;  3P7N A;  4LG0 A;  2QBY B;  3TGN A;  2PEX A;  3SFZ A;  3EET A;  2HKX A;  4EJV A;  2MLK A;  2MBF A;  5FLX Z;  3BJA A;  5D5W B;  4FX0 A;  3GYH X;  1MJ9 A;  4AWX B;  4N0B A;  2HKO A;  3RI4 A;  2M8E A;  1FX7 A;  1S6L A;  3GFL A;  4P55 A;  2M87 A;  4UV8 A;  4LB5 A;  2Y0M A;  3LA2 A;  2YR2 A;  5D8K B;  4EM2 A;  4NHJ A;  4HX8 A;  1KA8 A;  5E1X A;  3KLN A;  1YS6 A;  3FMR A;  3WU1 B;  1FZP B;  2P7C B;  4G8X A;  3Q9V A;  1IXR C;  2STT A;  5FD6 A;  4YFK F;  1U5T C;  1FBQ A;  2A61 A;  3TDZ C;  4IHT A;  1L0O C;  4XSX F;  2CO5 A;  4U0V A;  1SFU A;  2O0Y A;  4QLC U;  3HRM A;  4G6D A;  2VC1 A;  4BH9 A;  4RGU A;  2HWV A;  3ZMS A;  2R7D A;  1KU9 A;  1XGO A;  3H3U A;  3C1D A;  2VOP A;  3R4K A;  4EGZ A;  3DXJ F;  1RIO H;  3E6C C;  1H9T A;  4I0B A;  3QU6 A;  1J7K A;  1EH8 A;  3M1E A;  3EYI A;  3FM3 A;  4KMF A;  3BDD A;  1FNN A;  1XGS A;  4NQW A;  3T8T A;  4GGG A;  4YIF A;  2STW A;  2V6C A;  3JW4 A;  1O3S A;  3KE2 A;  2FNP A;  5H6R A;  1TNS A;  4EJT A;  1QNT A;  3ML6 A;  6PAX A;  1EH6 A;  3K2Z A;  2KIU A;  5DUK A;  4MTE A;  4WWC A;  2K02 A;  3U2R A;  2QEN A;  5D6E A;  2ESH A;  3K1M A;  1JHF A;  2XAQ A;  3GFJ A;  1KQ9 A;  5F64 A;  4ZYG A;  3W6K B;  1BI3 A;  2G7U A;  4O5V A;  3V8J A;  4EGY A;  3V7R A;  4HV6 A;  4B8X A;  3C18 A;  1FLI A;  2Q8K A;  2XV4 S;  2K4J A;  1MDM A;  3Q9S A;  4WXD A;  1YW9 A;  1QQI A;  2KIF A;  4RB0 A;  4EJW A;  3WTZ A;  1STZ A;  1F5T A;  1MJA A;  1R00 A;  1U8R A;  2PMU A;  2DW4 A;  2ZKZ A;  5CLS A;  2FBI A;  2OD5 A;  4CZZ A;  1P4W A;  1K78 A;  4I2O A;  5CYV A;  5BQT A;  3I54 A;  4U0Y A;  4LLN A;  2XKP A;  3BRO A;  5LHG A;  1JHH A;  2OAZ A;  1XCB A;  4HA8 A;  3WTV C;  3V7C A;  2RKH A;  1R1U A;  1YG2 A;  4AVP A;  1O3T A;  2COM A;  3KZZ A;  1V3F A;  2P6S A;  3FZV A;  4IRG A;  2F5F A;  5JR3 A;  4ENJ A;  4O6J A;  3J80 K;  2XAF A;  3EQL F;  1YO5 C;  5LGT A;  1P6R A;  2OZ6 A;  1O7L A;  5J8C A;  1XMA A;  4L9V A;  2CW0 F;  2RGV A;  2MA3 A;  4L5I A;  1WRJ A;  3HRT A;  2JZY A;  2FOK A;  1TQM A;  4FX4 A;  4ESB A;  2XIG A;  1OPC A;  1BI2 A;  4KT5 C;  4BYY A;  4OIN F;  1FT9 A;  4IRH A;  2ELH A;  5AIP A;  2K4B A;  4KYW A;  1UFM A;  3RKX A;  5FO5 A;  3F3X A;  3TKY A;  2RQP A;  1U78 A;  1WKM A;  3ZN0 A;  2QUF A;  4WF2 A;  1P4A A;  2IVM A;  2KRF A;  3K1N A;  5KVR A;  1X3U A;  1RZ4 A;  1ZH5 A;  2IP2 A;  4OIR F;  5HS7 A;  1W7P B;  4HX4 A;  2FBH A;  4JQF A;  5DCM A;  1YIO A;  4A0X A;  1ON1 A;  3VB2 A;  1GXP A;  4YII A;  1K7A A;  3RJP A;  1TTY A;  3GF2 A;  2QVO A;  3GX4 X;  3ABT A;  2M5W A;  1ZYR F;  3R61 A;  1QZY A;  1DP7 P;  1YFH A;  3LWF A;  4R79 A;  4UUV A;  2MH2 A;  4ENK A;  1CGP A;  5L3E A;  1U5T A;  4BHC A;  1U6G A;  3HRU A;  3I0T A;  3MQ0 A;  5LLQ A;  2X0L A;  4IXA A;  4A5M A;  4P9U A;  2DBB A;  2WC2 A;  4RB1 A;  3FHZ A;  4HF0 A;  2EFP A;  5KK1 A;  2ZFW A;  4HLY A;  2B0L A;  3QPH A;  2P5L C;  1KU3 A;  2HYG D;  1OMI A;  4OMZ A;  3I5U A;  2OBP A;  3JTG A;  4UVC A;  2L4M A;  1R5G A;  2D1V A;  2MLG A;  3ZMD A;  2GAU A;  4YFX F;  2FQ3 A;  1T39 A;  1SD5 A;  2L01 A;  4CGZ A;  2JPB A;  3FM5 A;  4MGR A;  5E18 F;  1S7A A;  1S29 A;  4UHT A;  2D45 A;  1HQC A;  5HVQ C;  4PGH A;  3IRR A;  1ZN2 A;  1TBX A;  5D5V B;  4I01 A;  3LA7 A;  5FLX K;  4KFC A;  2GIV A;  3O6B B;  2ZME B;  3E6M A;  1KGS A;  1PP8 F;  3FXU A;  3GLX A;  1B9N A;  2OZU A;  2IA1 A;  2DPD A;  4HYE A;  5JHU A;  3R60 A;  3ZMZ A;  2YU3 A;  2QLZ A;  3C7J A;  5EEG A;  2DK8 A;  4EVI A;  3WTY C;  2FEZ A;  2EV6 A;  3WTS C;  5TJJ A;  2HYF A;  2FML A;  2FE3 A;  1ZRD A;  1ON2 A;  2MC3 A;  3HIF A;  2W85 A;  4KMU X;  2EA4 A;  4N9I A;  3E3V A;  3D0S A;  3WTU C;  4HOB A;  1U3E M;  4RB2 C;  1K6O A;  1I1G A;  1BC8 C;  2BBY A;  2P7V B;  1XCV A;  1Z7U A;  2HQR A;  2QQ9 A;  1B6A A;  2P6T A;  3PQJ A;  1KYZ A;  2OQG A;  1IN7 A;  1IXS B;  4XSZ F;  1OYY A;  4M9Z A;  1PDN C;  2XAS A;  4IJA A;  3M9A A;  2GA1 A;  1CF7 A;  3F8B A;  4NB5 A;  2L4A A;  1HKT A;  3I64 A;  1UB9 A;  3JTH A;  3ELK A;  3GUD A;  1WSU A;  5LEJ A;  1YLF A;  3I4P A;  1HST A;  4RAY A;  4CO8 A;  1D8J A;  2H94 A;  1IN8 A;  2EFW A;  3T1B A;  2UXN A;  2Q0O A;  4RGX A;  5E8G A;  4DQ2 A;  1O7F A;  4A6E A;  3EDP A;  2A07 F;  3SZT A;  2TDX A;  3L09 A;  2ACJ A;  1OYW A;  1DDN A;  1B1B A;  2F5E A;  2VON A;  3DQV C;  4TV7 A;  4A0Y A;  3QOP A;  1IXC A;  2GXG A;  2W84 A;  2CGP A;  2Z99 A;  3P9C A;  3BJ6 A;  3IWF A;  3MAJ A;  3DFG A;  1F9N A;  4F7Z A;  3IWZ A;  1I27 A;  1Y0U A;  3SXY A;  1SD7 A;  1ZG1 A;  3WGG A;  5E17 F;  2FBK A;  3DPL C;  3F8C A;  3RTR A;  5BOX A;  1BJA A;  2JRT A;  5LBQ A;  4XBF A;  2VN2 A;  4ETS A;  1QGP A; 
#chains in the Genus database with same CATH topology
 3MEX A;  3SEQ A;  3A0H C;  1Z1D A;  4II2 A;  5J4V A;  1EH7 A;  2VOD A;  1HBX G;  2E1O A;  1W5T A;  3CCQ I;  1S7O A;  4CHU A;  1Y8Q B;  1KU2 A;  3A01 B;  5FLM J;  2L7F P;  3WTW C;  3S93 A;  2HVS A;  1KYW A;  2JN6 A;  2DQR A;  4JX6 A;  5J47 A;  1H89 C;  4CA0 A;  3HKZ N;  2K9M A;  5KCM A;  3HRS A;  3OOP A;  2HOE A;  2ZFU A;  3D5L A;  1DQU A;  1PVE A;  2A68 F;  4GO1 A;  4ANJ A;  3JRG A;  3FK7 A;  3IL2 A;  1UCR A;  1BC7 C;  2FJ1 A;  2VQH A;  3GO5 A;  1MD0 A;  2DOA A;  2DA5 A;  3K1P A;  3VYS B;  3RQ4 A;  2XC7 A;  2YU9 J;  2NYX A;  3E6B A;  1WWX A;  4A3M J;  2F5C A;  3OYL A;  3SFI A;  1BIB A;  1GHC A;  3QPS A;  5DDG A;  4EM1 A;  3NEU A;  4L9T A;  2A05 A;  2Y2Z A;  3BPV A;  4BE1 A;  1MND A;  1AU7 A;  1D1B A;  1MMN A;  1Z3Y A;  1BOB A;  1O3R A;  2CUJ A;  2X85 A;  2VBX A;  4UNO A;  3K4N A;  2EB7 A;  3H3V K;  3BR1 A;  5LRR A;  4I02 A;  4MQ9 F;  2DOD A;  3ZQI A;  2XGD A;  4M73 A;  3Q0W A;  5ILS A;  3JRE A;  1WJF A;  2KRC A;  4IEJ A;  1I3A A;  4QWQ A;  4ZDP A;  2FMY A;  1J59 A;  1NHA A;  5HDG A;  3GLL A;  3MKY B;  3MKW B;  3S1M J;  1WCM J;  3G4S I;  2XB5 A;  3GZ5 A;  1HLV A;  3TO6 A;  4MEX F;  2K7L A;  1FBU A;  2IW5 A;  1XPX A;  2NS0 A;  3B02 A;  5LHI A;  3F8N A;  5E1W A;  2M0M A;  2V1U A;  4BNC A;  2K9N A;  3QP5 A;  1ZQ3 P;  1D0Z A;  3ZOB A;  1MBK A;  4JOM A;  5HLT A;  2M35 A;  2L9R A;  4WXC A;  1WGX A;  1ONV A;  3JCU C;  2NNY A;  4HDV A;  1T38 A;  3GXO A;  3MZ8 A;  2JA6 J;  4BL0 B;  2F4M B;  2DT5 A;  4A12 A;  2XRO A;  5C44 J;  1FIP A;  1DU0 A;  3LNQ A;  2FXA A;  1Y8R B;  1IDY A;  3HM5 A;  3S32 A;  3BT9 A;  2HEO A;  2L9V A;  2M0C A;  2V1N A;  1QO0 D;  4Y33 A;  4C3J J;  1HW1 A;  2QKL B;  3T8R A;  3IC7 A;  4MTD A;  3ABL H;  4G7Z F;  3OS0 A;  3OYM A;  5L3C A;  2DDB A;  2DOE A;  1W5S A;  4HLX A;  4Y15 A;  3LOC A;  2CQN A;  5DUI A;  2HOA A;  3I59 A;  2DYS H;  5ICF A;  3SEZ A;  1SD6 A;  3CC7 I;  1SEU A;  4U87 A;  4L0Z B;  4CCO A;  2L3D A;  1OCZ H;  3L2C A;  3H0G J;  5IP9 J;  2ZCW A;  4KN4 X;  2LP0 A;  4KNY A;  4V2G A;  3V7S A;  3G6E I;  5FB2 A;  2ZNY A;  4PK4 A;  4C2U A;  1D8K A;  2R5Z B;  3RZO J;  4FQG A;  3H1C A;  3TED A;  2HDC A;  1FEX A;  3KET A;  2MZ4 A;  5L3D A;  4PGG A;  1RR8 C;  3FWE A;  3OYJ A;  3F22 A;  3T5X A;  2DJN A;  1USS A;  2VXD A;  5EZH A;  1ZLJ A;  3J7Y J;  4OAZ A;  2EWN A;  1NG6 A;  4AD9 A;  1R7J A;  1RR7 A;  5CVJ A;  2L7Z A;  3EUH C;  5HDK A;  3G1L A;  5E8I A;  4D9J A;  3EUA A;  3ISP A;  5HS8 A;  2H6B A;  5JI6 A;  3HPH A;  2CUF A;  4M74 A;  5DEQ A;  1QPM A;  3S2W A;  3IH4 A;  2XSD C;  4EMS A;  2QKM B;  2R7W A;  1ETO A;  2O5R A;  3RPU A;  3HXL A;  2LG4 A;  5F0H A;  3VFZ A;  3WGI A;  3F6O A;  4NC6 A;  5DS9 A;  2DA3 A;  2CYY A;  1UG2 A;  1IJW C;  2R7S A;  1YTY A;  1X4P A;  5E3N A;  2DJI A;  1X4O A;  2EQR A;  5K5R A;  4C2T A;  2KKO A;  5M5X J;  2LFB A;  1HW2 A;  5AIQ A;  4A2U A;  2G9W A;  4EQQ A;  2BYV E;  3LSI A;  1BIA A;  1TQI A;  2NOJ B;  1T2K A;  5GPA A;  4U7B A;  2CS3 A;  4OIO F;  1XN7 A;  3ZMT A;  3ZQC A;  2R7T A;  3CO7 C;  3S2D J;  3N4M A;  2JMW A;  3VSK A;  2JPC A;  2EFN A;  4XLA A;  2BZT A;  2CG4 A;  3HTS B;  1RPW A;  2EJR A;  3OYI A;  2L54 A;  1MH4 A;  4LOC A;  4HF2 A;  4KIB A;  4CYC A;  3CJT B;  4D5F A;  4HDU A;  2W25 A;  1LDD A;  3E97 A;  2VB6 A;  3LL7 A;  3HOT A;  2XGC A;  3T0Y A;  1XDS A;  3CCY A;  4Z6Y A;  4ON0 A;  1FSH A;  1UEL B;  5LRS A;  5LGU A;  2UXX A;  2DI3 A;  2MD0 A;  3QOE A;  3CUQ A;  4CCK A;  4IF4 A;  1B4A A;  4BEH B;  5F1R A;  1R6R A;  4B3A A;  4XLP F;  4KUM A;  4BHB A;  5JVT A;  3I58 A;  2NVX J;  3CTA A;  3OS1 A;  1UAA A;  1H0M A;  4GFB A;  4MQV A;  1FYK A;  1G3S A;  1VQ9 I;  1D5V A;  1SAX A;  1QHG A;  1AOY A;  2LLK A;  2LRD A;  2QSH X;  1TNT A;  2VBZ A;  3L2R A;  2FUG 2;  3ZQF A;  1IUY A;  3G3Z A;  1ENH A;  2NS8 A;  1XSX A;  3BG6 A;  3FXO A;  5JVG F;  1ZHF A;  4MFE A;  4CCJ A;  2BEO A;  3OR1 C;  2HOS A;  2QM3 A;  1BM9 A;  2RV8 A;  3FF5 A;  4DOZ A;  3PO2 J;  2HTS A;  2PBI A;  4I7H A;  3JAM Z;  2JK3 A;  4A3G J;  3TDU C;  1BOA A;  4ABZ A;  4ZYH A;  3CUO A;  1FMV A;  3F8F A;  2RNJ A;  2R7R A;  1ZR4 A;  3DU5 A;  1X2N A;  3TQN A;  4ASN A;  1MMA A;  5ILV A;  4D1Q A;  1FYL A;  1E3P A;  2NS7 A;  1FOK A;  2A6E F;  2VJ4 A;  4L0Y B;  2QEX I;  4I0A A;  3MKZ A;  3AAF A;  3GFI A;  5J1U A;  2H6C A;  2HR3 A;  2OPT A;  1ETX A;  3G1M A;  1VTN C;  3HG9 A;  3LSM A;  5DYM A;  5IYD J;  1XD7 A;  3JRD A;  3H5R A;  3AFH A;  3TW6 A;  1SVM A;  2JSC A;  2OA4 A;  3BCB A;  4B4C A;  4NUB A;  4B09 A;  3QU3 A;  2JVG A;  1J2X A;  5HDN A;  1MGT A;  1FY7 A;  5ED4 A;  2VJ5 A;  1D3Y A;  3F9K A;  3BZ6 A;  4GXO A;  4XRS A;  1OR7 A;  2EV5 A;  3DLL F;  4A3C J;  3VWB A;  3JSP A;  2VE9 A;  2VC0 A;  3GW2 A;  5B3S H;  2XAJ A;  4LJZ F;  3PIP F;  4BAY A;  3L9F A;  4C9Y A;  2E5N A;  4L9J A;  2O9L A;  1OCC H;  4CXF A;  3KX2 A;  2CQ7 A;  3BCA A;  1B8I B;  1IW7 F;  3DKW A;  4E7K A;  4O3M A;  3J81 Z;  2GXA A;  4XNF A;  3L1P A;  4BQO A;  2PQ8 A;  2LRE A;  1SMT A;  3S3M A;  2BXZ A;  3HYI A;  2X4H A;  3AL0 C;  1O4X A;  2P5K A;  3WOD F;  1ETY A;  3PJR A;  4GYI A;  1WJE A;  2D1H A;  3FKJ A;  1ZAO A;  4FCY A;  4NC7 A;  2ZXJ A;  5M5Y J;  2CRG A;  3PQK A;  4KA4 A;  1ZRF A;  3DV8 A;  4LGW A;  5E1Z B;  1APL C;  2BE5 F;  3CF2 A;  1BI1 A;  2XUB A;  4BS9 A;  5D5X B;  4N4O B;  5GAD J;  1I6X A;  4HQM A;  5D6F A;  3OYE A;  4M9X A;  3E5X A;  1AKH B;  3H92 A;  2X6O A;  3CME I;  1S5L C;  1TWA J;  4IX7 A;  4A3K J;  1VQK I;  2KJB A;  3K2A A;  3DEU A;  3HSE A;  1N25 A;  1A6Q A;  1IC8 A;  2EFO A;  4CCN A;  3RCO A;  2JA8 J;  3REO A;  4L5E A;  2QCO A;  3K4C A;  2P5V A;  3ZRG A;  4S05 A;  5D4R A;  1S8N A;  2AS5 F;  4EJO A;  4ZYD A;  1J75 A;  1YOV B;  2MD5 A;  3PFI A;  1Q1H A;  4HAM A;  4LK0 F;  1K79 A;  4G9Y A;  1FC3 A;  2V1D A;  1G4D A;  4S04 A;  3DBH B;  5JFR A;  2XAH A;  2BV6 A;  2VJI A;  5H2F C;  3V8K A;  5D5U B;  1N78 A;  1JUP A;  3KP4 A;  2FOW A;  3AG3 H;  2Z3Y A;  3SHF A;  2N8G A;  2PJP A;  3S17 J;  2CV2 A;  2HVQ A;  2Y75 A;  5FGM A;  1K83 J;  1U9O A;  2LMD A;  3W3C A;  1YJW I;  1E2X A;  1P2F A;  2BGC A;  1R23 A;  1T0F C;  1FYM A;  4RAG A;  4EJU A;  3U1D A;  1ZKG A;  2KLO A;  1HSJ A;  2Z5U A;  3FXL A;  3GEZ A;  1IN6 A;  2HZT A;  1V4R A;  4PDK A;  3OYG A;  4CYD A;  5TIS C;  3G1O A;  1I3Q J;  1V55 H;  4M6X A;  3WTT C;  3K70 C;  2DFF A;  4A3L J;  1TT0 A;  2DAO A;  4DW6 A;  1MIJ A;  5GP9 A;  4LG0 B;  2RRE A;  3VSL A;  3LAP A;  3J81 R;  5CVV A;  1IV8 A;  2MYS A;  4ZTF A;  2EK5 A;  5L3F A;  2ISY A;  2QA4 I;  1TWF J;  2HQN A;  2R0Q C;  4XKC A;  2ADU A;  3HSR A;  2X1E A;  4BJ5 C;  2RC4 A;  3WE2 A;  3BTC A;  1M1E B;  1I1S A;  2EBI A;  4BE2 A;  3RKY A;  2M30 A;  2YSR A;  5EG0 B;  2VL8 A;  4ZYA A;  3WHB A;  1Z91 A;  2A5Y B;  2XHK A;  3PNY A;  4E6K G;  4FHT A;  4PUS A;  4LLG F;  3OYD A;  3HSF A;  4ENN A;  2WV1 A;  5HLG A;  1FTT A;  3IHU A;  1VQ4 I;  3LQR A;  1A04 A;  2O61 A;  3IAM 2;  4KT6 A;  2HDD A;  2I10 A;  4AYB A;  3IKV A;  3JRA A;  5IOY A;  3P9I A;  3QWL A;  1F4K A;  2H8R A;  1LB2 A;  3NWT A;  1Z05 A;  5D8L B;  2P8T A;  3CDI A;  3KCC A;  3CLO A;  1BR1 A;  2M3A A;  2XPV A;  4YEJ A;  1WPK A;  2WV0 A;  3H3Z A;  3PNV A;  2QYO A;  1UHW A;  5A2Q Z;  3FXJ A;  3RZD J;  4A69 C;  1G3Y A;  1LEA A;  2JTV A;  4IVN A;  1UST A;  1XC5 A;  4JX5 A;  4BUP A;  3OYA A;  1BJZ A;  3FXQ A;  2XAG A;  3IAS 2;  4AIK A;  3RPU D;  3HEF A;  3D5S C;  5ICC A;  3QYE A;  1BW6 A;  4HBL A;  3EUH A;  4BXX J;  3TO7 A;  3C3W A;  4XN3 A;  1HKQ A;  3TBI A;  2QQ8 A;  5C4X J;  4LD5 A;  1A31 A;  2ME6 A;  4CIC A;  1JT0 A;  1X1B A;  3K10 A;  4C30 A;  3OR2 C;  2Z9O A;  3CCR I;  1VQ8 I;  1YW8 A;  2DFH A;  2DN0 A;  1REP C;  3QQA A;  2JA5 J;  3TO9 A;  3OS2 A;  2A6H F;  4RM2 A;  1D0X A;  3N97 A;  1I5Z A;  3TMO A;  1DPU A;  2Y48 A;  4HW0 A;  2PMZ A;  3LQQ A;  1S72 I;  1S7E A;  5CKT A;  3LAJ A;  4ZH4 F;  2K40 A;  4C3I J;  3K0L A;  4IOC F;  2KDO A;  1S9H A;  2CH0 A;  5M3M J;  2OF7 A;  3AG4 H;  1EJ9 A;  1GDT A;  3BC8 A;  1TWH J;  1R1V A;  2PMH A;  1LVA A;  4XRF A;  5ERI A;  5KNL A;  3BR2 A;  4LK1 F;  2DMU A;  2FF4 A;  5FFZ A;  1BN5 A;  1B9M A;  1MBF A;  2ZNZ A;  1W7P A;  3K4L A;  2DA4 A;  5CVI A;  2HVR A;  1LDK B;  3M8E A;  4DZP A;  2LKP A;  3OYB A;  1H88 C;  4NQW B;  2IRF G;  3K9T A;  1FMW A;  3FX3 A;  1MZB A;  1QZE A;  2ZXH A;  1LUJ B;  1ODD A;  2LNB A;  3OOU A;  2PG4 A;  4JYK A;  4XRS G;  1XGM A;  2FU4 A;  1G59 A;  4BHP A;  1GVJ A;  2QZ8 A;  3CC4 I;  1MBG A;  1U9N A;  3FMQ A;  4MFD A;  5CVR A;  4L9N A;  1LNW A;  2O8K A;  1VQN I;  4BBR J;  1MMS A;  1TZL A;  2KIM A;  3M8F A;  1TW2 A;  4AID A;  2R3S A;  2LD5 A;  2IAI A;  3E5Q A;  4PSW A;  3H9J A;  4AYB N;  3DTK A;  3DWL E;  3ERE D;  1SD4 A;  2WAF A;  1VQL I;  4I76 A;  4RB3 C;  2HQ5 A;  4E4H A;  2V9P A;  5CPR B;  2R5Y B;  3F6V A;  5F6F A;  1ZTR A;  3DCF A;  2BY2 A;  1JJ8 C;  1ZRE A;  5GAH J;  2PLY A;  4A5N A;  2FD5 A;  4ZYE A;  4Y52 J;  5EZG A;  2Y9Z A;  1XMK A;  4XON A;  2H8W A;  2LY1 A;  1QU3 A;  1HOM A;  1Y0N A;  3BPX A;  1Z6T A;  3RKW A;  2ISZ A;  4N4N B;  2VKH A;  1Z21 A;  2VXZ A;  4Q5S F;  2IXS A;  4EAT A;  2LBF B;  4FET A;  1VQO I;  3WTX C;  3GCM A;  2LDU A;  2IS2 A;  2EZK A;  1JTY A;  3EUK L;  1Y6I A;  4KIC A;  3CMM A;  4XMY A;  1WJD A;  1RUN A;  1ZG5 A;  1D1A A;  1KON A;  2XRL A;  3HOX J;  4CH7 A;  1IRF A;  2R7X A;  1AA7 A;  1Z3X A;  3HB9 A;  5J8F A;  1JXS A;  4FT8 A;  2BVL A;  3E0J B;  3DEE A;  5EJC A;  1XGN A;  2BW3 B;  5DD4 A;  3GFM A;  1ZGJ A;  1MDM B;  4UY8 I;  2PMZ N;  2VKD A;  4OIP F;  3HGG A;  2B63 J;  1EV7 A;  1P4X A;  2UZK A;  2ID6 A;  1IUF A;  4XQF A;  2OTL I;  3SDG A;  4XL9 A;  5HLH A;  1QBJ A;  3ONQ A;  4G7O F;  2LF8 A;  3M07 A;  4HRI A;  1HC8 A;  1FOY A;  1RES A;  2Q1Z B;  4IHV A;  1EF4 A;  1WZ2 A;  5HOD A;  3EYY A;  3GZ6 A;  1F43 A;  1ERD A;  1SVO A;  2YS9 A;  5B5E C;  1FIA A;  1K78 B;  3I4N J;  2XAU A;  2ZME A;  4WCG A;  3W2V A;  3R0A A;  5EYR A;  1W4M A;  3DLA A;  4FE4 A;  4Y7N J;  1ZG3 A;  1E0E A;  4CYC B;  2V9V A;  2XDV A;  2XSJ C;  4X0G A;  2WTE A;  1A5J A;  1YYV A;  3IP4 B;  2LF7 A;  3GTG J;  2CU7 A;  2LYC A;  1SMY F;  2RVC A;  4IPA A;  2O3F A;  4LLL A;  1IG7 A;  4E7Z A;  1J09 A;  4PZJ A;  3CUQ B;  4OWR B;  4B1R A;  2DPU A;  3FMS A;  1D1C A;  3OWT A;  1IRX A;  2FNA A;  5HNF A;  5L3G A;  3DPT A;  2K5C A;  1R22 A;  1XSV A;  2HGC A;  2JJ7 A;  3RYR A;  3BG9 A;  2EIM H;  2V79 A;  4ESF A;  4ITV A;  4F52 A;  1ZLK A;  2R92 J;  1WQ2 A;  3HZJ A;  3IH3 A;  2LVS A;  3HHH A;  3OV8 A;  2I8D A;  3C2H A;  3Q5F A;  2JQ7 A;  3IKT A;  2PN6 A;  3MZY A;  5FRM A;  3JAM K;  3A1Y A;  2V4J C;  1LEB A;  5LEK A;  1VQ5 I;  1J0R A;  3FXK A;  3I4M J;  3HPG A;  4Z2Y A;  3KYL A;  4KIT B;  3NRV A;  1T98 A;  3JRI A;  2M34 A;  1GT0 C;  1NK3 P;  1DP3 A;  2TCT A;  1T0F A;  2E5Z A;  2NOG A;  1QRY A;  2DO7 A;  1U2W A;  4A3B J;  4RMN A;  2BHY A;  2OC6 A;  1LQ1 A;  1IV6 A;  4Y3O A;  2CJJ A;  3KEY A;  1S3J A;  3PSF A;  2ETH A;  2E2I J;  2C6Y A;  2F2E A;  5FJ8 J;  1YX3 A;  3LST A;  3G2B A;  3SQN A;  2Q2E A;  3KP2 A;  4BXU A;  2MUN A;  3HTU A;  2E36 A;  2GA2 A;  1V5F A;  2X98 A;  3MMY B;  3HOS A;  1RKW A;  4I6Z A;  2M8G X;  4ZC3 A;  2R7O A;  1YS7 A;  5LD2 C;  3I56 I;  2MAB A;  2LY9 A;  1ZEL A;  5J6X A;  2HNH A;  1P7J A;  1KU7 A;  1R58 A;  4PJJ A;  1W5C C;  2VBY A;  3BTJ A;  2HYJ A;  3LSK A;  4PFO A;  2H27 A;  5FRN A;  5LHH A;  3J81 K;  2CUZ A;  1JUM A;  1HXD A;  2BY0 A;  2ZSI B;  3HDD A;  2OU2 A;  5EDN A;  3U9G A;  4RGR A;  2Y69 H;  4R8H A;  3WU0 A;  3ABU A;  1BI0 A;  1FSE A;  5DCM B;  3UKG A;  4XKV A;  4KIF A;  4N9H A;  1IN5 A;  4P9F A;  1OJL A;  2G7H A;  3UR3 C;  1R49 A;  3FIS A;  2NAZ A;  2DT7 B;  2KIQ A;  1U0J A;  1X1D A;  1H8A C;  1CQT A;  3WE3 A;  4HX7 A;  5ICE A;  3LFK A;  5K7F A;  1OCT C;  1XB4 A;  4K2E A;  3J7A O;  5J40 A;  3ZMU A;  1NK2 P;  3ROU A;  4MEY F;  4E70 A;  3VYR B;  3QPT A;  4HG2 A;  4R1H A;  2R7F A;  5IT9 Z;  3TP0 A;  1Z6R A;  2LKX A;  3VDX A;  2AQE A;  3WG7 H;  4CUG A;  1MSE C;  1BW5 A;  3I53 A;  4LB5 A;  4M9S A;  4OU0 A;  1E3H A;  3RYP A;  1U5T B;  3K7A J;  2PX9 A;  1X19 A;  2VT2 A;  3FBI B;  4KIG A;  3SDB A;  4D7N A;  1FTZ A;  1G8X A;  4DBR A;  4M72 A;  2MH9 A;  4YG2 F;  1YW7 A;  1LFB A;  2QSF X;  3KZI C;  1YJ9 I;  2NNN A;  1PUF B;  3CO6 C;  2UV1 A;  1ZGA A;  4C3H J;  2R7V A;  3CMY A;  3S2H J;  2DK5 A;  3IUO A;  4FE7 A;  4F92 B;  2X51 A;  5DCF A;  1YQA A;  1B59 A;  4J19 A;  1TW3 A;  1KQ0 A;  1LFP A;  3ZMV A;  3GTM J;  3TP3 A;  3KP3 A;  2QBY A;  3OY9 A;  5F1J A;  2QQB A;  4E7S A;  1E17 A;  2GQQ A;  3VEP A;  1W7P D;  1PP7 U;  2IT0 A;  3DBL B;  4H0E A;  3HUG A;  3ASO H;  5BPD A;  2GXB A;  2IA0 A;  2YX7 A;  3IV5 A;  2V7F A;  3QYB A;  2M4K A;  1VFC A;  1OIS A;  1TP4 A;  1XSD A;  4XID A;  2Y30 A;  1SFX A;  4M6V A;  2DFI A;  1OCO H;  1G3W A;  2COB A;  5EEH A;  4RS8 A;  3SZP A;  5BS6 A;  1KQ8 A;  4LFU A;  3A01 A;  2MGQ A;  4BDZ A;  4ENM A;  1B72 B;  2ZB9 A;  5CQG A;  3NQO A;  2R7Q A;  4UUS B;  4UVB A;  2M9H A;  3ASN H;  1A35 A;  1GVD A;  5EGO B;  3K4B A;  1POG A;  2KMU A;  5L3B A;  1IRG A;  1I39 A;  5HNH A;  2DTR A;  2LH9 A;  3OIO A;  1OLT A;  3ZR8 X;  2Z33 A;  2O6G E;  3CJN A;  2XGX A;  4LIT A;  2NVY J;  2JRM A;  4XM3 A;  2E7W A;  4UV9 A;  4B3X A;  4OOI A;  2Z2S B;  2FA5 A;  1X3Z B;  2ESN A;  3G73 A;  3DTE A;  3E5U A;  2IGM A;  3F0C A;  1OKR A;  1DPR A;  2IGO A;  2JUG A;  1YRN B;  2CW7 A;  1R5H A;  4Q47 A;  5DV5 A;  3L2Q A;  4XR6 A;  4BQA A;  2EV0 A;  2DQL A;  5F04 A;  2DMP A;  5A2Q K;  4A3F J;  4G6Q A;  3CZ6 A;  4HZF A;  4CZC A;  1ZR2 A;  5IOZ A;  3O2P E;  4IKF A;  3QP6 A;  1FWZ A;  3BOQ A;  4CSW A;  1K4T A;  1IN4 A;  3CDH A;  1VQM I;  3W6J B;  1O3Q A;  4G12 A;  4HSR A;  1F36 A;  4Y17 A;  4HNT A;  2RDP A;  4LB6 B;  1WI9 A;  3KP7 A;  1FPQ A;  3AG2 H;  3KEQ A;  5IT3 A;  2GWR A;  3BR3 A;  3L7W A;  4M6Y A;  2O8X A;  4GCV A;  2DU9 A;  3FKI J;  2A3S A;  4E7L A;  4HNV A;  5K1Y A;  4PJM A;  2EIN H;  2A69 F;  1BR4 A;  2KL4 A;  2YPR A;  5H20 A;  3WGH A;  2HFH A;  1RNL A;  2J5O A;  2JT1 A;  2BY3 A;  4JK1 X;  4L5J A;  2UWM A;  3ABK H;  2XB0 X;  4EM0 B;  1IZ1 A;  1T95 A;  2K86 A;  1R9T J;  2CQX A;  2WB1 A;  3P5J A;  5EF6 A;  2VOO A;  5DD8 A;  3PUF A;  3QOD A;  5DM6 F;  1OCR H;  2DLL A;  2VQG A;  3X2Q H;  3ERM A;  3S8P A;  4IHS A;  1OQY A;  2FSW A;  2IS6 A;  3HL2 A;  3U21 A;  3ZP5 A;  3C2G A;  2DFE A;  4GDF A;  1O57 A;  3RQI A;  1R1T A;  3RDI A;  1Z0X A;  2DA6 A;  4XKB A;  1T6S A;  3BY6 A;  1G6N A;  4F55 A;  2ECC A;  3K4M A;  2FRH A;  2W48 A;  4DGW B;  1CF7 B;  1QZZ A;  4JBA A;  3LSP A;  2VBW A;  4UVA A;  4RBO A;  1TWC J;  3DP7 A;  4E7I A;  1GXQ A;  1TQP A;  1J5Y A;  3ZQ7 A;  4AIH A;  1MMG A;  4DYC A;  2W57 A;  1L3L A;  2WY8 Q;  5JLW A;  4XKW A;  2K9L A;  3VYU B;  1LE8 B;  2DA1 A;  4ZZL A;  5BNG A;  3BWG A;  3MWM A;  3JAM R;  2AXL A;  3OIP A;  3SJM A;  4EV0 A;  3BJO A;  3K4K A;  2R5Z A;  2EZL A;  2M1B A;  1ITY A;  4WXH A;  3V8L A;  1IDZ A;  1V54 H;  2OCE A;  1Z9C A;  2J5P A;  4Q48 A;  5H6Q A;  3KP5 A;  1ZRC A;  2DA7 A;  1AHD P;  1FP2 A;  5K7H A;  1Y1V J;  2F6C A;  2E35 A;  1UMQ A;  3ULQ B;  2CWE A;  3F72 A;  1RI7 A;  1D5Y A;  2CMP A;  3K70 D;  1MKM A;  5GAE J;  2L02 A;  2P0W A;  2M2E A;  1GUU A;  2ELJ A;  1GV2 A;  4B47 A;  3M7G A;  4PJL A;  3MFK A;  3CLQ A;  1H9G A;  1TLH B;  4DIQ A;  1XDU A;  3UNG C;  2E7X A;  2O03 A;  3P9K A;  2HS5 A;  2X9D A;  2A5W A;  4UXN A;  3TL4 X;  5J4Y A;  4IHY A;  2RN7 A;  1C0W A;  2H1L A;  2VT3 A;  2VKE A;  2KDZ A;  3J7A W;  2ZBK A;  3FXR A;  3ECH A;  2ZSH B;  1GLN A;  1HW5 A;  2GIZ A;  4WK8 F;  1FP1 D;  2LK2 A;  4KN7 X;  3GTP J;  2DMQ A;  2CFO A;  3E6D A;  3BZK A;  1FOW A;  2KT0 A;  2ZJ2 A;  2E1M B;  4QPQ A;  1EA3 A;  4KDP A;  4LMY A;  4LIU A;  3E7L A;  3R0J A;  4RAZ A;  4ZZD A;  4BBS J;  4M71 A;  1Z7L A;  3OMY A;  4BQQ A;  2R4G A;  2XKO A;  4A0Z A;  1W0T A;  3CP8 A;  2L7M P;  4M3G A;  4P5O A;  1LDJ A;  2WB1 N;  3COA C;  2VE8 A;  1JE8 A;  4X6A J;  2H09 A;  3V42 A;  2DCE A;  4U7D A;  2XVC A;  4I98 B;  3JSO A;  2PI0 A;  5C4J J;  2VJJ A;  4BJ6 C;  4MO7 A;  4RLF A;  5HLI A;  3SYT A;  2IJL A;  2JA2 A;  1SC7 A;  2E2H J;  1Y56 A;  5TRD A;  3GTL J;  2DXI A;  1OCP A;  1WFX A;  4DNC A;  3IRQ A;  1RC9 A;  1BR2 A;  2LTP A;  2OQR A;  3F8M A;  4ZJZ A;  4NDL A;  1SAU A;  1LKX A;  4XLN F;  1SFE A;  2GZW A;  3O8G A;  3K69 A;  3F23 A;  1BBY A;  1R36 A;  4G7H F;  1RUO A;  1WVR A;  4OIQ F;  1FJL A;  3B73 A;  2WWY A;  2IA2 A;  3VOD A;  5CJ9 A;  2G0E A;  5FFX A;  1ULY A;  2KP6 A;  4DZJ A;  3PL8 A;  5K5Q A;  1JJ6 C;  3HJE A;  3CF5 F;  2WAD A;  3CJQ B;  4MHG A;  4QIW N;  2P4W A;  3KLO A;  2NRA C;  3J80 Z;  2KPM A;  1Y39 A;  2V1X A;  2QQA A;  3VOE A;  5D4S A;  3S16 J;  2M4G A;  3QRF F;  4U88 A;  4PCQ A;  1P92 A;  5HS9 A;  4BAC A;  3BR5 A;  3JRB A;  4D0P A;  1T08 B;  1DUX C;  4HF1 A;  4ZTJ A;  1VF9 A;  5FKL A;  4HST A;  3DF8 A;  2KQR A;  4GYG A;  5BPI A;  3GWZ A;  3L00 A;  2EIL H;  1VQP I;  1VI0 A;  1R71 A;  3HC7 A;  3J7A Y;  3HOU J;  2JUC A;  2KZG A;  2Z16 A;  3MZH A;  3ZCO A;  5K7Z A;  2LR8 A;  3FK6 A;  3MD2 A;  3WG9 A;  2PFB A;  2GLO A;  1IF1 A;  1KZH A;  4IOA F;  3CCM I;  3JRF A;  3S15 J;  2TRT A;  9ANT A;  5AON A;  4G94 A;  2GBY A;  2L2O A;  3MKL A;  4Q4Z F;  2ELK A;  2HXO A;  4W1U A;  4AM3 A;  2D2W A;  1RKT A;  1YI2 I;  4HPQ A;  3KFW X;  3OSF A;  4PFP A;  2EFQ A;  3AG1 H;  4AUX A;  3GTJ J;  3E1S A;  3PNT A;  1PUE E;  1W36 C;  5IP6 A;  2F48 A;  4ESJ A;  3KEO A;  4OMY A;  1F1Z A;  2M7A A;  5M5W J;  1RET A;  3PSI A;  3H9Q A;  3ZPL A;  1MJB A;  4PSX A;  4RLQ A;  3D5R C;  5FD5 A;  4U0W A;  1WH5 A;  2D5V A;  3WU2 C;  2IS1 A;  1JGG A;  4XN0 A;  1B8I A;  1ETV A;  5BMZ A;  5KAI C;  3HHG A;  1J9I A;  3TOB A;  3VYT B;  2ID3 A;  3CP2 A;  1P9Q C;  1XMX A;  3L2V A;  2BOL A;  2W24 A;  3F21 A;  2L5Q A;  2XF5 A;  2KJC A;  2OUM A;  2XPU A;  3GME A;  3GZN B;  1HKS A;  1JKR C;  1YE9 A;  4IRI A;  5ILU A;  4FAS D;  3C2B A;  4ZDL A;  3PUB A;  4BXF A;  5A2Q R;  2LSO A;  4Y13 A;  5LGN A;  2ZO4 A;  2HTJ A;  3KP6 A;  4WX9 A;  2HDW A;  2WY7 Q;  1X1P A;  3BP8 A;  3LMM A;  5E3M A;  1HF0 A;  2M45 A;  3J80 R;  1LJ9 A;  2F5V A;  2K27 A;  4YFN F;  1X1A A;  2KHM A;  1AKH A;  3I59 B;  5C3E J;  4IO9 F;  4HQE A;  4A6D A;  1ZAR A;  5E20 A;  2DMT A;  3LA3 A;  3DPU A;  3O3K A;  3BLY A;  1K6Y A;  2VUM J;  3CUQ C;  3K6G A;  4RGS A;  5F27 A;  4V2F A;  3ZN1 A;  3KYC B;  3S3N A;  2E1C A;  2ME0 A;  1UHM A;  5IT9 K;  2Z1D A;  1IAW A;  3DU6 A;  4CDG A;  5ICG A;  3V4G A;  3R6S A;  4KIS A;  2XRN A;  2E1N A;  3QAH A;  3I71 A;  1TWG J;  1G3T A;  1MBE A;  1NG7 A;  2F5D A;  4JP0 A;  3HOZ J;  2RNG A;  1RQ6 A;  3LSG A;  3K4J A;  2CSO A;  4D5C A;  4V19 K;  4P96 A;  1UZC A;  1TC3 C;  2AQF A;  4L18 B;  3TOA A;  5CVU A;  3ZGK A;  1JKQ C;  3RPQ A;  1OYI A;  5FKM A;  2IPQ X;  3OL4 A;  2X1D A;  4I09 A;  2CQK A;  1EKE A;  1AWC A;  4AIJ A;  4M3F A;  4HV5 A;  2CFX A;  2BY1 A;  2KIS A;  1JGS A;  3OSG A;  3S1Q J;  2YX4 A;  2AHQ A;  4NNJ A;  1Y1W J;  1G2H A;  3KZY A;  2W1O A;  3GVA A;  3RIR A;  2QWW A;  3MCZ A;  2EA2 A;  1GV5 A;  1FBS A;  5K5O A;  5HOO A;  2DDA A;  2HXI A;  4MNU A;  2IEK A;  3ECO A;  3P7N A;  5CQE A;  5FKN A;  4LG0 A;  4IHW A;  2QBY B;  4DJA A;  2WA0 A;  2RAE A;  3TGN A;  2PEX A;  3MN2 A;  3SFZ A;  2OV7 A;  4E7J A;  3EET A;  2HKX A;  2PJR A;  1OFC X;  4EJV A;  2CV1 A;  2MLK A;  3CC2 I;  1Z77 A;  1A36 A;  2MBF A;  1OR7 C;  3PFY A;  5FLX Z;  3S1N J;  1JKP C;  1MSF C;  3BJA A;  2IGN A;  2XGE A;  2DMN A;  5D5W B;  4FX0 A;  3GYH X;  5EG0 A;  1MJ9 A;  3NAR A;  4AWX B;  1DGR M;  4N0B A;  5IPA A;  4UUT A;  1SAN A;  2HKO A;  2VAS A;  2M8E A;  3RI4 A;  1FX7 A;  1S6L A;  3GFL A;  2LKS A;  2K85 A;  2M87 A;  4P55 A;  4UV8 A;  2Y0M A;  4AC0 A;  5IY5 H;  3LA2 A;  2YR2 A;  3J7Z I;  1V5E A;  2L9N A;  5D8K B;  4EM2 A;  2UUZ A;  4NHJ A;  4HX8 A;  4IHX A;  1XTA A;  1KA8 A;  4M3B A;  5E1X A;  3KLN A;  1YS6 A;  3FMR A;  3WU1 B;  2NXN B;  2EIJ H;  1FZP B;  2P7C B;  2L9S A;  3A4C A;  4G8X A;  3Q9V A;  1IGN A;  1IXR C;  2STT A;  5FD6 A;  4YFK F;  1U5T C;  1FBQ A;  2A61 A;  3TDZ C;  4J01 A;  4QTR A;  2DT6 A;  3OYC A;  3CMA I;  4IHT A;  1L0O C;  2ECB A;  4XSX F;  2CO5 A;  2QF7 A;  4U0V A;  1SFU A;  3PIO F;  2O0Y A;  2GOM A;  4QLC U;  3ESW B;  2WAQ N;  3BR0 A;  4A3J J;  3HRM A;  4G6D A;  2VC1 A;  2W82 A;  3H36 A;  4BH9 A;  4M3E A;  4RGU A;  5DTD A;  2HWV A;  4NC8 A;  2E34 A;  1LFU P;  3ZMS A;  2HOT A;  2R7D A;  3LSH A;  1UG0 A;  1KU9 A;  5KHD A;  2MVT A;  1XGO A;  1W0U A;  3H3U A;  3C1D A;  2VOP A;  2HPM A;  1XG1 A;  3R4K A;  4J00 A;  4EGZ A;  3DXJ F;  5FLX R;  1RIO H;  3DEW A;  3E6C C;  1W1W E;  1H9T A;  4I0B A;  4PJN A;  3QU6 A;  1J7K A;  1JI8 A;  1R5I D;  5F0C A;  3HBL A;  1EH8 A;  3M1E A;  3EYI A;  3FM3 A;  4KMF A;  2JA7 J;  1XX5 A;  3BDD A;  1FNN A;  1XGS A;  4NQW A;  3T8T A;  1WJ5 A;  2JVH A;  2X48 A;  4GGG A;  4YIF A;  2STW A;  1QA6 A;  2V6C A;  1WHU A;  4XLF A;  3JW4 A;  1O3S A;  3KE2 A;  2CUE A;  2FNP A;  2HPI A;  5H6R A;  4A3D J;  2DOF A;  1TNS A;  5KAF C;  4EJT A;  1QNT A;  3ML6 A;  6PAX A;  4A93 J;  1EH6 A;  2MFZ A;  2B7E A;  4RA2 A;  2ZJR F;  3K2Z A;  3HOY J;  2L7K A;  4M3D A;  2LC2 A;  2R5Y A;  4LIV A;  2KIU A;  5DUK A;  1UHS A;  1N77 A;  3BQY A;  1X58 A;  4FIS A;  4MTE A;  3HGY A;  4WWC A;  2K02 A;  3U2R A;  3A52 A;  3RSN A;  1DGW Y;  3AKZ A;  3L2W A;  5GPC A;  2QEN A;  4DYQ A;  5D6E A;  2EIK H;  2ESH A;  1DU6 A;  3K1M A;  2LBF A;  1JHF A;  2XAQ A;  2V6E A;  3GFJ A;  1KQ9 A;  5F64 A;  2K9Q A;  4ZYG A;  1VQ7 I;  4E7H A;  3W6K B;  1BI3 A;  4F3Q A;  2LOO A;  1P7I A;  1BA5 A;  2M7B A;  2G7U A;  4O5V A;  3BTL A;  3Q0V A;  3V8J A;  4EGY A;  3V7R A;  4HV6 A;  4BU2 A;  4MIM A;  3ZQL A;  4B8X A;  3C18 A;  3OIQ A;  2BW3 A;  3VPR A;  2Q8K A;  1FLI A;  2XV4 S;  2K4J A;  2I5U A;  1MDM A;  3Q9S A;  4WXD A;  3BZC A;  1YW9 A;  1QQI A;  2E19 A;  2KIF A;  3TW7 A;  4RB0 A;  4EJW A;  3WTZ A;  3S14 J;  1STZ A;  4RAF A;  1F5T A;  1MJA A;  3KYD B;  1R00 A;  3BQZ A;  4EEF G;  2PMU A;  1U8R A;  1PJR A;  1YIT I;  3OL3 A;  1D0Y A;  2DW4 A;  2P81 A;  3BTI A;  2ZKZ A;  3FHN A;  5CLS A;  2P0T A;  2FBI A;  3GTQ J;  2OD5 A;  4CZZ A;  1P4W A;  1K78 A;  4I2O A;  2X6X A;  2HI3 A;  2WBM A;  1MH3 A;  4UB6 C;  5CYV A;  1R4N B;  2Y9Y A;  5BQT A;  3I54 A;  4U0Y A;  4LLN A;  2XKP A;  3BRO A;  1TT5 B;  5LHG A;  2E2J J;  5IT9 R;  2ZXW H;  1JHH A;  4AVZ A;  2OAZ A;  1XCB A;  2KZV A;  2NVT J;  3KIO A;  4HA8 A;  1ACI A;  3WTV C;  4QPO A;  4XK4 A;  1JKO C;  3BG3 A;  2RKH A;  3V7C A;  1R1U A;  1YG2 A;  2EZI A;  3NAU A;  4AVP A;  3CCL I;  1O3T A;  2COM A;  2ICW G;  3KZZ A;  4HNU A;  4OAY A;  1V3F A;  2P6S A;  3FZV A;  3M1C A;  4IRG A;  3U1K A;  4F93 B;  2F5F A;  5JR3 A;  4ENJ A;  5J3L A;  5IP7 J;  1VZ0 A;  4O6J A;  1TL8 A;  3J80 K;  3G71 I;  3CCE I;  2XAF A;  3EQL F;  5E3O A;  1U8B A;  4CCM A;  5LGT A;  1P6R A;  1YO5 C;  2OZ6 A;  1IRZ A;  1BL0 A;  1O7L A;  5J8C A;  5GTI C;  1XMA A;  2DYR H;  2ZJP F;  4L9V A;  2HZD A;  3SZG A;  2CW0 F;  2RGV A;  4Y4R A;  2MA3 A;  4L5I A;  1WRJ A;  3M3Y J;  2VI6 A;  3HRT A;  2XF6 A;  5F0F A;  3CCU I;  2JZY A;  2QSG X;  1JT6 A;  2FOK A;  3H5A A;  1TQM A;  4FX4 A;  4LG3 A;  4ESB A;  2XIG A;  1OPC A;  4BY7 J;  1ETQ A;  1BI2 A;  3RKQ A;  2B9S A;  4KT5 C;  2IGK A;  3FBN B;  4BYY A;  4OIN F;  1FT9 A;  4IRH A;  2ELH A;  5AIP A;  2K4B A;  4KYW A;  1HCR A;  1I6H J;  1UFM A;  2XPW A;  3RKX A;  1K61 A;  1Q1V A;  5FKK A;  2E1M C;  1QVT A;  3F3X A;  5FO5 A;  3TKY A;  4X1E A;  1K4S A;  2RQP A;  4BE0 A;  1U78 A;  4XLC A;  1WKM A;  3ZN0 A;  1JUS A;  2VPL A;  2QUF A;  4UB8 C;  4WF2 A;  4F91 B;  1P4A A;  1XS9 A;  2IVM A;  2GM4 A;  2KRF A;  1X2M A;  2F4O B;  1NH3 A;  3K1N A;  5FRO A;  1FOX A;  5KVR A;  3A2K A;  1X3U A;  2MC4 A;  3LFU A;  4G6T B;  2OJE D;  1RZ4 A;  1ZH5 A;  2IP2 A;  4OIR F;  5HS7 A;  1W7P B;  3FIW A;  4XOR A;  4HX4 A;  3S1R J;  2FBH A;  2AXT C;  4JQF A;  5DCM A;  2KFD A;  3CCS I;  1YIO A;  4A0X A;  3N05 A;  1LPQ A;  4YEL A;  1ON1 A;  3VB2 A;  1GXP A;  1WJC A;  4YII A;  1K7A A;  2BVM A;  2DTZ A;  3LSJ A;  3RJP A;  1TTY A;  3GF2 A;  2ZME C;  2QVO A;  3GX4 X;  3ABT A;  2VLA A;  2M5W A;  1ZYR F;  3R61 A;  1QZY A;  1DP7 P;  4A3E J;  5DM7 F;  2RQQ A;  1YFH A;  3LWF A;  2FQ4 A;  1ORK A;  4R79 A;  4UUV A;  3BR6 A;  1JTX A;  2MH2 A;  4ENK A;  5L3E A;  1CGP A;  1U5T A;  4BHC A;  1V5G A;  1ZGW A;  1MBJ A;  1U6G A;  3HRU A;  2R7Z J;  3I0T A;  3MQ0 A;  2ZXI A;  1MW7 A;  2E71 A;  5LLQ A;  2X0L A;  4IXA A;  4A5M A;  3JR9 A;  1PUF A;  4P9U A;  4DYR A;  2DBB A;  2WC2 A;  4RB1 A;  3JRH A;  4P1W A;  3FHZ A;  2X6Y A;  4HF0 A;  2EFP A;  2OCC H;  5KK1 A;  2YUS A;  2ZFW A;  4ZDO A;  4XLH A;  4HLY A;  2B0L A;  3FXM A;  2EH3 A;  3QPH A;  3EPZ A;  2P5L C;  1KU3 A;  1HA8 A;  2HYG D;  4YRV A;  1OMI A;  4OMZ A;  3I5U A;  2CV0 A;  4H4K C;  2K3F A;  3OYK A;  2OBP A;  3JTG A;  4UVC A;  1R4M B;  3OYH A;  1MNM C;  3JRC A;  2L4M A;  3PO3 J;  1R5G A;  5F08 A;  2DA2 A;  2VKV A;  2D1V A;  3L2U A;  3ABM H;  1NTC A;  2MLG A;  3ZMD A;  2GAU A;  2CQQ A;  2MW8 A;  4YFX F;  1VQ6 I;  2FQ3 A;  3DKX A;  1T39 A;  3QPL A;  2Y31 A;  1T33 A;  1SD5 A;  1IO2 A;  2L01 A;  4CGZ A;  2JPB A;  3FM5 A;  4MGR A;  5E18 F;  2AO9 A;  1S7A A;  1S29 A;  4UHT A;  2D45 A;  2IS4 A;  2H1K A;  2V26 A;  1HQC A;  1SFO J;  5HVQ C;  4PGH A;  3IH2 A;  3IRR A;  1ZN2 A;  5JLX A;  1B72 A;  1TBX A;  5D5V B;  4I01 A;  1SVL A;  3LA7 A;  2PJR B;  1WJA A;  5FLX K;  3AL0 B;  2Y0S A;  4UUS A;  4KFC A;  3CDL A;  2GIV A;  3O6B B;  3HOW J;  5EGO A;  4BEH A;  2K3P A;  3ZQG A;  2ZME B;  3OYN A;  3E6M A;  1KGS A;  4HEA 2;  4B48 A;  3D1N I;  3OYF A;  1PP8 F;  2EZH A;  5LFA A;  2VQL A;  2R7U A;  3FXU A;  2A6T A;  4XOP A;  3GLX A;  5E79 C;  2E60 A;  1B9N A;  2VPR A;  1QVU A;  2OZU A;  4IQJ A;  2IA1 A;  2DPD A;  4HYE A;  5JHU A;  3R60 A;  4PJ0 C;  2YU3 A;  3ZMZ A;  1YRN A;  2QLZ A;  3DKY A;  3C7J A;  3HOV J;  1HDP A;  5EEA A;  5EEG A;  2DK8 A;  4EVI A;  2HU9 A;  4NBQ A;  3WTY C;  2FEZ A;  2EV6 A;  2V9K A;  2HQA A;  3WTS C;  4XOT A;  5TJJ A;  2FX0 A;  3I9V 2;  2HYF A;  2FML A;  2R93 J;  3CD6 I;  1MNE A;  4A3I J;  2FE3 A;  4RDU A;  3S3O A;  1HDD C;  1ZRD A;  1ON2 A;  2L0K A;  2MSY A;  4IL6 C;  2WAE A;  1W36 D;  2MC3 A;  3HIF A;  2W85 A;  4KMU X;  3I55 I;  3CCJ I;  5TGT A;  3LSR A;  1A6I A;  2EA4 A;  4N9I A;  4I99 C;  3E3V A;  3WHC A;  3CCV I;  3D0S A;  3BG5 A;  5JHF A;  1YIJ I;  3WTU C;  3A03 A;  4BY1 J;  4HOB A;  5B1B H;  4YIR X;  4FTH A;  1U3E M;  4RB2 C;  3B6A A;  1K6O A;  3M4O J;  1I1G A;  1BC8 C;  2BBY A;  2W00 A;  3CQZ J;  2P7V B;  1N75 A;  4D7M A;  1XCV A;  3H5N A;  5B66 C;  4CCL A;  2ZJQ F;  5J1R A;  1Z7U A;  1RRJ A;  2HQR A;  2QQ9 A;  2BHZ A;  1ETK A;  1B6A A;  2Q2E B;  3H0D A;  1LVK A;  3Q3S A;  4JX4 A;  2NVQ J;  2P6T A;  3PQJ A;  1YHQ I;  1KYZ A;  2OQG A;  4IZZ A;  1IN7 A;  1IXS B;  4XSZ F;  3A0B C;  1UJ8 A;  1T56 A;  1OYY A;  4M9Z A;  4XLE A;  1PDN C;  2W4S A;  1T8I A;  2LY2 A;  3CJR B;  3A02 A;  1YX5 A;  2XAS A;  4IJA A;  3W2W A;  3FDY A;  3M9A A;  1I50 J;  3BG7 A;  3PM1 A;  2GA1 A;  3HKZ A;  1MMD A;  1ETW A;  3I3L A;  1CF7 A;  4KJZ A;  4GRI A;  3F8B A;  4NB5 A;  2L4A A;  5M3F J;  1MBH A;  2QGU A;  1QHH D;  3I64 A;  1HKT A;  1UB9 A;  2X1C A;  5GTH C;  3JTH A;  4BJT A;  4DBQ A;  3ELK A;  4MLO A;  1X1C A;  2K9S A;  2Y0S N;  4IQ4 A;  3GUD A;  1WSU A;  3ZQQ A;  5LEJ A;  3DBR B;  1YLF A;  5GAG J;  1LE8 A;  3I4P A;  3MVP A;  1HST A;  3CES A;  3O8H A;  4RAY A;  4RM3 A;  2JSP A;  4CO8 A;  4S0H B;  2MG4 A;  1D8J A;  3H35 A;  3Q0U A;  1E3O C;  2H94 A;  1IN8 A;  2EFW A;  2O7O A;  3T1B A;  2UXN A;  2Q0O A;  4RGX A;  5J1Y A;  3NWS A;  5E8G A;  1PYV A;  4DQ2 A;  1O7F A;  2X6W A;  4A6E A;  4AU7 A;  3EDP A;  1VND A;  2WAQ A;  2A07 F;  2F4I A;  2TDX A;  3DTI A;  3L09 A;  3SZT A;  4B44 A;  2ACJ A;  1OYW A;  4XIC A;  1DDN A;  1B1B A;  2F5E A;  2VON A;  2VIX A;  2ZC2 A;  3DQV C;  5FKO A;  5FLV A;  1Z67 A;  4TV7 A;  4A0Y A;  3GBG A;  3QYF A;  3QOP A;  2XF7 A;  1IXC A;  2GXG A;  2OTJ I;  2W84 A;  3GTO J;  3ZQH A;  4XRM A;  2CGP A;  2Z99 A;  1WJB A;  2BXY A;  5IYC J;  4QSH A;  3P9C A;  2CW8 A;  4BQN A;  2NVU B;  3BJ6 A;  3W2A A;  3IWF A;  3MAJ A;  2JWT A;  2VQC A;  3DFG A;  1F9N A;  4F7Z A;  3GTK J;  1WI3 A;  1X3W B;  2EPF A;  4BGD A;  3H9G A;  3KPH A;  1SFK A;  3IWZ A;  4B43 A;  1I27 A;  3M8J A;  1Y0U A;  1ZK8 A;  5B1A H;  2W7N A;  3SXY A;  1SD7 A;  2IBD A;  1ZG1 A;  1QPI A;  4BKX A;  3WGG A;  3W6V A;  4II3 A;  4W97 A;  5E17 F;  2FBK A;  5IYB J;  1YJN I;  3DPL C;  1WH7 A;  4BDY A;  3B6C A;  2GOX B;  3F8C A;  3RTR A;  5BOX A;  1BJA A;  2JRT A;  5LBQ A;  4C2M J;  4XBF A;  2VN2 A;  3HUG B;  4ETS A;  2KRH A;  1QGP A;  3ZXS A;  5E3L A; 
#chains in the Genus database with same CATH homology
 3MEX A;  1Z1D A;  1EH7 A;  2VOD A;  1HBX G;  1W5T A;  1S7O A;  4CHU A;  1KU2 A;  3WTW C;  1KYW A;  2DQR A;  3HRS A;  3OOP A;  2HOE A;  3D5L A;  2A68 F;  4GO1 A;  3IL2 A;  1UCR A;  1BC7 C;  3GO5 A;  1MD0 A;  3K1P A;  2NYX A;  3E6B A;  1WWX A;  2F5C A;  1BIB A;  1GHC A;  5DDG A;  4EM1 A;  3NEU A;  4L9T A;  3BPV A;  1O3R A;  2VBX A;  4UNO A;  2EB7 A;  5LRR A;  4I02 A;  4MQ9 F;  4M73 A;  5ILS A;  4QWQ A;  2FMY A;  1J59 A;  1NHA A;  5HDG A;  3GZ5 A;  3TO6 A;  4MEX F;  2K7L A;  1FBU A;  2IW5 A;  2NS0 A;  3B02 A;  5LHI A;  3F8N A;  5E1W A;  2V1U A;  4BNC A;  3QP5 A;  4WXC A;  4HDV A;  1ONV A;  2NNY A;  1T38 A;  3GXO A;  2DT5 A;  4A12 A;  2XRO A;  2FXA A;  2HEO A;  1QO0 D;  1HW1 A;  3T8R A;  3IC7 A;  4MTD A;  4G7Z F;  5L3C A;  1W5S A;  4HLX A;  4Y15 A;  5DUI A;  3I59 A;  5ICF A;  1SD6 A;  4L0Z B;  2L3D A;  3L2C A;  2ZCW A;  4KN4 X;  4KNY A;  3V7S A;  5FB2 A;  2ZNY A;  1D8K A;  2HDC A;  3KET A;  5L3D A;  4PGG A;  3FWE A;  3F22 A;  3T5X A;  1USS A;  1ZLJ A;  2EWN A;  4AD9 A;  1R7J A;  5CVJ A;  5HDK A;  5E8I A;  3ISP A;  5HS8 A;  2H6B A;  5JI6 A;  4M74 A;  5DEQ A;  1QPM A;  3S2W A;  4EMS A;  3RPU A;  3WGI A;  3VFZ A;  3F6O A;  2CYY A;  1YTY A;  5K5R A;  2KKO A;  1HW2 A;  5AIQ A;  4A2U A;  2G9W A;  4EQQ A;  2BYV E;  1BIA A;  1TQI A;  1T2K A;  4U7B A;  4OIO F;  1XN7 A;  3ZMT A;  3CO7 C;  3N4M A;  2JPC A;  2EFN A;  2CG4 A;  3HTS B;  2EJR A;  2L54 A;  4HF2 A;  4KIB A;  4HDU A;  2W25 A;  1LDD A;  3E97 A;  3HOT A;  3T0Y A;  1XDS A;  1FSH A;  4ON0 A;  5LRS A;  5LGU A;  2UXX A;  2DI3 A;  3CUQ A;  4IF4 A;  1B4A A;  5F1R A;  4XLP F;  4KUM A;  4BHB A;  5JVT A;  3I58 A;  3CTA A;  1H0M A;  4MQV A;  1FYK A;  1G3S A;  1D5V A;  1SAX A;  1AOY A;  1TNT A;  2VBZ A;  1IUY A;  3G3Z A;  1XSX A;  1ZHF A;  2BEO A;  2QM3 A;  1BM9 A;  2RV8 A;  3FF5 A;  2HTS A;  2PBI A;  4I7H A;  3JAM Z;  3TDU C;  1BOA A;  4ZYH A;  3CUO A;  3F8F A;  2RNJ A;  3TQN A;  4ASN A;  5ILV A;  1FYL A;  1FOK A;  2A6E F;  4L0Y B;  4I0A A;  3GFI A;  3AAF A;  2H6C A;  2HR3 A;  1VTN C;  5DYM A;  1XD7 A;  2JSC A;  2OA4 A;  4B09 A;  3QU3 A;  1J2X A;  5HDN A;  5ED4 A;  1MGT A;  1FY7 A;  1D3Y A;  3BZ6 A;  4GXO A;  1OR7 A;  2EV5 A;  3JSP A;  2VE9 A;  2VC0 A;  3GW2 A;  2XAJ A;  4LJZ F;  4BAY A;  3L9F A;  4L9J A;  4CXF A;  1IW7 F;  3DKW A;  4O3M A;  3J81 Z;  2PQ8 A;  1SMT A;  3HYI A;  2X4H A;  2P5K A;  3WOD F;  4GYI A;  2D1H A;  1ZAO A;  2ZXJ A;  3PQK A;  4KA4 A;  1ZRF A;  3DV8 A;  4LGW A;  5E1Z B;  2BE5 F;  1BI1 A;  2XUB A;  5D5X B;  1I6X A;  4HQM A;  5D6F A;  4M9X A;  3E5X A;  3H92 A;  2KJB A;  3DEU A;  3HSE A;  2EFO A;  3REO A;  5D4R A;  4S05 A;  2P5V A;  1S8N A;  2AS5 F;  4EJO A;  4ZYD A;  1J75 A;  2MD5 A;  3PFI A;  4LK0 F;  1Q1H A;  4HAM A;  1K79 A;  4G9Y A;  1FC3 A;  2V1D A;  1G4D A;  4S04 A;  5JFR A;  2XAH A;  2BV6 A;  5D5U B;  3V8K A;  3KP4 A;  2Z3Y A;  3SHF A;  2PJP A;  2Y75 A;  5FGM A;  1E2X A;  1P2F A;  2BGC A;  1R23 A;  1FYM A;  4EJU A;  3U1D A;  1HSJ A;  2Z5U A;  3GEZ A;  1IN6 A;  2HZT A;  1V4R A;  4PDK A;  4CYD A;  4M6X A;  3WTT C;  2DAO A;  4LG0 B;  3LAP A;  5CVV A;  2EK5 A;  5L3F A;  2ISY A;  2HQN A;  2ADU A;  3HSR A;  2RC4 A;  3WE2 A;  1I1S A;  3RKY A;  2M30 A;  2YSR A;  1Z91 A;  2A5Y B;  2XHK A;  4FHT A;  4LLG F;  3HSF A;  4ENN A;  5HLG A;  3IHU A;  3LQR A;  1A04 A;  2O61 A;  3IKV A;  1F4K A;  3P9I A;  1LB2 A;  5D8L B;  1Z05 A;  2P8T A;  3KCC A;  3CLO A;  2WV0 A;  3H3Z A;  2QYO A;  1UHW A;  5A2Q Z;  1G3Y A;  1LEA A;  4IVN A;  2JTV A;  1UST A;  3FXQ A;  2XAG A;  4AIK A;  5ICC A;  4HBL A;  3EUH A;  3TO7 A;  3C3W A;  1HKQ A;  4LD5 A;  4CIC A;  2Z9O A;  1YW8 A;  1REP C;  3TO9 A;  2A6H F;  3N97 A;  1I5Z A;  1DPU A;  2Y48 A;  4HW0 A;  3LQQ A;  3LAJ A;  4ZH4 F;  3K0L A;  1R1V A;  2PMH A;  1LVA A;  4XRF A;  5ERI A;  4LK1 F;  2FF4 A;  5FFZ A;  1BN5 A;  1B9M A;  2ZNZ A;  1W7P A;  5CVI A;  1LDK B;  3M8E A;  2LKP A;  2IRF G;  3K9T A;  3FX3 A;  1MZB A;  2LNB A;  1ODD A;  2PG4 A;  1XGM A;  2FU4 A;  4BHP A;  1GVJ A;  2QZ8 A;  3FMQ A;  5CVR A;  4L9N A;  1LNW A;  2KIM A;  3M8F A;  1TW2 A;  2R3S A;  3E5Q A;  3ERE D;  1SD4 A;  4RB3 C;  3F6V A;  5F6F A;  1ZRE A;  2PLY A;  4A5N A;  4ZYE A;  1XMK A;  3BPX A;  1Z6T A;  3RKW A;  2ISZ A;  2VXZ A;  4Q5S F;  3WTX C;  2LDU A;  4KIC A;  1RUN A;  1ZG5 A;  1IRF A;  5J8F A;  1JXS A;  4FT8 A;  1XGN A;  5DD4 A;  3GFM A;  1ZGJ A;  1MDM B;  4OIP F;  1EV7 A;  1P4X A;  2UZK A;  5HLH A;  1QBJ A;  4G7O F;  2LF8 A;  3EYY A;  3GZ6 A;  1K78 B;  2ZME A;  4WCG A;  3R0A A;  1W4M A;  1ZG3 A;  2V9V A;  2WTE A;  1YYV A;  2LF7 A;  2RVC A;  1SMY F;  4IPA A;  4LLL A;  2O3F A;  4PZJ A;  3CUQ B;  2DPU A;  3FMS A;  2FNA A;  5L3G A;  3DPT A;  1R22 A;  1XSV A;  2HGC A;  3RYR A;  4ESF A;  2V79 A;  1ZLK A;  1WQ2 A;  3HHH A;  3OV8 A;  3Q5F A;  3IKT A;  2PN6 A;  3MZY A;  3JAM K;  1LEB A;  5LEK A;  1J0R A;  4Z2Y A;  3NRV A;  1T98 A;  1T0F A;  2DO7 A;  1U2W A;  1LQ1 A;  1S3J A;  2ETH A;  2C6Y A;  2F2E A;  3LST A;  3SQN A;  2Q2E A;  3KP2 A;  4BXU A;  3HTU A;  2GA2 A;  3HOS A;  1YS7 A;  5J6X A;  1KU7 A;  1R58 A;  2VBY A;  2H27 A;  5LHH A;  3J81 K;  1HXD A;  2OU2 A;  3U9G A;  4RGR A;  4R8H A;  3WU0 A;  3ABU A;  1BI0 A;  1FSE A;  5DCM B;  4KIF A;  4N9H A;  1IN5 A;  4P9F A;  2G7H A;  2NAZ A;  3WE3 A;  4HX7 A;  5ICE A;  3LFK A;  1XB4 A;  4K2E A;  3J7A O;  3ZMU A;  3ROU A;  4MEY F;  4E70 A;  3QPT A;  4R1H A;  2R7F A;  5IT9 Z;  1Z6R A;  3I53 A;  4M9S A;  4OU0 A;  3RYP A;  1U5T B;  2VT2 A;  4KIG A;  4M72 A;  2MH9 A;  4YG2 F;  1YW7 A;  2NNN A;  3CO6 C;  1ZGA A;  2DK5 A;  5DCF A;  1YQA A;  1B59 A;  1TW3 A;  1KQ0 A;  3ZMV A;  3KP3 A;  2QBY A;  2QQB A;  1E17 A;  2GQQ A;  3VEP A;  1W7P D;  1PP7 U;  2IT0 A;  4H0E A;  3HUG A;  5BPD A;  2GXB A;  2IA0 A;  2YX7 A;  1XSD A;  1SFX A;  2DFI A;  1G3W A;  5EEH A;  3SZP A;  4RS8 A;  5BS6 A;  1KQ8 A;  4LFU A;  4ENM A;  3NQO A;  4UVB A;  5L3B A;  1IRG A;  2DTR A;  2Z33 A;  2O6G E;  3CJN A;  2XGX A;  2E7W A;  4UV9 A;  4OOI A;  2FA5 A;  2ESN A;  3G73 A;  3E5U A;  1OKR A;  1DPR A;  1R5H A;  4Q47 A;  5DV5 A;  4BQA A;  2EV0 A;  2DQL A;  5A2Q K;  4G6Q A;  4HZF A;  3O2P E;  3QP6 A;  1FWZ A;  3BOQ A;  1IN4 A;  3CDH A;  1O3Q A;  3W6J B;  4Y17 A;  2RDP A;  4LB6 B;  1WI9 A;  3KP7 A;  1FPQ A;  3KEQ A;  5IT3 A;  2GWR A;  3L7W A;  4M6Y A;  2O8X A;  4GCV A;  2DU9 A;  2A3S A;  5K1Y A;  2A69 F;  2YPR A;  5H20 A;  3WGH A;  2HFH A;  1RNL A;  2J5O A;  2JT1 A;  4JK1 X;  4L5J A;  2UWM A;  4EM0 B;  1IZ1 A;  2K86 A;  2VOO A;  5DD8 A;  2DLL A;  4IHS A;  2FSW A;  3ZP5 A;  1O57 A;  1R1T A;  3RDI A;  1T6S A;  3BY6 A;  1G6N A;  2FRH A;  1CF7 B;  1QZZ A;  4JBA A;  2VBW A;  4UVA A;  3DP7 A;  1GXQ A;  1TQP A;  1J5Y A;  3ZQ7 A;  4AIH A;  2W57 A;  1L3L A;  4ZZL A;  3BWG A;  3MWM A;  2AXL A;  4EV0 A;  3BJO A;  2M1B A;  4WXH A;  3V8L A;  1Z9C A;  2J5P A;  4Q48 A;  5H6Q A;  3KP5 A;  1ZRC A;  1FP2 A;  3ULQ B;  2CWE A;  3F72 A;  1RI7 A;  1MKM A;  2L02 A;  3M7G A;  3MFK A;  1H9G A;  1TLH B;  1XDU A;  2E7X A;  2O03 A;  3P9K A;  2HS5 A;  4UXN A;  2RN7 A;  1C0W A;  2VT3 A;  2ZBK A;  3FXR A;  3ECH A;  1HW5 A;  4WK8 F;  1FP1 D;  4KN7 X;  3E6D A;  2ZJ2 A;  4KDP A;  4LMY A;  3R0J A;  4ZZD A;  4RAZ A;  4M71 A;  2XKO A;  4A0Z A;  4P5O A;  1LDJ A;  3COA C;  2VE8 A;  1JE8 A;  2H09 A;  4U7D A;  2XVC A;  4I98 B;  3JSO A;  2PI0 A;  5HLI A;  2IJL A;  5TRD A;  4DNC A;  3IRQ A;  2OQR A;  3F8M A;  4XLN F;  1SFE A;  2GZW A;  3K69 A;  3F23 A;  1BBY A;  1R36 A;  4G7H F;  1RUO A;  4OIQ F;  3B73 A;  2WWY A;  2IA2 A;  3VOD A;  5CJ9 A;  5FFX A;  1ULY A;  5K5Q A;  4MHG A;  2P4W A;  3KLO A;  2NRA C;  3J80 Z;  2V1X A;  2QQA A;  3VOE A;  5D4S A;  3QRF F;  4U88 A;  4PCQ A;  1P92 A;  5HS9 A;  4D0P A;  1DUX C;  4HF1 A;  5BPI A;  3DF8 A;  4GYG A;  3GWZ A;  3L00 A;  3MZH A;  3WG9 A;  2PFB A;  1IF1 A;  5AON A;  4G94 A;  4Q4Z F;  2D2W A;  3KFW X;  2EFQ A;  1PUE E;  4ESJ A;  3KEO A;  4OMY A;  1F1Z A;  3ZPL A;  1MJB A;  5FD5 A;  4U0W A;  5BMZ A;  3HHG A;  1J9I A;  3TOB A;  2W24 A;  3F21 A;  2KJC A;  1HKS A;  4IRI A;  5ILU A;  2LSO A;  4Y13 A;  5LGN A;  2ZO4 A;  2HTJ A;  3KP6 A;  4WX9 A;  3BP8 A;  2M45 A;  1LJ9 A;  2K27 A;  4YFN F;  3I59 B;  4HQE A;  4A6D A;  1ZAR A;  5E20 A;  3LA3 A;  3O3K A;  3CUQ C;  4RGS A;  3ZN1 A;  2E1C A;  1UHM A;  5IT9 K;  1IAW A;  4CDG A;  5ICG A;  3V4G A;  3R6S A;  2XRN A;  2E1N A;  3QAH A;  3I71 A;  1G3T A;  2F5D A;  2CSO A;  4P96 A;  4L18 B;  3TOA A;  5CVU A;  3RPQ A;  1OYI A;  2IPQ X;  4I09 A;  2CQK A;  1AWC A;  4AIJ A;  4HV5 A;  2CFX A;  1JGS A;  2YX4 A;  3KZY A;  3GVA A;  3RIR A;  2QWW A;  3MCZ A;  2EA2 A;  1FBS A;  5K5O A;  5HOO A;  4MNU A;  3ECO A;  3P7N A;  4LG0 A;  2QBY B;  3TGN A;  2PEX A;  3SFZ A;  3EET A;  2HKX A;  4EJV A;  2MLK A;  2MBF A;  5FLX Z;  3BJA A;  5D5W B;  4FX0 A;  3GYH X;  1MJ9 A;  4AWX B;  4N0B A;  2HKO A;  3RI4 A;  2M8E A;  1FX7 A;  1S6L A;  3GFL A;  4P55 A;  2M87 A;  4UV8 A;  4LB5 A;  2Y0M A;  3LA2 A;  2YR2 A;  5D8K B;  4EM2 A;  4NHJ A;  4HX8 A;  1KA8 A;  5E1X A;  3KLN A;  1YS6 A;  3FMR A;  3WU1 B;  1FZP B;  2P7C B;  4G8X A;  3Q9V A;  1IXR C;  2STT A;  5FD6 A;  4YFK F;  1U5T C;  1FBQ A;  2A61 A;  3TDZ C;  4IHT A;  1L0O C;  4XSX F;  2CO5 A;  4U0V A;  1SFU A;  2O0Y A;  4QLC U;  3HRM A;  4G6D A;  2VC1 A;  4BH9 A;  4RGU A;  2HWV A;  3ZMS A;  2R7D A;  1KU9 A;  1XGO A;  3H3U A;  3C1D A;  2VOP A;  3R4K A;  4EGZ A;  3DXJ F;  1RIO H;  3E6C C;  1H9T A;  4I0B A;  3QU6 A;  1J7K A;  1EH8 A;  3M1E A;  3EYI A;  3FM3 A;  4KMF A;  3BDD A;  1FNN A;  1XGS A;  4NQW A;  3T8T A;  4GGG A;  4YIF A;  2STW A;  2V6C A;  3JW4 A;  1O3S A;  3KE2 A;  2FNP A;  5H6R A;  1TNS A;  4EJT A;  1QNT A;  3ML6 A;  6PAX A;  1EH6 A;  3K2Z A;  2KIU A;  5DUK A;  4MTE A;  4WWC A;  2K02 A;  3U2R A;  2QEN A;  5D6E A;  2ESH A;  3K1M A;  1JHF A;  2XAQ A;  3GFJ A;  1KQ9 A;  5F64 A;  4ZYG A;  3W6K B;  1BI3 A;  2G7U A;  4O5V A;  3V8J A;  4EGY A;  3V7R A;  4HV6 A;  4B8X A;  3C18 A;  1FLI A;  2Q8K A;  2XV4 S;  2K4J A;  1MDM A;  3Q9S A;  4WXD A;  1YW9 A;  1QQI A;  2KIF A;  4RB0 A;  4EJW A;  3WTZ A;  1STZ A;  1F5T A;  1MJA A;  1R00 A;  1U8R A;  2PMU A;  2DW4 A;  2ZKZ A;  5CLS A;  2FBI A;  2OD5 A;  4CZZ A;  1P4W A;  1K78 A;  4I2O A;  5CYV A;  5BQT A;  3I54 A;  4U0Y A;  4LLN A;  2XKP A;  3BRO A;  5LHG A;  1JHH A;  2OAZ A;  1XCB A;  4HA8 A;  3WTV C;  3V7C A;  2RKH A;  1R1U A;  1YG2 A;  4AVP A;  1O3T A;  2COM A;  3KZZ A;  1V3F A;  2P6S A;  3FZV A;  4IRG A;  2F5F A;  5JR3 A;  4ENJ A;  4O6J A;  3J80 K;  2XAF A;  3EQL F;  1YO5 C;  5LGT A;  1P6R A;  2OZ6 A;  1O7L A;  5J8C A;  1XMA A;  4L9V A;  2CW0 F;  2RGV A;  2MA3 A;  4L5I A;  1WRJ A;  3HRT A;  2JZY A;  2FOK A;  1TQM A;  4FX4 A;  4ESB A;  2XIG A;  1OPC A;  1BI2 A;  4KT5 C;  4BYY A;  4OIN F;  1FT9 A;  4IRH A;  2ELH A;  5AIP A;  2K4B A;  4KYW A;  1UFM A;  3RKX A;  5FO5 A;  3F3X A;  3TKY A;  2RQP A;  1U78 A;  1WKM A;  3ZN0 A;  2QUF A;  4WF2 A;  1P4A A;  2IVM A;  2KRF A;  3K1N A;  5KVR A;  1X3U A;  1RZ4 A;  1ZH5 A;  2IP2 A;  4OIR F;  5HS7 A;  1W7P B;  4HX4 A;  2FBH A;  4JQF A;  5DCM A;  1YIO A;  4A0X A;  1ON1 A;  3VB2 A;  1GXP A;  4YII A;  1K7A A;  3RJP A;  1TTY A;  3GF2 A;  2QVO A;  3GX4 X;  3ABT A;  2M5W A;  1ZYR F;  3R61 A;  1QZY A;  1DP7 P;  1YFH A;  3LWF A;  4R79 A;  4UUV A;  2MH2 A;  4ENK A;  1CGP A;  5L3E A;  1U5T A;  4BHC A;  1U6G A;  3HRU A;  3I0T A;  3MQ0 A;  5LLQ A;  2X0L A;  4IXA A;  4A5M A;  4P9U A;  2DBB A;  2WC2 A;  4RB1 A;  3FHZ A;  4HF0 A;  2EFP A;  5KK1 A;  2ZFW A;  4HLY A;  2B0L A;  3QPH A;  2P5L C;  1KU3 A;  2HYG D;  1OMI A;  4OMZ A;  3I5U A;  2OBP A;  3JTG A;  4UVC A;  2L4M A;  1R5G A;  2D1V A;  2MLG A;  3ZMD A;  2GAU A;  4YFX F;  2FQ3 A;  1T39 A;  1SD5 A;  2L01 A;  4CGZ A;  2JPB A;  3FM5 A;  4MGR A;  5E18 F;  1S7A A;  1S29 A;  4UHT A;  2D45 A;  1HQC A;  5HVQ C;  4PGH A;  3IRR A;  1ZN2 A;  1TBX A;  5D5V B;  4I01 A;  3LA7 A;  5FLX K;  4KFC A;  2GIV A;  3O6B B;  2ZME B;  3E6M A;  1KGS A;  1PP8 F;  3FXU A;  3GLX A;  1B9N A;  2OZU A;  2IA1 A;  2DPD A;  4HYE A;  5JHU A;  3R60 A;  3ZMZ A;  2YU3 A;  2QLZ A;  3C7J A;  5EEG A;  2DK8 A;  4EVI A;  3WTY C;  2FEZ A;  2EV6 A;  3WTS C;  5TJJ A;  2HYF A;  2FML A;  2FE3 A;  1ZRD A;  1ON2 A;  2MC3 A;  3HIF A;  2W85 A;  4KMU X;  2EA4 A;  4N9I A;  3E3V A;  3D0S A;  3WTU C;  4HOB A;  1U3E M;  4RB2 C;  1K6O A;  1I1G A;  1BC8 C;  2BBY A;  2P7V B;  1XCV A;  1Z7U A;  2HQR A;  2QQ9 A;  1B6A A;  2P6T A;  3PQJ A;  1KYZ A;  2OQG A;  1IN7 A;  1IXS B;  4XSZ F;  1OYY A;  4M9Z A;  1PDN C;  2XAS A;  4IJA A;  3M9A A;  2GA1 A;  1CF7 A;  3F8B A;  4NB5 A;  2L4A A;  1HKT A;  3I64 A;  1UB9 A;  3JTH A;  3ELK A;  3GUD A;  1WSU A;  5LEJ A;  1YLF A;  3I4P A;  1HST A;  4RAY A;  4CO8 A;  1D8J A;  2H94 A;  1IN8 A;  2EFW A;  3T1B A;  2UXN A;  2Q0O A;  4RGX A;  5E8G A;  4DQ2 A;  1O7F A;  4A6E A;  3EDP A;  2A07 F;  3SZT A;  2TDX A;  3L09 A;  2ACJ A;  1OYW A;  1DDN A;  1B1B A;  2F5E A;  2VON A;  3DQV C;  4TV7 A;  4A0Y A;  3QOP A;  1IXC A;  2GXG A;  2W84 A;  2CGP A;  2Z99 A;  3P9C A;  3BJ6 A;  3IWF A;  3MAJ A;  3DFG A;  1F9N A;  4F7Z A;  3IWZ A;  1I27 A;  1Y0U A;  3SXY A;  1SD7 A;  1ZG1 A;  3WGG A;  5E17 F;  2FBK A;  3DPL C;  3F8C A;  3RTR A;  5BOX A;  1BJA A;  2JRT A;  5LBQ A;  4XBF A;  2VN2 A;  4ETS A;  1QGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...