1ON1A

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ab conformation.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
135
structure length
130
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structure of the Manganese-Bound Manganese Transport Regulator of Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 52
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1on1A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1on1A02
1T2KA 5DUIA 2DQLA 3LAPA 4AIJA 3R0AA 2X4HA 4HOBA 3ZMTA 3WTSC 5BOXA 2P5LC 3IKTA 4L18B 1U2WA 2RNJA 3JW4A 2P6SA 1U8RA 1IXRC 2HGCA 4EGZA 2IA0A 3FMRA 5FD5A 2R7FA 3GW2A 4CDGA 1RUOA 3ZP5A 2FE3A 5JFRA 4H0EA 1ZRCA 1LVAA 1S7AA 1ZRFA 4A0XA 1OYIA 4ON0A 1TQPA 3ZMUA 4KYWA 3HSRA 2FOKA 3O6BB 3HHGA 4AIKA 4I0AA 3FZVA 2YSRA 3NEUA 4IRHA 3S2WA 1TQMA 5CVVA 4L0YB 3EUHA 4UVBA 1XGOA 3BJ6A 1KA8A 3CUQA 2IA2A 1B6AA 3BPXA 1LB2A 2ZMEA 4WX9A 3KP5A 2K86A 4A5MA 1WRJA 4XSZF 2HKOA 3U1DA 1G4DA 4YIFA 2VODA 4LLGF 3GLXA 4ESJA 5LGNA 1RNLA 2HTSA 2XHKA 4HF0A 3GEZA 5JI6A 2KIMA 3FF5A 4ENJA 4R79A 4XLNF 3GX4X 4LK1F 4O5VA 2CO5A 2KJCA 3K1NA 1F9NA 1BM9A 5F6FA 1P92A 2OU2A 2YX7A 4YIIA 2DPUA 1QZYA 3TQNA 5D8LB 1KU9A 2E7WA 5BMZA 2EV5A 4EJTA 3VODA 4MTDA 5E17F 1J5YA 1U3EM 2K02A 4CXFA 1XDUA 2GA1A 3GO5A 1OPCA 2K4BA 2WC2A 1U6GA 2PQ8A 3M7GA 3WGGA 3VFZA 3BWGA 3DP7A 2M87A 2XASA 3E3VA 2CSOA 4DQ2A 4PGHA 4GXOA 1U5TC 4ENMA 1FBUA 3GF2A 3R0JA 1STZA 3QAHA 5ICGA 4IRIA 3WTWC 1KYZA 2FRHA 2P6TA 5DV5A 3T8TA 2PLYA 5HOOA 3F3XA 3DEUA 1X3UA 2PMUA 3WTVC 3CLOA 3DQVC 4L9VA 4HDVA 3J80K 2AXLA 3J80Z 2EV0A 4KFCA 3WTTC 4ZZDA 2UXNA 1D8JA 4LMYA 3QPHA 1MZBA 1YTYA 2PBIA 4CGZA 1KQ9A 2QBYB 2RKHA 4KIGA 1WKMA 5E18F 3DXJF 3I58A 4AWXB 1MDMB 4HDUA 2RN7A 1J2XA 3F8MA 4RAZA 2VC1A 1E2XA 2RGVA 3DF8A 4HW0A 2ZNYA 4I98B 1GVJA 2IW5A 2Z3YA 1ZG1A 3KZYA 4U7DA 3DPTA 4WF2A 2O6GE 2H6BA 1J9IA 4KICA 4L5JA 1SMYF 2W57A 3ULQB 1ZH5A 2R7DA 1T6SA 2ADUA 1XGSA 1S3JA 5E1WA 2DI3A 3LAJA 1A04A 4M72A 4Y15A 3V7CA 1G3YA 1ZRDA 4A5NA 1MJAA 5ICCA 1BC7C 2YR2A 5CJ9A 3D0SA 3WTXC 2QBYA 2VOOA 2HDCA 4CHUA 3KP6A 2P7CB 1MDMA 4IHSA 3OOPA 2YPRA 5K5RA 1TBXA 1NHAA 5EEGA 3ROUA 3R6SA 2EFOA 5CVRA 4RB0A 1K6OA 4G6QA 3VEPA 4PDKA 1XGNA 2MA3A 2BBYA 1U78A 2QVOA 1R00A 3TDZC 1Q1HA 2EFQA 4EQQA 2GXGA 4Y13A 3RIRA 2DT5A 5FLXK 2PFBA 3RTRA 4LD5A 1PP8F 4HX8A 2L4MA 4UV9A 1SD5A 3E5XA 1JHHA 5D8KB 3I0TA 3LA7A 4G7HF 4BHBA 2CQKA 4GGGA 1XSVA 4BAYA 1W4MA 3J81K 1FP1D 3KFWX 3J81Z 2A69F 3JSPA 3BPVA 4BH9A 5F64A 2EA4A 2FBIA 3LA3A 4L9JA 1XGMA 2H27A 2V1DA 1TQIA 1LEAA 3JTHA 5F1RA 4YG2F 4LJZF 2L4AA 3RKXA 2NAZA 1ZLJA 1EH7A 4LGWA 4NB5A 1YLFA 4EJVA 4RB3C 2R3SA 1WWXA 3P9CA 1UHWA 2KJBA 2ZXJA 2CYYA 1T38A 2YX4A 2VN2A 4G7ZF 1IN7A 4S05A 3KZZA 1RZ4A 2ISYA 4IJAA 4IHTA 1UCRA 5DD8A 2ZO4A 3E6CC 2W24A 3M9AA 1F1ZA 4HX4A 4HF2A 5D5WB 5KVRA 2HFHA 2HZTA 1OYYA 2DK5A 3C18A 3WTYC 3FM3A 5LHHA 2JPBA 1R5HA 4XRFA 3ML6A 5LGTA 3GXOA 1R1VA 5CVUA 3TGNA 4LFUA 3K1PA 2GXBA 4RB2C 4M9XA 5E8GA 5CVIA 3RJPA 4UV8A 3H3UA 3OV8A 1YW8A 5L3CA 3IWFA 4G6DA 2C6YA 4UXNA 4WWCA 1BBYA 1W7PB 3KE2A 2P4WA 4P9UA 2HYFA 3ZMDA 2EWNA 4IPAA 5LHGA 2PI0A 3WGIA 4L5IA 5D5VB 2G9WA 3HYIA 4GO1A 3L09A 4RGRA 2G7HA 4K2EA 5HS7A 1UFMA 2MH2A 2W85A 3F8NA 3GUDA 4KT5C 3ZN1A 5D6FA 2A68F 4NHJA 3Q9VA 2ZJ2A 2XRNA 2F5FA 1ODDA 3L00A 1LQ1A 4HQEA 4HLYA 4D0PA 3BY6A 2UWMA 3WODF 3ZMVA 1YO5C 2IRFG 1WI9A 2IT0A 1UHMA 5IT9K 5D5UB 4HX7A 3REOA 3SQNA 2FF4A 1R7JA 1HKSA 2XKPA 4Y17A 4ZH4F 1W7PA 3ZMSA 1KU7A 4FX0A 5HS8A 2ZMEB 4P5OA 3GVAA 4ASNA 2IP2A 1Z1DA 4P9FA 1DP7P 3CDHA 2VBXA 2VBZA 1J7KA 2D2WA 4KN4X 1CF7B 4A2UA 2A3SA 4FT8A 3F72A 3BZ6A 2EFNA 2OQGA 3E6BA 3F6VA 1IN4A 1YFHA 2BEOA 2O61A 1ZGJA 2M8EA 2P7VB 1SMTA 4KIFA 3SHFA 1Y0UA 1IN5A 2L3DA 3EYIA 3DFGA 4EJOA 2QQAA 5HDKA 1FSHA 3KLOA 2L54A 4MGRA 1FP2A 4MNUA 1BIAA 1FPQA 3D5LA 3ECHA 3JSOA 2LDUA 2F5EA 4AIHA 1JE8A 1ZYRF 4MTEA 1B1BA 4ENNA 1SD4A 4EGYA 4KIBA 5E1ZB 3T5XA 1S8NA 4L9TA 4ZYDA 2H94A 5E1XA 1C0WA 3RYRA 1FWZA 3QRFF 3K9TA 1HKQA 2E1NA 2A6HF 1R23A 2RQPA 3TOBA 2CFXA 4U7BA 1HKTA 1GXQA 3K2ZA 4JBAA 1CF7A 2QUFA 1Z7UA 2RVCA 3M8EA 4OMZA 2O8XA 2LNBA 4JQFA 1BI3A 4U0YA 4F7ZA 4FX4A 2QENA 5L3DA 3AAFA 3TO7A 2A6EF 2NYXA 3MCZA 4BHCA 3WU0A 2V9VA 3RPUA 3KP4A 4M73A 3IKVA 1FYLA 1ONVA 2XAQA 1I1SA 5CYVA 3KLNA 5BQTA 1E17A 1SD7A 2GQQA 2DFIA 1P6RA 4G94A 3KEOA 3DV8A 2XROA 2BYVE 4Q47A 1IW7F 1ZLKA 1O3TA 5HDGA 2FMYA 4EJWA 1U5TB 5K5QA 1BI2A 3M1EA 3MZYA 2ETHA 2D45A 1K7AA 1FYMA 5LRRA 1F4KA 3LA2A 1IRFA 1HW1A 3T1BA 2EFPA 1FY7A 3P9KA 1Z91A 1IZ1A 1QBJA 2WV0A 1YIOA 2M1BA 2JTVA 4WK8F 4KDPA 2ELHA 2HQNA 2QQBA 5H6RA 3C1DA 5DCFA 3CUOA 2Z99A 1I1GA 5HLGA 1T39A 1P4AA 3QU3A 3QP5A 3IRRA 2ACJA 3FWEA 2PN6A 1XSXA 4LB5A 3RKWA 2Q8KA 2MLKA 4CO8A 1U5TA 1TLHB 4BHPA 2GZWA 3N4MA 4MEXF 2KIUA 2FNPA 3BROA 3R4KA 2HR3A 5ILSA 3IL2A 2EV6A 2QZ8A 2NRAC 2QM3A 5L3EA 3R61A 2JSCA 3IC7A 3RI4A 1BJAA 3L7WA 4G7OF 4O6JA 5DEQA 3GFIA 2FSWA 2DLLA 2ZBKA 2DBBA 3FMSA 1V3FA 2FNAA 2VBWA 5AIQA 2L01A 3L9FA 4OIPF 1L3LA 4XBFA 4RS8A 2VC0A 1IAWA 2TDXA 2STWA 1MJ9A 4UHTA 3HTSB 1HQCA 1EV7A 2XAJA 1FOKA 1KU2A 2VT2A 5HVQC 1P2FA 3WE3A 1O3SA 4UVAA 4BYYA 3SFZA 2IPQX 1G3WA 3L2CA 1ZGAA 4BXUA 4IF4A 2DPDA 1BN5A 1P4XA 4AVPA 3RDIA 1K79A 2UZKA 3P7NA 1GXPA 5LBQA 4XLPF 5FO5A 4DNCA 2P5VA 1FBSA 3EQLF 3F8CA 1FLIA 2FMLA 4B8XA 3HRMA 4N9HA 3KP7A 2OAZA 3GZ6A 3CO6C 4ETSA 4UNOA 2PG4A 1ON1A 3LWFA 3DPLC 1AWCA 2GIVA 3WE2A 1OR7A 1FNNA 5BPIA 5ICEA 4EM1A 3C3WA 5LHIA 1JGSA 3COAC 4RB1A 3HHHA 1H0MA 2FU4A 1JHFA 4ZYGA 1J75A 2LSOA 4HAMA 1L0OC 4FHTA 4WXDA 3BJAA 2XAGA 2QLZA 2WWYA 4OIQF 2DQRA 3CO7C 4A6DA 4QLCU 2O0YA 4LB6B 3QU6A 2CWEA 1BI1A 1QNTA 5ERIA 1FYKA 4Q5SF 1FZPB 3RYPA 5CLSA 2MBFA 3K69A 2A5YB 4EM2A 3KP3A 4KMUX 3FX3A 1YYVA 1YW9A 2HTJA 2KKOA 5HLIA 3FHZA 5ED4A 1LJ9A 1HW2A 3T8RA 2DTRA 1S6LA 3V7RA 2PMHA 2VONA 2OZUA 2Z9OA 5E8IA 3V8KA 6PAXA 1H9TA 3U2RA 4KNYA 3PQJA 3PQKA 2F5CA 5ILUA 4WXHA 3BDDA 3BOQA 2MD5A 4RAYA 2HS5A 4I7HA 4PCQA 3MZHA 5K5OA 1S29A 3WU1B 2E7XA 4ENKA 3I59A 3MEXA 1HW5A 5LLQA 5K1YA 4BQAA 4I0BA 5L3FA 2HEOA 1XCBA 4I2OA 3WTZA 4IRGA 3TDUC 3HUGA 1RUNA 5JHUA 3IWZA 1IXSB 1EH6A 2VE8A 2A61A 3GYHX 3M8FA 3F23A 4MQ9F 2G7UA 3ISPA 5E20A 5LEKA 3U9GA 2OZ6A 1ZARA 1HSTA 1TNTA 2M5WA 3W6KB 2HWVA 5HLHA 1OMIA 1D5VA 1KU3A 1O3RA 2JPCA 1XSDA 1FC3A 3HIFA 5A2QZ 1FT9A 2F2EA 3I4PA 3N97A 2VE9A 1QZZA 4Q4ZF 3HRTA 3CJNA 3ZPLA 2O03A 2XKOA 1YS6A 2IJLA 5D6EA 3CUQC 5BPDA 2QQ9A 2GWRA 4TV7A 4Q48A 4OIRF 4E70A 3IHUA 5DD4A 4GYGA 2X0LA 3MQ0A 4G9YA 5LGUA 3TO6A 4LLLA 3MFKA 4GYIA 2BGCA 4CICA 3QP6A 2ESNA 4A0ZA 5IT3A 4A12A 3H92A 1ZHFA 2EA2A 2J5PA 2EFWA 4EV0A 1D8KA 4ZYEA 3F6OA 3Q5FA 3WG9A 2ZFWA 3I64A 4HV6A 3VB2A 2XGXA 4A6EA 4ZYHA 4L0ZB 5L3BA 1IXCA 4I09A 2PJPA 4HA8A 3HSEA 4HLXA 4KMFA 4M71A 2UXXA 3VOEA 1XMKA 1DDNA 1FSEA 2F5DA 2ISZA 3H3ZA 2Y0MA 4R1HA 1RIOH 2DO7A 1V4RA 2W84A 3KETA 3E6MA 4L9NA 1XB4A 1TTYA 4I01A 5DCMB 2XV4S 4LG0B 2COMA 3ZQ7A 1ZN2A 2P5KA 4BNCA 4EVIA 2MH9A 3MAJA 1ULYA 3O3KA 2OA4A 3LSTA 3ZMZA 3FXQA 1G3SA 4MQVA 3HRUA 2V1XA 2MC3A 4YFNF 1SAXA 3E5UA 1LDJA 2FXAA 3ECOA 3KCCA 2B0LA 1XDSA 4MHGA 3BP8A 5CVJA 2EB7A 1LDDA 3ABUA 5H20A 1BI0A 3BJOA 4S04A 5J8FA 5KK1A 3SZPA 1G3TA 1IN6A 4IXAA 3F8FA 1B9NA 3RPQA 2XVCA 1MD0A 5FFXA 4P55A 2BV6A 4M6YA 1I6XA 4ESBA 1O3QA 1R5GA 1W5TA 2CGPA 1VTNC 2L02A 1AOYA 1W7PD 4PZJA 2DW4A 2LF8A 5DCMA 3RKYA 4LG0A 1SD6A 3E97A 4HQMA 4HZFA 2H6CA 3V8LA 2OQRA 2OBPA 1FX7A 4M74A 1B59A 3QOPA 4I02A 4ESFA 4OOIA 2EJRA 2P8TA 1YW7A 1PP7U 5FFZA 2EK5A 3R60A 5D4RA 2E1CA 4XSXF 1Z05A 3HOTA 3PFIA 4HF1A 3GFLA 1WQ2A 4EJUA 3HSFA 1I27A 1I5ZA 1KGSA 3TO9A 1QPMA 1T0FA 2AS5F 1LDKB 1HSJA 2FQ3A 1OYWA 1DPRA 1R1UA 4G8XA 3F8BA 2H09A 3W6JB 3B73A 2FEZA 3HOSA 2NS0A 1J0RA 3K1MA 5EEHA 1Z9CA 1D3YA 1WSUA 3TKYA 4ZZLA 2VT3A 2HOEA 2GA2A 4KN7X 3ZN0A 1XD7A 4HYEA 1O57A 1HXDA 2W25A 4O3MA 4RGXA 1S7OA 3K0LA 1MJBA 3FMQA 3V8JA 5DUKA 4R8HA 2ZKZA 2ESHA 4CZZA 3V7SA 3KEQA 2Z33A 5FGMA 2QYOA 5JVTA 3V4GA 2M30A 2VXZA 3DKWA 4M6XA 3E6DA 2O3FA 1YS7A 4P96A 5J6XA 1JXSA 2FA5A 4MEYF 2Z5UA 4Z2YA 2QWWA 5H6QA 2Q2EA 1IRGA 4WXCA 2XAFA 1T98A 3F21A 1QO0D 2HKXA 3SXYA 3HTUA 1B4AA 2JT1A 4OINF 4RGSA 1KQ0A 1ZG3A 3I71A 1F5TA 5LEJA 4OU0A 1OKRA 4WCGA 2STTA 2ZNZA 2J5OA 5FLXZ 4U88A 4N9IA 3G3ZA 1EH8A 2Y48A 3JAMK 3JAMZ 1IN8A 4U0VA 2XUBA 5J8CA 3CTAA 2HQRA 1PUEE 3J7AO 2D1VA 1XCVA 4HBLA 4OMYA 1SFEA 2K4JA 2RDPA 3I53A 5D5XB 2A07F 3ABTA 1IF1A 2CG4A 2IA1A 4HV5A 4A0YA 3SZTA 3FXUA 2LF7A 2Y75A 1PDNC 3O2PE 3NQOA 3LQQA 2DK8A 4PGGA 3F22A 3LFKA 2V79A 4UUVA 1KQ8A 3P9IA 1GHCA 1TNSA 1ZAOA 2YU3A 2GAUA 1YQAA 3NRVA 4EM0B 1QQIA 2PEXA 3Q9SA 3I59B 2LKPA 1K78B 3IRQA 3G73A 1W5SA 3GFMA 1QGPA 5ICFA 2ZCWA 1R1TA 4JK1X 1H9GA 3EYYA 2WTEA 2D1HA 3C7JA 1P4WA 4UVCA 1USTA 3EDPA 1RI7A 2JZYA 1ON2A 1BC8C 1FBQA 4GCVA 1SFXA 5FD6A 1B9MA 3WGHA 4M9ZA 2XAHA 5AONA 2VBYA 4N0BA 1R22A 1XN7A 2M45A 1SFUA 4KA4A 2KRFA 2BE5F 2XIGA 3GFJA 3B02A 1LNWA 3EETA 1MKMA 3T0YA 2FBHA 5L3GA 4M9SA 1Z6RA 1O7FA 2MLGA 2HYGD 1KYWA 3MWMA 3I5UA 5FB2A 1K78A 3JTGA 2Q0OA 3FXRA 5AIPA 4YFKF 2K7LA 1ZREA 4CYDA 1G6NA 4KUMA 5DDGA 3FM5A 3LQRA 3ERED 3KP2A 2DU9A 5LRSA 5D4SA 2OD5A 1MGTA 3TOAA 5DYMA 3GWZA 2RV8A 3E5QA 1LEBA 1REPC 1J59A 5HDNA 3ELKA 2NNNA 3WTUC 4B09A 4LLNA 3I54A 1BIBA 1DUXC 1R58A 1O7LA 4QWQA 1Z6TA 4RGUA 4AD9A 1CGPA 3HRSA 2VOPA 1USSA 1UB9A 4NQWA 5A2QK 5JR3A 1R36A 2K27A 5TRDA 5ILVA 4EMSA 2FBKA 2NNYA 1DPUA 4YFXF 1TW3A 5HS9A 5TJJA 4U0WA 1TW2A 2V1UA 1BOAA 2IVMA 2V6CA 2RC4A 5IT9Z 4IVNA 1ZG5A 4LK0F 1HBXG 1XMAA 1YG2A 2JRTA 3QPTA 2KIFA 3CUQB 2CW0F 1IUYA 3GZ5A 5BS6A 2DAOA 4OIOF
chains in the Genus database with same CATH superfamily
3F9KA 1T2KA 3LSIA 5DUIA 2KMUA 3BLYA 1GV5A 4DYCA 2DQLA 3KYDB 2HVSA 3LAPA 3H9GA 1IDZA 4OWRB 2LR8A 2LFBA 4AIJA 3R0AA 2GLOA 2X4HA 4HOBA 1ZGWA 3ZMTA 3ZQGA 4OAZA 3WTSC 5BOXA 2P5LC 3IKTA 4X1EA 1D0XA 4L18B 1U2WA 2RNJA 3JW4A 2P6SA 3MKWB 2E34A 3TMOA 4A3IJ 1U8RA 5A2QR 1IXRC 2HGCA 4EGZA 2IA0A 2YUSA 2R4GA 3BZKA 3FMRA 3TL4X 4JP0A 3BR6A 3K4LA 5FD5A 2R7FA 3GW2A 3HJEA 4CDGA 1RUOA 3ZP5A 2FE3A 5JFRA 3DCFA 4H0EA 1ZRCA 1LVAA 4C30A 1S7AA 4ANJA 3M4OJ 1EA3A 4W97A 2ELJA 1ZRFA 3BR2A 5TGTA 2EZIA 5IT9R 4A0XA 1OYIA 2VB6A 3FKJA 1Z0XA 4ON0A 3G6EI 1ZQ3P 1TQPA 1W36D 2F4MB 3ZMUA 1PUFA 4KYWA 3HSRA 1FEXA 2FOKA 3O6BB 3HHGA 4AIKA 2CW7A 2JRMA 4I0AA 3FZVA 2NVTJ 2YSRA 4XKCA 1BW5A 2LD5A 1WHUA 1D0YA 3NEUA 3MVPA 4IRHA 3S2WA 4BEHA 1LVKA 3LFUA 1TQMA 5CVVA 5FKKA 1MBJA 3KYCB 1VF9A 4L0YB 2DCEA 1I6HJ 3EUHA 1Y1WJ 5E3LA 1ITYA 4UVBA 2RAEA 1XGOA 2QKLB 2M7BA 1KA8A 3BJ6A 5B1AH 2I10A 3CUQA 5J1RA 1WJEA 2IA2A 1B6AA 3BPXA 5GAGJ 3CMYA 2LLKA 1LB2A 2ZMEA 4A3GJ 4WX9A 3QYBA 3KP5A 2K86A 1DU6A 2NOGA 4A5MA 1WRJA 5EG0B 4XSZF 2HKOA 3U1DA 1H88C 1G4DA 4YIFA 5LFAA 2VODA 2QF7A 4E7HA 4LLGF 3GLXA 1N77A 4ESJA 4AVZA 5LGNA 1RNLA 2BHYA 3OYFA 2HTSA 2XHKA 4HF0A 3GEZA 5JI6A 2KIMA 3FF5A 3L2UA 4ENJA 3H5RA 4R79A 4XLNF 4F93B 4LK1F 3X2QH 3GX4X 4OIOF 3LMMA 4O5VA 3DEWA 2CO5A 2KJCA 2DDBA 3K1NA 2NVYJ 1K4TA 1F9NA 3GTOJ 1BM9A 5F6FA 2ZJQF 1P92A 3M3YJ 3JRHA 2KFDA 2OU2A 3DBHB 2GOXB 3L1PA 1W0TA 1XC5A 2YX7A 3GTQJ 4YIIA 2E1MB 4XLAA 2DPUA 2MD0A 1QZYA 3TQNA 5D8LB 1KU9A 2E7WA 5BMZA 2EV5A 3OS0A 4EJTA 3VODA 4MTDA 5E17F 1J5YA 5KHDA 1U3EM 2K02A 5E3OA 4CXFA 1XDUA 2DA1A 2GA1A 3GO5A 1OPCA 3L2RA 2K4BA 2XGCA 2WC2A 1U6GA 2PQ8A 2JA5J 1YJWI 1YITI 3M7GA 3WGGA 3VFZA 3BWGA 3DP7A 4CUGA 2M87A 2XASA 3ASNH 3SEQA 3E3VA 2CSOA 2M2EA 4F91B 4DQ2A 2CRGA 2IEKA 5EG0A 1FTZA 1X1DA 3NARA 4PGHA 5J4YA 2E60A 3IV5A 4GXOA 1U5TC 2EZKA 3DTKA 4ENMA 1FBUA 3GF2A 3R0JA 1STZA 4XORA 2KPMA 3QAHA 4II3A 4V2GA 5ICGA 4IRIA 3WTWC 1KYZA 2Q1ZB 1AHDP 1H89C 2QA4I 3K70C 2FRHA 2P6TA 5DV5A 1HF0A 3T8TA 1MBFA 2PLYA 5HOOA 1JJ6C 3F3XA 4BQNA 3DEUA 3CLQA 1YRNB 3S1NJ 2XSJC 1UAAA 2R7WA 1X3UA 2PMUA 3WTVC 4CCLA 3M07A 3CLOA 4YRVA 3D5RC 3DQVC 4L9VA 3A03A 5EDNA 2JVGA 4A3DJ 4HDVA 3J80K 2AXLA 4QPOA 3J80Z 2EV0A 4KFCA 3G1OA 3WTTC 3CCMI 3HXLA 4ZZDA 2QSHX 2UXNA 2EINH 4B4CA 3MKYB 3ZQLA 2NVQJ 1D8JA 4LMYA 4D7MA 3LSHA 3QPHA 3TBIA 2VUMJ 2LG4A 3BR0A 1MZBA 4IX7A 2PBIA 1YTYA 2QSGX 1X3ZB 1F36A 4BE2A 3BCBA 1KQ9A 4CGZA 2QBYB 2RKHA 4KIGA 1WKMA 3U21A 5E18F 5JHFA 5K7ZA 3DXJF 3I58A 4AWXB 3LSJA 1MDMB 3CF5F 2JA8J 4HDUA 3UKGA 1DQUA 2RN7A 1MSFC 2Y0SN 3H1CA 1J2XA 3F8MA 4RAZA 2VC1A 1E2XA 1WH7A 2RGVA 3DF8A 4UUTA 4BE0A 3HKZN 4BBSJ 3CCRI 4HW0A 1YX3A 2ZNYA 4I98B 5FKLA 1Y39A 2HNHA 2M7AA 1GVJA 4AU7A 2IW5A 1GUUA 2Z3YA 1ZG1A 1E0EA 3KZYA 4U7DA 3I55I 3DPTA 1TZLA 4WF2A 2O6GE 2H6BA 1X2NA 4F92B 4RLQA 1YRNA 3J80R 1J9IA 4BXFA 4KICA 4L5JA 1SMYF 2M0MA 2W57A 3ULQB 1ZH5A 1Y8RB 3LNQA 2CUJA 1T6SA 2R7DA 3LOCA 5EJCA 2ADUA 1Z21A 1XGSA 1R6RA 1S3JA 5E1WA 2DI3A 3LAJA 1A04A 4M72A 4Y15A 4PJLA 4FETA 4RDUA 2ZJPF 4XLHA 3V7CA 4I99C 1G3YA 4A3KJ 1ZRDA 4A5NA 1DP3A 1MJAA 2IBDA 2IAIA 5ICCA 2XF5A 1BC7C 2YR2A 4M6VA 5CJ9A 1IUFA 3D0SA 3WTXC 2L9NA 2QBYA 2VOOA 4XL9A 2HDCA 4CHUA 3BTIA 4FE7A 3KP6A 2P7CB 1OQYA 1UJ8A 1MDMA 4IHSA 3OOPA 2IXSA 2YPRA 1QHGA 3PNYA 5K5RA 3H0DA 1TBXA 1NHAA 4DBRA 5EEGA 2X1CA 4XM3A 2MABA 3R6SA 3ROUA 2EFOA 5CVRA 4RB0A 4ZC3A 1XTAA 1K6OA 4G6QA 3VEPA 4PDKA 2EZLA 1OR7C 1XGNA 1HA8A 2DXIA 2MA3A 2BBYA 1U78A 3CMMA 2JN6A 2QQ8A 2DJNA 2QVOA 3JCUC 1R00A 1I50J 3S16J 3TDZC 1Q1HA 2EFQA 4EQQA 4F55A 2GXGA 2WB1A 4Y13A 3A52A 1BR2A 3GTKJ 3RIRA 2DT5A 4XQFA 1TL8A 2VLAA 5FLXK 3HOYJ 1GLNA 2PFBA 2ID6A 3RTRA 3ZQFA 4LD5A 1PP8F 4HX8A 5E3MA 2H1KA 2KISA 2L4MA 3FHNA 4UV9A 1SD5A 3E5XA 3I56I 1JHHA 5D8KB 4JX6A 2KRCA 3OYLA 2LY9A 3I0TA 5E3NA 3LA7A 3C2GA 4BY7J 2XRLA 1IJWC 4G7HF 3PUBA 1ETOA 2CQKA 4BHBA 2EH3A 4GGGA 1XSVA 2M9HA 4BAYA 2KDOA 1W4MA 3J81K 2XDVA 1FP1D 3KFWX 3J81Z 3W6VA 2MZ4A 2A69F 3JSPA 3BPVA 4BH9A 5IP7J 5F64A 3I9V2 1X4OA 3CCVI 5C4XJ 2EA4A 3FK7A 5EYRA 2FBIA 3LA3A 1ERDA 4L9JA 1XGMA 2A05A 2H27A 3CF2A 2V1DA 1TQIA 1LEAA 3JTHA 1T33A 2IGOA 2VKHA 5F1RA 4GRIA 4YG2F 1ETKA 4LJZF 2L4AA 2DMTA 1VZ0A 3QOEA 3RKXA 1G2HA 2NAZA 1ZLJA 2CQ7A 1FIPA 2R0QC 1EH7A 5FLXR 2PJRB 1TT5B 1MMDA 3AG3H 4LGWA 4ZDOA 1S5LC 4NB5A 1YLFA 3PUFA 4EJVA 2E2HJ 1IV6A 2DA5A 4RB3C 1T56A 1WWXA 2R3SA 3P9CA 1MH4A 3OS1A 3PJRA 2XPUA 1UHWA 5FKNA 1ZR2A 2KJBA 3H36A 2KT0A 1G59A 2ZXJA 5E79C 1OISA 3OL3A 2ECBA 4V19K 2CYYA 2W1OA 1RC9A 3FK6A 2YX4A 1T38A 2E1OA 2VN2A 2L9RA 3Q0VA 4G7ZF 2W48A 1IN7A 4S05A 3KZZA 1RZ4A 2ISYA 3OIOA 4IJAA 4NC8A 3OYCA 3J81R 2HYJA 2RQQA 9ANTA 4A3CJ 4D1QA 2CV2A 4IHTA 1UCRA 2JSPA 3FXOA 5DD8A 2ZO4A 5CKTA 4IHXA 2R7ZJ 3E6CC 1SAUA 3PIPF 2W24A 4CSWA 5IOZA 3VSKA 3M9AA 1F1ZA 4HX4A 4HF2A 3HL2A 5D5WB 2P0WA 5KVRA 1OJLA 2IGNA 2HFHA 2HZTA 3HZJA 5EF6A 1OYYA 2DK5A 1Y1VJ 2BY2A 2CQXA 3C18A 3WTYC 3FM3A 5LHHA 2JPBA 2OV7A 3OSGA 3DLAA 1R5HA 1WH5A 4XRFA 5JVGF 1UG2A 3ML6A 2KIQA 5B3SH 2MG4A 1HCRA 1YOVB 5LGTA 1XPXA 3SDGA 3GXOA 1R1VA 5CVUA 2E5ZA 3TGNA 4LFUA 4XONA 3K1PA 2GXBA 4RB2C 1JGGA 2DMPA 1TWFJ 1HC8A 4M9XA 5E8GA 2X6WA 5CVIA 3RJPA 1MBKA 5GPAA 4M3DA 1ENHA 2XSDC 5TISC 4UV8A 3H3UA 3OV8A 2DOEA 1YW8A 4G12A 5L3CA 3IP4B 3IWFA 4M3BA 5GP9A 4DBQA 4G6DA 2C6YA 4UXNA 3OYIA 4WWCA 2JA2A 1BBYA 2E71A 1W7PB 3KE2A 2P4WA 4P9UA 1BW6A 2HYFA 3ZMDA 3B6CA 2OTJI 2EWNA 1S9HA 4IPAA 5LHGA 3S3NA 2PI0A 3WGIA 1RETA 4L5IA 3OYGA 5D5VB 2G9WA 3HYIA 2Y2ZA 4U87A 2AXTC 4GO1A 3AL0B 2DODA 2W4SA 1BOBA 3QPLA 3G71I 2B9SA 3L09A 2VJIA 4RGRA 1DGRM 2P81A 2G7HA 4K2EA 5HS7A 1UFMA 2MH2A 2W85A 2VI6A 2QSFX 3F8NA 3GUDA 4KT5C 3ZN1A 2HU9A 5D6FA 2A68F 4NHJA 3Q9VA 2LC2A 2ZJ2A 4RM2A 1X1CA 2XRNA 2F5FA 1ODDA 1SVMA 3ZQIA 1XG1A 3L00A 3UR3C 1LQ1A 5IYBJ 2KQRA 4HQEA 2LKXA 4HLYA 4D0PA 3BY6A 3PIOF 2UWMA 3WODF 4HNUA 3HOVJ 3ZMVA 1WJ5A 4DGWB 1YO5C 5M5WJ 3HOZJ 2F5VA 1PUFB 2IRFG 1WI9A 2IT0A 1UHMA 5FLMJ 4XK4A 1I39A 3HB9A 5IT9K 4NBQA 2AQFA 2LRDA 2L0KA 5D5UB 4EEFG 3DPUA 4CCOA 2DA2A 4HX7A 2MW8A 3REOA 1D0ZA 3SQNA 2FF4A 4E7ZA 2BY0A 3BR3A 3FXMA 2R93J 1I3AA 1R7JA 1HKSA 2XKPA 3FKIJ 4X0GA 3H35A 4LG3A 4Y17A 4ZH4F 1W7PA 1JKOC 4C3HJ 3ZMSA 1KU7A 4FX0A 5HS8A 2JVHA 2ZMEB 4UUSB 4P5OA 3GVAA 4B44A 4ASNA 3K6GA 2IP2A 1Z1DA 1BR1A 4P9FA 3OSFA 1DP7P 4CCMA 3CDHA 4M3GA 2VBXA 1ETWA 2TRTA 2VBZA 3VYSB 2BY3A 3BTCA 4Y3OA 4QSHA 2WAQN 3AFHA 1J7KA 2IGKA 2D2WA 3DTEA 1FMVA 4KN4X 4PJ0C 1CF7B 4A2UA 2A3SA 4FT8A 4AYBN 3GTJJ 3F72A 2DYRH 3CQZJ 2K85A 3BZ6A 2EFNA 2JUGA 2OQGA 4IOCF 3E6BA 2Y9ZA 3F6VA 1IN4A 1YFHA 2BEOA 3OR2C 2O61A 1ZGJA 2M8EA 2P7VB 5HNFA 2K5CA 3ZQCA 2HPMA 1SMTA 2QGUA 4CCJA 4KIFA 3SHFA 1Y0UA 1QU3A 3OMYA 1IN5A 2L3DA 5B5EC 3DFGA 4EJOA 3EYIA 2EPFA 2QQAA 5HDKA 1FSHA 3KLOA 3KEYA 1WCMJ 2L54A 4MGRA 1FP2A 3NWTA 4MNUA 1BIAA 4RAGA 1FPQA 3D5LA 3ECHA 3HPGA 3JSOA 4F52A 2LDUA 2F5EA 2X1EA 4AIHA 1JE8A 1ZYRF 4MO7A 4EATA 2VQCA 5KAFC 4MTEA 3WHCA 1LFUP 1B1BA 4ENNA 5FJ8J 5EZHA 2HOTA 1SD4A 2AHQA 3AG2H 2LYCA 4ITVA 4EGYA 4KIBA 5E1ZB 3Q0WA 4UUSA 4KJZA 2CUFA 3T5XA 1S8NA 4L9TA 4ZYDA 4A3JJ 2H94A 1ETQA 5E1XA 2KP6A 4E4HA 4S0HB 4XMYA 1C0WA 3RYRA 1FWZA 4PFOA 3QRFF 3K9TA 3CC4I 3HDDA 2CQQA 1HKQA 2E1NA 1X3WB 1R23A 2A6HF 2RQPA 1Y56A 4E7IA 3TOBA 2CFXA 3HPHA 4U7BA 1HKTA 1GXQA 3K2ZA 4JBAA 1CF7A 2QUFA 2Y30A 1Z7UA 2RVCA 3M8EA 4OMZA 2O8XA 2LNBA 4JQFA 2OPTA 1BI3A 4U0YA 4F7ZA 4FX4A 2CH0A 2VQLA 2QENA 4B1RA 5L3DA 1UMQA 3AAFA 3TO7A 1Q1VA 2NXNB 3IH2A 2FQ4A 2A6EF 2LREA 4J01A 2NYXA 3S1QJ 1WZ2A 2I5UA 3MCZA 2K40A 3BG5A 4BHCA 5CQGA 4RMNA 3L2QA 2OUMA 3WU0A 2V9VA 3RPUA 3ZQQA 2CUEA 3KP4A 2BXYA 4M73A 4GDFA 1ORKA 3IKVA 2R7QA 1FYLA 1ONVA 2XAQA 3A1YA 2JA7J 1I1SA 4BUPA 5F08A 3OYDA 3BG9A 1SANA 1JUSA 2M34A 5CYVA 3I4NJ 1AKHA 1VI0A 1TWGJ 2UV1A 3KLNA 5KCMA 5BQTA 2GM4A 1WJAA 2JQ7A 2Y0SA 1E17A 1SD7A 2GQQA 2DFIA 1P6RA 4G94A 3S32A 3KEOA 1MSEC 4P1WA 3DV8A 2K9LA 2DA7A 3HKZA 4LOCA 3VYUB 2XROA 2GXAA 2BYVE 2KDZA 1X1BA 4Q47A 2LOOA 4MLOA 4D5FA 5F0HA 1IW7F 3IAS2 1ZLKA 1O3TA 2LMDA 1N75A 5F0FA 1JKRC 5HDGA 2FMYA 2LY2A 4BQQA 1X2MA 2HQAA 4AIDA 4EJWA 1QRYA 1U5TB 2FJ1A 1ZTRA 3OIPA 5K5QA 2R7OA 1BI2A 3GCMA 2HQ5A 1ETXA 4PJMA 3M1EA 3MZYA 2ETHA 4C9YA 2D45A 2KLOA 4XRSG 2VJJA 3K4KA 1LE8B 4A69C 1K7AA 4MIMA 1ZK8A 1FYMA 5LRRA 5C44J 1F4KA 2V7FA 4JX4A 3Q3SA 1BA5A 4CZCA 3SJMA 3LA2A 1IRFA 4AM3A 1HW1A 3T1BA 2EFPA 2E5NA 1FY7A 3P9KA 1Z91A 4PUSA 3RSNA 2NS8A 1QPIA 1IZ1A 1QBJA 3ZCOA 2WV0A 3JR9A 4PK4A 4J19A 1YIOA 2M1BA 4BS9A 2JTVA 4HSRA 1JT0A 4WK8F 4KDPA 3CCLI 3F0CA 2ELHA 2HQNA 2QQBA 3OR1C 5H6RA 3G4SI 3C1DA 5DCFA 3GMEA 3BR5A 2Z99A 3CUOA 1I1GA 5HLGA 1T39A 3ABKH 2L9SA 1P4AA 4XRMA 2OTLI 3QU3A 1WJBA 3K4JA 3KIOA 3GTLJ 3QP5A 2EIKH 3D1NI 3GTPJ 1QA6A 1MH3A 3IRRA 2ACJA 3CCEI 2L7FP 2M35A 3FWEA 2PN6A 1X4PA 2W00A 2WAFA 3TW6A 4DYQA 2QEXI 1XSXA 4LB5A 3RKWA 2ZJRF 2Q8KA 1M1EB 2MLKA 4CO8A 1U5TA 2MVTA 1TLHB 3W3CA 4I6ZA 1POGA 3K4NA 4BHPA 3S14J 2GZWA 3N4MA 2V4JC 4MEXF 2R7UA 1MMNA 2KIUA 2M4GA 2FNPA 3BROA 2WBMA 3HG9A 3JRFA 1MW7A 3R4KA 1LE8A 1D5YA 2HR3A 5ILSA 4E6KG 3IL2A 2EV6A 1JUMA 2QZ8A 2NRAC 2QM3A 5L3EA 3R61A 2JSCA 3AKZA 3CP2A 4XOTA 3SDBA 4IQJA 1VQ8I 3IC7A 3RI4A 2Y9YA 1BJAA 3L7WA 5GPCA 2DFHA 4C2MJ 2KRHA 2X85A 4G7OF 2ME0A 4DZJA 3OYAA 4O6JA 1OCCH 5DEQA 3L2VA 1DGWY 3GFIA 1HDPA 2FSWA 2DLLA 1WJFA 2ZBKA 2ID3A 1T08B 3GZNB 2DBBA 3ZXSA 3FMSA 2JK3A 1AA7A 4PJNA 1V3FA 2FNAA 1A35A 3M1CA 1BJZA 2VBWA 2VASA 3RCOA 5IYDJ 5CQEA 4BDYA 5AIQA 4HNTA 2L01A 3L9FA 4OIPF 1L3LA 4XBFA 4RS8A 2VC0A 1IAWA 3RPUD 1VQLI 4CYCB 2TDXA 3PNVA 1MJ9A 4UHTA 2STWA 1HQCA 3ASOH 3HTSB 2VQGA 3RZOJ 3PFYA 2WY7Q 3ZOBA 1JI8A 4FCYA 2DMNA 3RQ4A 1EV7A 2XAJA 4DYRA 1FOKA 1KU2A 2VT2A 5HVQC 1P2FA 3WE3A 1O3SA 3BG7A 1ETYA 3VWBA 4UVAA 4N4NB 4Y33A 3A4CA 2Y69H 4BYYA 3SFZA 1PJRA 4RBOA 2IPQX 1G3WA 3L2CA 1ZGAA 2VIXA 1G8XA 4DIQA 3FBNB 4BXUA 4IF4A 2DPDA 2XB5A 2DT6A 1BN5A 2M4KA 2L2OA 2X1DA 4IHVA 1P4XA 4AVPA 2BVMA 3RDIA 1E3PA 1OCZH 2FOWA 1K79A 2I8DA 4AC0A 2UZKA 3DU5A 1T8IA 2DFFA 2DFEA 3J7AY 2FD5A 3P7NA 3H5NA 1GXPA 1D1CA 5LBQA 3U1KA 1N25A 1R5ID 2ZB9A 2N8GA 4XLPF 4II2A 1FMWA 3OYJA 1D1BA 2MYSA 5FO5A 1IDYA 1SC7A 2AO9A 1W36C 5FRNA 4C2UA 1V55H 2WAEA 1QVUA 2OCEA 4DNCA 2IS2A 1YI2I 4G6TB 2P5VA 3HOWJ 3TW7A 1FOWA 1FBSA 3EQLF 3F8CA 3LSKA 3OS2A 2CJJA 1FLIA 2DOAA 2FMLA 4B8XA 3ABLH 4XR6A 4CYCA 4AUXA 2JMWA 2MGQA 5F27A 2ZXIA 1ZKGA 3HRMA 3OYNA 4N9HA 3KP7A 4GFBA 2OAZA 4IKFA 1QVTA 2A6TA 3GZ6A 3CO6C 4ETSA 1XMXA 4UNOA 2PG4A 1ON1A 3LWFA 1JT6A 3DPLC 4E7LA 1W5CC 2GIVA 4FISA 1AWCA 3WE2A 1OR7A 1FNNA 4FE4A 5ICEA 4EM1A 3S1RJ 5BPIA 2X98A 1EKEA 3MKLA 2V6EA 3C3WA 3GTGJ 5LHIA 4QIWN 1JGSA 3COAC 2PMZN 4RB1A 4N4OB 3S2HJ 4HG2A 3VPRA 1P9QC 3HHHA 1H0MA 2FU4A 1JHFA 4ZYGA 1J75A 4BJ5C 1NTCA 3JRBA 1WJCA 2LSOA 4HAMA 1L0OC 2F4IA 4FHTA 1HDDC 1RRJA 1WFXA 3E1SA 3BJAA 4WXDA 5JLXA 4CA0A 4DJAA 1GDTA 1GV2A 2XAGA 5EEAA 1MBEA 2QLZA 4IHYA 3E7LA 2WWYA 4OIQF 1R4NB 2DQRA 2X9DA 3CO7C 4A6DA 2L7MP 4QLCU 1FTTA 2O0YA 2IS1A 4LB6B 4A93J 3QU6A 2CWEA 1BI1A 2Z16A 5H2FC 1QNTA 5GAHJ 5ERIA 3HUGB 1FYKA 1B72B 4Q5SF 2R7SA 1Z3XA 1EJ9A 3K70D 2HI3A 1FZPB 1HOMA 3RYPA 5CLSA 5KNLA 2MBFA 3K69A 5GADJ 4V2FA 2A5YB 4IEJA 3CC7I 4EM2A 4Y4RA 3KP3A 1A6IA 3QODA 1R9TJ 3ZR8X 4KMUX 3FX3A 1YYVA 3DKXA 2CFOA 1YW9A 2HTJA 2JJ7A 2FX0A 4PJJA 1OCPA 2KKOA 4RM3A 3ZQHA 5HLIA 3FHZA 2MSYA 3O8GA 5ED4A 1LJ9A 1P7JA 3JRCA 1HW2A 3OWTA 3T8RA 2DTRA 1MNEA 1S6LA 3V7RA 2PMHA 1Z77A 2VONA 2OZUA 2JUCA 2Z9OA 1RPWA 5E8IA 4Z6YA 3KPHA 3V8KA 6PAXA 5EGOB 1H9TA 3U2RA 4KNYA 3PQJA 3PQKA 1S72I 3CMAI 3K2AA 2B7EA 2F5CA 5ILUA 2M0CA 4WXHA 1R71A 3BDDA 3BOQA 3LL7A 2MD5A 4RAYA 2HS5A 4I7HA 3B6AA 4PCQA 5FLVA 3I4MJ 2NVUB 5K5OA 3MZHA 1S29A 3CZ6A 2V9KA 3WU1B 3CJTB 1FIAA 5K7FA 3V42A 3HBLA 2E7XA 4ENKA 1V5GA 3TEDA 3IUOA 3I59A 3MEXA 1IO2A 1HW5A 4IL6C 3VSLA 5LLQA 2WAQA 5K1YA 4A3FJ 3HGYA 4BQAA 1GVDA 1WVRA 4I0BA 4RA2A 5L3FA 2HEOA 1E3OC 1XCBA 3BQYA 3WU2C 1ZELA 3QQAA 5F04A 3IAM2 4LIUA 4C3IJ 4I2OA 3WTZA 4IRGA 3TDUC 4AYBA 2HXOA 1YJ9I 3HUGA 3QPSA 1RUNA 1B72A 3OYHA 5JHUA 3IWZA 1IXSB 1EH6A 2VE8A 2A61A 3GYHX 1ACIA 1XX5A 3M8FA 2VJ5A 5HLTA 3KX2A 3F23A 4MQ9F 2G7UA 3ISPA 3ZRGA 2NVXJ 5E20A 1RKWA 2MFZA 5LEKA 1WGXA 2K9NA 3U9GA 1MBHA 2OZ6A 1ZARA 5C4JJ 3ABMH 2Y31A 1HSTA 1TNTA 2M5WA 2OCCH 3ESWB 2XF6A 3W6KB 2HWVA 3ONQA 4ZDLA 1OMIA 5HLHA 1D5VA 1KU3A 1K61A 2LK2A 3FXJA 2R5YB 1O3RA 2WY8Q 5M3FJ 5EGOA 2JPCA 1WI3A 1XSDA 1IG7A 1FC3A 3HIFA 5A2QZ 3GBGA 1YIJI 1VQOI 2ZFUA 1FT9A 2F2EA 3I4PA 3N97A 5DM6F 4CH7A 2R7RA 4IHWA 2LTPA 2VE9A 1QZZA 4Q4ZF 3HRTA 3CJNA 3ZPLA 1A5JA 2H1LA 2O03A 2XKOA 4RLFA 1QZEA 2DA3A 3QYEA 1J09A 1MMSA 2VXDA 1V5EA 4Y7NJ 1YS6A 3S2DJ 2IJLA 3EUHC 3IH3A 2EBIA 2L9VA 4HNVA 3GTMJ 5D6EA 3OIQA 2F6CA 2LVSA 3CUQC 4B3AA 1VQMI 2ZSIB 1U9NA 5BPDA 2QQ9A 4NC7A 2GWRA 4XNFA 1BR4A 4TV7A 4Q48A 1Y6IA 1LFBA 2EIJH 3BQZA 4OIRF 4E70A 2M3AA 3IHUA 2B63J 5DD4A 2X6YA 4GYGA 2X0LA 2R5ZA 3MQ0A 4G9YA 5LGUA 3C2BA 1MMGA 3TO6A 4LLLA 2BOLA 3MFKA 1NG6A 4GYIA 2BGCA 4CICA 3QP6A 2ESNA 4BACA 1OCOH 3A2KA 4A0ZA 5IT3A 5GTIC 4A12A 3VDXA 3H92A 4NNJA 4XICA 2R7XA 3HGGA 4BY1J 1ZHFA 2EA2A 4QTRA 4JX5A 3JRAA 2J5PA 2V9PA 4IQ4A 3J7ZI 2EFWA 4EV0A 5IPAA 4QPQA 4IOAF 2R5YA 3CJQB 4RAFA 1K4SA 2K9QA 4HEA2 3MMYB 2LP0A 3WHBA 2Z1DA 1D8KA 2ZXHA 2KL4A 4ZYEA 1TT0A 3F6OA 4ABZA 1LFPA 3Q5FA 3OL4A 4CCNA 1IRXA 2DT7B 3WG9A 2ZFWA 5HNHA 3FIWA 5IYCJ 3I64A 1AKHB 4HV6A 3VB2A 1VQ6I 2XGXA 2MUNA 3SYTA 1TWAJ 3VYRB 4A6EA 3E0JB 4ZYHA 3K4BA 4NC6A 4B47A 4L0ZB 5L3BA 1IXCA 4I09A 3VYTB 3MN2A 2WA0A 3S1MJ 1VQ4I 2VPLA 2PJPA 4YELA 2EIMH 4HA8A 3HSEA 4HLXA 2GBYA 2E19A 4KMFA 2O9LA 4M71A 2UXXA 2F48A 3VOEA 1OCRH 1Y0NA 1XMKA 2VPRA 2CW8A 1RQ6A 2DMQA 1DDNA 1FSEA 4KT6A 2F5DA 2MC4A 2ISZA 3H3ZA 2Y0MA 1BL0A 4R1HA 1RIOH 2DO7A 1WPKA 1V4RA 2W84A 3M8JA 3KETA 2NOJB 5J4VA 5FRMA 3E6MA 4HRIA 4L9NA 1OFCX 1XB4A 1TTYA 4I01A 2BHZA 4A3LJ 4D9JA 5DCMB 4A3MJ 2XV4S 4LG0B 2COMA 3ZQ7A 1ZN2A 2OC6A 3MZ8A 2P5KA 4CCKA 2DN0A 4BNCA 3DEEA 4EVIA 5J1YA 5IOYA 2MH9A 3MAJA 1ULYA 3K10A 2OA4A 2L7ZA 3O3KA 2IGMA 3LSTA 3ZMZA 1W0UA 2L7KA 3FXQA 5J40A 1G3SA 4MQVA 3CESA 2V1XA 3HRUA 4FASD 4L5EA 2E1MC 2MC3A 4YFNF 1SAXA 3E5UA 1LDJA 4KISA 3SFIA 2FXAA 4BJ6C 3ECOA 2K9MA 1JJ8C 4F3QA 3KCCA 4IZZA 1T0FC 3DBRB 3J7YJ 3Q0UA 5K7HA 4BXXJ 2B0LA 3OYMA 4BL0B 1XDSA 4MHGA 2E35A 3BP8A 4JYKA 5CVJA 4B3XA 1MBGA 2EB7A 1LDDA 3ABUA 2H8RA 4BQOA 1ZR4A 3LSRA 5H20A 4OAYA 3BC8A 1BI0A 1VFCA 3BJOA 4S04A 5J8FA 5KK1A 4FTHA 3SZPA 1G3TA 3O8HA 3FDYA 1IN6A 4IXAA 3JRGA 3F8FA 1B9NA 2EZHA 3RPQA 4M3FA 2XVCA 1MMAA 3FXLA 3S3MA 1MD0A 1NK3P 5FFXA 4P55A 2BV6A 2CV0A 1VQKI 2JA6J 4M6YA 4BBRJ 1I6XA 4PFPA 4D7NA 4ESBA 1O3QA 4XKWA 5FKOA 1RKTA 1R5GA 1Z3YA 1OCTC 1W5TA 3CDLA 2CGPA 2YS9A 1X1AA 4ZDPA 3H5AA 1VTNC 2VL8A 2L02A 2W82A 1AOYA 1W7PD 4PZJA 2DW4A 1VQ7I 2LF8A 1YJNI 2BXZA 1V5FA 5DCMA 3RKYA 3RKQA 2V1NA 4LG0A 1SD6A 4H4KC 3W2WA 1VQ9I 3E97A 4HQMA 5IY5H 4HZFA 3KYLA 4A3BJ 2H6CA 2CMPA 2OQRA 3V8LA 2OBPA 1FX7A 4M74A 5GAEJ 4YIRX 4BE1A 1B59A 3QOPA 3K7AJ 4I02A 4ESFA 4OOIA 2EJRA 2P8TA 1YW7A 1PP7U 3FXKA 2EK5A 2XPVA 5FFZA 3R60A 5D4RA 2E1CA 2ME6A 4XSXF 1Z05A 3HOTA 3PFIA 4HF1A 2O5RA 3CCYA 1SVOA 3GFLA 1WQ2A 4EJUA 3HSFA 2ECCA 1I27A 1I5ZA 1KGSA 2CU7A 3TO9A 2YU9J 3LSPA 2IS6A 1QPMA 1T0FA 2BY1A 2AS5F 3A0HC 2V26A 1DU0A 2XPWA 3JREA 1YHQI 1LDKB 3A0BC 1HSJA 5KAIC 1FJLA 3DBLB 2FQ3A 1OYWA 4LITA 2XF7A 1P7IA 1DPRA 1R1UA 3CCSI 4G8XA 3F8BA 3W2VA 2H09A 2BZTA 3OYEA 3W6JB 3B73A 1IC8A 3DU6A 3W2AA 2R7TA 2FEZA 2TCTA 3HOSA 2HDDA 2EILH 2NS0A 1J0RA 4E7JA 3K1MA 1ETVA 2A5WA 3I3LA 4PSWA 5C3EJ 5EEHA 3UNGC 4ZYAA 1Z9CA 2Q2EB 1D3YA 2DYSH 1WSUA 3TKYA 4ZZLA 2LH9A 3H0GJ 5DM7F 2ZXWH 1UELB 4BJTA 2VT3A 2X51A 4XKBA 2HOEA 2GA2A 4KN7X 4PSXA 2R92J 3CC2I 2OF7A 3ZN0A 1XD7A 4HYEA 1O57A 2ZSHB 2L5QA 1HXDA 3FBIB 2KHMA 2W25A 4O3MA 4RGXA 1S7OA 3K0LA 4ZTFA 3BG6A 3BCAA 1MJBA 5M5XJ 3FMQA 2ZC2A 3HM5A 3V8JA 3S8PA 5DUKA 4R8HA 3TP3A 1I3QJ 2ZKZA 1NH3A 2ESHA 3AG4H 1Z7LA 3PL8A 1SEUA 1JUPA 2XB0X 4CZZA 2DA6A 2JWTA 3CDIA 4UB6C 3V7SA 1TWHJ 3KEQA 1EF4A 2Z33A 4YEJA 1TWCJ 3RZDJ 2CS3A 5FGMA 2PX9A 2QYOA 4J00A 4I76A 2W7NA 1AU7A 2NS7A 3H9QA 5JVTA 2RNGA 4XOPA 2D5VA 3G1LA 1LPQA 2LKSA 1H8AC 3V4GA 2K3FA 4XN3A 2M30A 4A3EJ 2VXZA 2DTZA 3DKWA 2HVRA 4M6XA 1RESA 3E6DA 4BKXA 1SFOJ 1LKXA 2O3FA 1YS7A 4P96A 5FROA 5J47A 4C2TA 5J6XA 1N78A 1JXSA 1UZCA 2FA5A 1LUJB 4MEYF 5F1JA 3OYKA 4DZPA 4XRSA 2CQNA 2Z5UA 4Z2YA 1FOXA 5M3MJ 2QWWA 5H6QA 2Q2EA 3HC7A 1JTXA 2PMZA 1IRGA 4WXCA 2XAFA 1T98A 3F21A 1QO0D 2X6OA 5GTHC 2HKXA 3G2BA 2VKDA 1QHHD 3SXYA 3HTUA 5F0CA 1K83J 1Y8QB 1B4AA 1FOYA 2JT1A 2Z2SB 4OINF 4RGSA 2F4OB 1KQ0A 3WG7H 1ZG3A 3HOUJ 1S7EA 3ERMA 3I71A 1F5TA 5LEJA 2CV1A 1CQTA 1PYVA 4OU0A 1OKRA 3ZGKA 4WCGA 2STTA 2ZNZA 5FKMA 4ZTJA 2J5OA 5BNGA 5FLXZ 3CCUI 1VNDA 1YE9A 3FISA 2DJIA 4D5CA 2G0EA 3A02A 4U88A 3PSFA 4N9IA 4Y52J 2FUG2 3G3ZA 1EH8A 2R7VA 1X19A 2O7OA 2Y48A 4E7SA 4KITB 3JAMK 2HXIA 3JAMZ 1IN8A 1RR7A 3H9JA 3HEFA 3MD2A 3NAUA 4U0VA 2XUBA 5J8CA 3CTAA 1KONA 1IGNA 2HQRA 2BVLA 1V54H 3PO3J 1XS9A 1PUEE 3BTJA 1WJDA 3J7AO 3KZIC 2D1VA 1XCVA 1VQNI 4HBLA 4OMYA 1SFEA 1U8BA 2X48A 2K4JA 4NDLA 3JRDA 2RDPA 3EPZA 3I53A 1TC3C 5D5XB 2A07F 2K3PA 3PSIA 3ABTA 2XAUA 1IF1A 2CG4A 2IA1A 2VQHA 3OYBA 5B66C 3PM1A 4DW6A 1B8IB 4UY8I 2K9SA 4HV5A 1MNDA 3SZTA 4A0YA 3FXUA 2LF7A 2Y75A 3CMEI 1PDNC 3O2PE 3NQOA 3DKYA 2DA4A 3OOUA 4XKVA 1NG7A 1APLC 4B48A 3LQQA 2HOSA 1A6QA 2DK8A 4PGGA 2XGEA 3F22A 3LFKA 2V79A 4BGDA 4UUVA 1KQ8A 3P9IA 3QYFA 1GHCA 2M8GX 5J1UA 1TNSA 1ZAOA 2ELKA 2HOAA 3CD6I 2YU3A 2GAUA 1YQAA 3NRVA 4EM0B 1QQIA 2PEXA 4C3JJ 3Q9SA 1UHSA 2DOFA 2LKPA 2X6XA 3I59B 4JOMA 1Z67A 4XLCA 3IRQA 3G73A 1K78B 1W5SA 1A31A 3GFMA 3S93A 1QGPA 5ICFA 2ZCWA 1R1TA 2BW3B 3JAMR 2WB1N 3TP0A 2GIZA 5B1BH 2ICWG 2HPIA 4JK1X 1H9GA 3EYYA 2WTEA 1YX5A 1VQPI 3BTLA 3CP8A 2D1HA 3C7JA 1IRZA 1P4WA 4HPQA 2E2JJ 4M3EA 4UVCA 5DS9A 1SVLA 3L2WA 1USTA 3EDPA 4DOZA 3C2HA 4BDZA 1NK2P 3J7AW 3A01B 3CCQI 1RI7A 2JZYA 1ON2A 3D5SC 1BC8C 2RREA 1FBQA 1UG0A 4GCVA 3S15J 1MIJA 1SFXA 5FD6A 1TP4A 1B9MA 3WGHA 1U9OA 4M9ZA 3H3VK 2XAHA 2VKEA 2DDAA 1T95A 1U0JA 5AONA 2VBYA 4N0BA 2UUZA 1R22A 3P5JA 1XN7A 3QWLA 1X1PA 2H8WA 2QKMB 1B8IA 3CJRB 2M45A 1HLVA 1SFUA 4NQWB 4KA4A 1D1AA 4B43A 2KRFA 2VKVA 2LY1A 2BE5F 2XGDA 2XIGA 1IV8A 3GFJA 3CCJI 3B02A 1LNWA 3EETA 3MKZA 1MKMA 3T0YA 4XLEA 1X58A 2E36A 5LD2C 2FBHA 5L3GA 2KZGA 1W1WE 4M9SA 5J3LA 3GLLA 1Z6RA 4ZJZA 2PJRA 1O7FA 2WV1A 2LBFB 2MLGA 4NUBA 1R4MB 2HYGD 1JKQC 1KYWA 3LSMA 2COBA 3MWMA 3I5UA 4UB8C 3SEZA 5FB2A 3NWSA 5M5YJ 1O4XA 1K78A 1K6YA 3JTGA 2Q0OA 3FXRA 5AIPA 4YFKF 2K7LA 3K4CA 2OJED 1ZREA 2BW3A 3LSGA 1A36A 3DTIA 4CYDA 1OLTA 5CPRB 1G6NA 4KUMA 1E3HA 4X6AJ 4XIDA 5DDGA 3FM5A 1PVEA 3LQRA 3PNTA 3SZGA 5JLWA 3ERED 3G1MA 3KP2A 4MFEA 3EUKL 4BU2A 2E2IJ 2DU9A 1F43A 5LRSA 5D4SA 2OD5A 1MGTA 3HOXJ 4FQGA 3TOAA 2P0TA 2R5ZB 3DLLF 5EZGA 5DYMA 3EUAA 3A01A 3GWZA 3AL0C 2RV8A 3E5QA 1LEBA 3N05A 4W1UA 1REPC 2O8KA 1J59A 3BT9A 5HDNA 4E7KA 4XN0A 2IS4A 3ELKA 2NNNA 3WTUC 4B09A 4LLNA 3I54A 1BIBA 3S3OA 1DUXC 3BZCA 3K4MA 1R58A 3S17J 1O7LA 4IO9F 1JTYA 4QWQA 1SFKA 1GT0C 1Z6TA 2HZDA 4RGUA 4AD9A 5HODA 1JKPC 3BG3A 1CGPA 3HRSA 5IP6A 2VOPA 1USSA 3RQIA 1UB9A 4NQWA 3AG1H 1MNMC 2GOMA 3JRIA 5A2QK 2VJ4A 5JR3A 2DMUA 3IH4A 1R36A 2K27A 4MFDA 5TRDA 5ILVA 5IP9J 4EMSA 2AQEA 2FBKA 2NNYA 1DPUA 4YFXF 2CUZA 1TW3A 5HS9A 2EQRA 5TJJA 4U0WA 2LBFA 4LIVA 1TW2A 2V1UA 1BOAA 2QCOA 2IVMA 2V6CA 3BR1A 2RC4A 2KZVA 4XLFA 5IT9Z 4HSTA 4IVNA 2HVQA 1ZG5A 3OY9A 4LK0F 4BEHB 1HBXG 1XMAA 5DTDA 1R49A 3DWLE 2HDWA 1YG2A 1KZHA 2WADA 2XC7A 1RR8C 2JRTA 2ZMEC 3QPTA 3PO2J 2KIFA 3CUQB 2CW0F 1IUYA 3GZ5A 5BS6A 2DAOA 1VQ5I
chains in the Genus database with same CATH topology
1T2KA 5DUIA 2DQLA 3LAPA 4AIJA 3R0AA 2X4HA 4HOBA 3ZMTA 3WTSC 5BOXA 2P5LC 3IKTA 4L18B 1U2WA 2RNJA 3JW4A 2P6SA 1U8RA 1IXRC 2HGCA 4EGZA 2IA0A 3FMRA 5FD5A 2R7FA 3GW2A 4CDGA 1RUOA 3ZP5A 2FE3A 5JFRA 4H0EA 1ZRCA 1LVAA 1S7AA 1ZRFA 4A0XA 1OYIA 4ON0A 1TQPA 3ZMUA 4KYWA 3HSRA 2FOKA 3O6BB 3HHGA 4AIKA 4I0AA 3FZVA 2YSRA 3NEUA 4IRHA 3S2WA 1TQMA 5CVVA 4L0YB 3EUHA 4UVBA 1XGOA 3BJ6A 1KA8A 3CUQA 2IA2A 1B6AA 3BPXA 1LB2A 2ZMEA 4WX9A 3KP5A 2K86A 4A5MA 1WRJA 4XSZF 2HKOA 3U1DA 1G4DA 4YIFA 2VODA 4LLGF 3GLXA 4ESJA 5LGNA 1RNLA 2HTSA 2XHKA 4HF0A 3GEZA 5JI6A 2KIMA 3FF5A 4ENJA 4R79A 4XLNF 3GX4X 4LK1F 4O5VA 2CO5A 2KJCA 3K1NA 1F9NA 1BM9A 5F6FA 1P92A 2OU2A 2YX7A 4YIIA 2DPUA 1QZYA 3TQNA 5D8LB 1KU9A 2E7WA 5BMZA 2EV5A 4EJTA 3VODA 4MTDA 5E17F 1J5YA 1U3EM 2K02A 4CXFA 1XDUA 2GA1A 3GO5A 1OPCA 2K4BA 2WC2A 1U6GA 2PQ8A 3M7GA 3WGGA 3VFZA 3BWGA 3DP7A 2M87A 2XASA 3E3VA 2CSOA 4DQ2A 4PGHA 4GXOA 1U5TC 4ENMA 1FBUA 3GF2A 3R0JA 1STZA 3QAHA 5ICGA 4IRIA 3WTWC 1KYZA 2FRHA 2P6TA 5DV5A 3T8TA 2PLYA 5HOOA 3F3XA 3DEUA 1X3UA 2PMUA 3WTVC 3CLOA 3DQVC 4L9VA 4HDVA 3J80K 2AXLA 3J80Z 2EV0A 4KFCA 3WTTC 4ZZDA 2UXNA 1D8JA 4LMYA 3QPHA 1MZBA 1YTYA 2PBIA 4CGZA 1KQ9A 2QBYB 2RKHA 4KIGA 1WKMA 5E18F 3DXJF 3I58A 4AWXB 1MDMB 4HDUA 2RN7A 1J2XA 3F8MA 4RAZA 2VC1A 1E2XA 2RGVA 3DF8A 4HW0A 2ZNYA 4I98B 1GVJA 2IW5A 2Z3YA 1ZG1A 3KZYA 4U7DA 3DPTA 4WF2A 2O6GE 2H6BA 1J9IA 4KICA 4L5JA 1SMYF 2W57A 3ULQB 1ZH5A 2R7DA 1T6SA 2ADUA 1XGSA 1S3JA 5E1WA 2DI3A 3LAJA 1A04A 4M72A 4Y15A 3V7CA 1G3YA 1ZRDA 4A5NA 1MJAA 5ICCA 1BC7C 2YR2A 5CJ9A 3D0SA 3WTXC 2QBYA 2VOOA 2HDCA 4CHUA 3KP6A 2P7CB 1MDMA 4IHSA 3OOPA 2YPRA 5K5RA 1TBXA 1NHAA 5EEGA 3ROUA 3R6SA 2EFOA 5CVRA 4RB0A 1K6OA 4G6QA 3VEPA 4PDKA 1XGNA 2MA3A 2BBYA 1U78A 2QVOA 1R00A 3TDZC 1Q1HA 2EFQA 4EQQA 2GXGA 4Y13A 3RIRA 2DT5A 5FLXK 2PFBA 3RTRA 4LD5A 1PP8F 4HX8A 2L4MA 4UV9A 1SD5A 3E5XA 1JHHA 5D8KB 3I0TA 3LA7A 4G7HF 4BHBA 2CQKA 4GGGA 1XSVA 4BAYA 1W4MA 3J81K 1FP1D 3KFWX 3J81Z 2A69F 3JSPA 3BPVA 4BH9A 5F64A 2EA4A 2FBIA 3LA3A 4L9JA 1XGMA 2H27A 2V1DA 1TQIA 1LEAA 3JTHA 5F1RA 4YG2F 4LJZF 2L4AA 3RKXA 2NAZA 1ZLJA 1EH7A 4LGWA 4NB5A 1YLFA 4EJVA 4RB3C 2R3SA 1WWXA 3P9CA 1UHWA 2KJBA 2ZXJA 2CYYA 1T38A 2YX4A 2VN2A 4G7ZF 1IN7A 4S05A 3KZZA 1RZ4A 2ISYA 4IJAA 4IHTA 1UCRA 5DD8A 2ZO4A 3E6CC 2W24A 3M9AA 1F1ZA 4HX4A 4HF2A 5D5WB 5KVRA 2HFHA 2HZTA 1OYYA 2DK5A 3C18A 3WTYC 3FM3A 5LHHA 2JPBA 1R5HA 4XRFA 3ML6A 5LGTA 3GXOA 1R1VA 5CVUA 3TGNA 4LFUA 3K1PA 2GXBA 4RB2C 4M9XA 5E8GA 5CVIA 3RJPA 4UV8A 3H3UA 3OV8A 1YW8A 5L3CA 3IWFA 4G6DA 2C6YA 4UXNA 4WWCA 1BBYA 1W7PB 3KE2A 2P4WA 4P9UA 2HYFA 3ZMDA 2EWNA 4IPAA 5LHGA 2PI0A 3WGIA 4L5IA 5D5VB 2G9WA 3HYIA 4GO1A 3L09A 4RGRA 2G7HA 4K2EA 5HS7A 1UFMA 2MH2A 2W85A 3F8NA 3GUDA 4KT5C 3ZN1A 5D6FA 2A68F 4NHJA 3Q9VA 2ZJ2A 2XRNA 2F5FA 1ODDA 3L00A 1LQ1A 4HQEA 4HLYA 4D0PA 3BY6A 2UWMA 3WODF 3ZMVA 1YO5C 2IRFG 1WI9A 2IT0A 1UHMA 5IT9K 5D5UB 4HX7A 3REOA 3SQNA 2FF4A 1R7JA 1HKSA 2XKPA 4Y17A 4ZH4F 1W7PA 3ZMSA 1KU7A 4FX0A 5HS8A 2ZMEB 4P5OA 3GVAA 4ASNA 2IP2A 1Z1DA 4P9FA 1DP7P 3CDHA 2VBXA 2VBZA 1J7KA 2D2WA 4KN4X 1CF7B 4A2UA 2A3SA 4FT8A 3F72A 3BZ6A 2EFNA 2OQGA 3E6BA 3F6VA 1IN4A 1YFHA 2BEOA 2O61A 1ZGJA 2M8EA 2P7VB 1SMTA 4KIFA 3SHFA 1Y0UA 1IN5A 2L3DA 3EYIA 3DFGA 4EJOA 2QQAA 5HDKA 1FSHA 3KLOA 2L54A 4MGRA 1FP2A 4MNUA 1BIAA 1FPQA 3D5LA 3ECHA 3JSOA 2LDUA 2F5EA 4AIHA 1JE8A 1ZYRF 4MTEA 1B1BA 4ENNA 1SD4A 4EGYA 4KIBA 5E1ZB 3T5XA 1S8NA 4L9TA 4ZYDA 2H94A 5E1XA 1C0WA 3RYRA 1FWZA 3QRFF 3K9TA 1HKQA 2E1NA 2A6HF 1R23A 2RQPA 3TOBA 2CFXA 4U7BA 1HKTA 1GXQA 3K2ZA 4JBAA 1CF7A 2QUFA 1Z7UA 2RVCA 3M8EA 4OMZA 2O8XA 2LNBA 4JQFA 1BI3A 4U0YA 4F7ZA 4FX4A 2QENA 5L3DA 3AAFA 3TO7A 2A6EF 2NYXA 3MCZA 4BHCA 3WU0A 2V9VA 3RPUA 3KP4A 4M73A 3IKVA 1FYLA 1ONVA 2XAQA 1I1SA 5CYVA 3KLNA 5BQTA 1E17A 1SD7A 2GQQA 2DFIA 1P6RA 4G94A 3KEOA 3DV8A 2XROA 2BYVE 4Q47A 1IW7F 1ZLKA 1O3TA 5HDGA 2FMYA 4EJWA 1U5TB 5K5QA 1BI2A 3M1EA 3MZYA 2ETHA 2D45A 1K7AA 1FYMA 5LRRA 1F4KA 3LA2A 1IRFA 1HW1A 3T1BA 2EFPA 1FY7A 3P9KA 1Z91A 1IZ1A 1QBJA 2WV0A 1YIOA 2M1BA 2JTVA 4WK8F 4KDPA 2ELHA 2HQNA 2QQBA 5H6RA 3C1DA 5DCFA 3CUOA 2Z99A 1I1GA 5HLGA 1T39A 1P4AA 3QU3A 3QP5A 3IRRA 2ACJA 3FWEA 2PN6A 1XSXA 4LB5A 3RKWA 2Q8KA 2MLKA 4CO8A 1U5TA 1TLHB 4BHPA 2GZWA 3N4MA 4MEXF 2KIUA 2FNPA 3BROA 3R4KA 2HR3A 5ILSA 3IL2A 2EV6A 2QZ8A 2NRAC 2QM3A 5L3EA 3R61A 2JSCA 3IC7A 3RI4A 1BJAA 3L7WA 4G7OF 4O6JA 5DEQA 3GFIA 2FSWA 2DLLA 2ZBKA 2DBBA 3FMSA 1V3FA 2FNAA 2VBWA 5AIQA 2L01A 3L9FA 4OIPF 1L3LA 4XBFA 4RS8A 2VC0A 1IAWA 2TDXA 2STWA 1MJ9A 4UHTA 3HTSB 1HQCA 1EV7A 2XAJA 1FOKA 1KU2A 2VT2A 5HVQC 1P2FA 3WE3A 1O3SA 4UVAA 4BYYA 3SFZA 2IPQX 1G3WA 3L2CA 1ZGAA 4BXUA 4IF4A 2DPDA 1BN5A 1P4XA 4AVPA 3RDIA 1K79A 2UZKA 3P7NA 1GXPA 5LBQA 4XLPF 5FO5A 4DNCA 2P5VA 1FBSA 3EQLF 3F8CA 1FLIA 2FMLA 4B8XA 3HRMA 4N9HA 3KP7A 2OAZA 3GZ6A 3CO6C 4ETSA 4UNOA 2PG4A 1ON1A 3LWFA 3DPLC 1AWCA 2GIVA 3WE2A 1OR7A 1FNNA 5BPIA 5ICEA 4EM1A 3C3WA 5LHIA 1JGSA 3COAC 4RB1A 3HHHA 1H0MA 2FU4A 1JHFA 4ZYGA 1J75A 2LSOA 4HAMA 1L0OC 4FHTA 4WXDA 3BJAA 2XAGA 2QLZA 2WWYA 4OIQF 2DQRA 3CO7C 4A6DA 4QLCU 2O0YA 4LB6B 3QU6A 2CWEA 1BI1A 1QNTA 5ERIA 1FYKA 4Q5SF 1FZPB 3RYPA 5CLSA 2MBFA 3K69A 2A5YB 4EM2A 3KP3A 4KMUX 3FX3A 1YYVA 1YW9A 2HTJA 2KKOA 5HLIA 3FHZA 5ED4A 1LJ9A 1HW2A 3T8RA 2DTRA 1S6LA 3V7RA 2PMHA 2VONA 2OZUA 2Z9OA 5E8IA 3V8KA 6PAXA 1H9TA 3U2RA 4KNYA 3PQJA 3PQKA 2F5CA 5ILUA 4WXHA 3BDDA 3BOQA 2MD5A 4RAYA 2HS5A 4I7HA 4PCQA 3MZHA 5K5OA 1S29A 3WU1B 2E7XA 4ENKA 3I59A 3MEXA 1HW5A 5LLQA 5K1YA 4BQAA 4I0BA 5L3FA 2HEOA 1XCBA 4I2OA 3WTZA 4IRGA 3TDUC 3HUGA 1RUNA 5JHUA 3IWZA 1IXSB 1EH6A 2VE8A 2A61A 3GYHX 3M8FA 3F23A 4MQ9F 2G7UA 3ISPA 5E20A 5LEKA 3U9GA 2OZ6A 1ZARA 1HSTA 1TNTA 2M5WA 3W6KB 2HWVA 5HLHA 1OMIA 1D5VA 1KU3A 1O3RA 2JPCA 1XSDA 1FC3A 3HIFA 5A2QZ 1FT9A 2F2EA 3I4PA 3N97A 2VE9A 1QZZA 4Q4ZF 3HRTA 3CJNA 3ZPLA 2O03A 2XKOA 1YS6A 2IJLA 5D6EA 3CUQC 5BPDA 2QQ9A 2GWRA 4TV7A 4Q48A 4OIRF 4E70A 3IHUA 5DD4A 4GYGA 2X0LA 3MQ0A 4G9YA 5LGUA 3TO6A 4LLLA 3MFKA 4GYIA 2BGCA 4CICA 3QP6A 2ESNA 4A0ZA 5IT3A 4A12A 3H92A 1ZHFA 2EA2A 2J5PA 2EFWA 4EV0A 1D8KA 4ZYEA 3F6OA 3Q5FA 3WG9A 2ZFWA 3I64A 4HV6A 3VB2A 2XGXA 4A6EA 4ZYHA 4L0ZB 5L3BA 1IXCA 4I09A 2PJPA 4HA8A 3HSEA 4HLXA 4KMFA 4M71A 2UXXA 3VOEA 1XMKA 1DDNA 1FSEA 2F5DA 2ISZA 3H3ZA 2Y0MA 4R1HA 1RIOH 2DO7A 1V4RA 2W84A 3KETA 3E6MA 4L9NA 1XB4A 1TTYA 4I01A 5DCMB 2XV4S 4LG0B 2COMA 3ZQ7A 1ZN2A 2P5KA 4BNCA 4EVIA 2MH9A 3MAJA 1ULYA 3O3KA 2OA4A 3LSTA 3ZMZA 3FXQA 1G3SA 4MQVA 3HRUA 2V1XA 2MC3A 4YFNF 1SAXA 3E5UA 1LDJA 2FXAA 3ECOA 3KCCA 2B0LA 1XDSA 4MHGA 3BP8A 5CVJA 2EB7A 1LDDA 3ABUA 5H20A 1BI0A 3BJOA 4S04A 5J8FA 5KK1A 3SZPA 1G3TA 1IN6A 4IXAA 3F8FA 1B9NA 3RPQA 2XVCA 1MD0A 5FFXA 4P55A 2BV6A 4M6YA 1I6XA 4ESBA 1O3QA 1R5GA 1W5TA 2CGPA 1VTNC 2L02A 1AOYA 1W7PD 4PZJA 2DW4A 2LF8A 5DCMA 3RKYA 4LG0A 1SD6A 3E97A 4HQMA 4HZFA 2H6CA 3V8LA 2OQRA 2OBPA 1FX7A 4M74A 1B59A 3QOPA 4I02A 4ESFA 4OOIA 2EJRA 2P8TA 1YW7A 1PP7U 5FFZA 2EK5A 3R60A 5D4RA 2E1CA 4XSXF 1Z05A 3HOTA 3PFIA 4HF1A 3GFLA 1WQ2A 4EJUA 3HSFA 1I27A 1I5ZA 1KGSA 3TO9A 1QPMA 1T0FA 2AS5F 1LDKB 1HSJA 2FQ3A 1OYWA 1DPRA 1R1UA 4G8XA 3F8BA 2H09A 3W6JB 3B73A 2FEZA 3HOSA 2NS0A 1J0RA 3K1MA 5EEHA 1Z9CA 1D3YA 1WSUA 3TKYA 4ZZLA 2VT3A 2HOEA 2GA2A 4KN7X 3ZN0A 1XD7A 4HYEA 1O57A 1HXDA 2W25A 4O3MA 4RGXA 1S7OA 3K0LA 1MJBA 3FMQA 3V8JA 5DUKA 4R8HA 2ZKZA 2ESHA 4CZZA 3V7SA 3KEQA 2Z33A 5FGMA 2QYOA 5JVTA 3V4GA 2M30A 2VXZA 3DKWA 4M6XA 3E6DA 2O3FA 1YS7A 4P96A 5J6XA 1JXSA 2FA5A 4MEYF 2Z5UA 4Z2YA 2QWWA 5H6QA 2Q2EA 1IRGA 4WXCA 2XAFA 1T98A 3F21A 1QO0D 2HKXA 3SXYA 3HTUA 1B4AA 2JT1A 4OINF 4RGSA 1KQ0A 1ZG3A 3I71A 1F5TA 5LEJA 4OU0A 1OKRA 4WCGA 2STTA 2ZNZA 2J5OA 5FLXZ 4U88A 4N9IA 3G3ZA 1EH8A 2Y48A 3JAMK 3JAMZ 1IN8A 4U0VA 2XUBA 5J8CA 3CTAA 2HQRA 1PUEE 3J7AO 2D1VA 1XCVA 4HBLA 4OMYA 1SFEA 2K4JA 2RDPA 3I53A 5D5XB 2A07F 3ABTA 1IF1A 2CG4A 2IA1A 4HV5A 4A0YA 3SZTA 3FXUA 2LF7A 2Y75A 1PDNC 3O2PE 3NQOA 3LQQA 2DK8A 4PGGA 3F22A 3LFKA 2V79A 4UUVA 1KQ8A 3P9IA 1GHCA 1TNSA 1ZAOA 2YU3A 2GAUA 1YQAA 3NRVA 4EM0B 1QQIA 2PEXA 3Q9SA 3I59B 2LKPA 1K78B 3IRQA 3G73A 1W5SA 3GFMA 1QGPA 5ICFA 2ZCWA 1R1TA 4JK1X 1H9GA 3EYYA 2WTEA 2D1HA 3C7JA 1P4WA 4UVCA 1USTA 3EDPA 1RI7A 2JZYA 1ON2A 1BC8C 1FBQA 4GCVA 1SFXA 5FD6A 1B9MA 3WGHA 4M9ZA 2XAHA 5AONA 2VBYA 4N0BA 1R22A 1XN7A 2M45A 1SFUA 4KA4A 2KRFA 2BE5F 2XIGA 3GFJA 3B02A 1LNWA 3EETA 1MKMA 3T0YA 2FBHA 5L3GA 4M9SA 1Z6RA 1O7FA 2MLGA 2HYGD 1KYWA 3MWMA 3I5UA 5FB2A 1K78A 3JTGA 2Q0OA 3FXRA 5AIPA 4YFKF 2K7LA 1ZREA 4CYDA 1G6NA 4KUMA 5DDGA 3FM5A 3LQRA 3ERED 3KP2A 2DU9A 5LRSA 5D4SA 2OD5A 1MGTA 3TOAA 5DYMA 3GWZA 2RV8A 3E5QA 1LEBA 1REPC 1J59A 5HDNA 3ELKA 2NNNA 3WTUC 4B09A 4LLNA 3I54A 1BIBA 1DUXC 1R58A 1O7LA 4QWQA 1Z6TA 4RGUA 4AD9A 1CGPA 3HRSA 2VOPA 1USSA 1UB9A 4NQWA 5A2QK 5JR3A 1R36A 2K27A 5TRDA 5ILVA 4EMSA 2FBKA 2NNYA 1DPUA 4YFXF 1TW3A 5HS9A 5TJJA 4U0WA 1TW2A 2V1UA 1BOAA 2IVMA 2V6CA 2RC4A 5IT9Z 4IVNA 1ZG5A 4LK0F 1HBXG 1XMAA 1YG2A 2JRTA 3QPTA 2KIFA 3CUQB 2CW0F 1IUYA 3GZ5A 5BS6A 2DAOA 4OIOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K A;  5DUI A;  2DQL A;  3LAP A;  4AIJ A;  3R0A A;  2X4H A;  4HOB A;  3ZMT A;  3WTS C;  5BOX A;  2P5L C;  3IKT A;  4L18 B;  1U2W A;  2RNJ A;  3JW4 A;  2P6S A;  1U8R A;  1IXR C;  2HGC A;  4EGZ A;  2IA0 A;  3FMR A;  5FD5 A;  2R7F A;  3GW2 A;  4CDG A;  1RUO A;  3ZP5 A;  2FE3 A;  5JFR A;  4H0E A;  1ZRC A;  1LVA A;  1S7A A;  1ZRF A;  4A0X A;  1OYI A;  4ON0 A;  1TQP A;  3ZMU A;  4KYW A;  3HSR A;  2FOK A;  3O6B B;  3HHG A;  4AIK A;  4I0A A;  3FZV A;  2YSR A;  3NEU A;  4IRH A;  3S2W A;  1TQM A;  5CVV A;  4L0Y B;  3EUH A;  4UVB A;  1XGO A;  3BJ6 A;  1KA8 A;  3CUQ A;  2IA2 A;  1B6A A;  3BPX A;  1LB2 A;  2ZME A;  4WX9 A;  3KP5 A;  2K86 A;  4A5M A;  1WRJ A;  4XSZ F;  2HKO A;  3U1D A;  1G4D A;  4YIF A;  2VOD A;  4LLG F;  3GLX A;  4ESJ A;  5LGN A;  1RNL A;  2HTS A;  2XHK A;  4HF0 A;  3GEZ A;  5JI6 A;  2KIM A;  3FF5 A;  4ENJ A;  4R79 A;  4XLN F;  3GX4 X;  4LK1 F;  4O5V A;  2CO5 A;  2KJC A;  3K1N A;  1F9N A;  1BM9 A;  5F6F A;  1P92 A;  2OU2 A;  2YX7 A;  4YII A;  2DPU A;  1QZY A;  3TQN A;  5D8L B;  1KU9 A;  2E7W A;  5BMZ A;  2EV5 A;  4EJT A;  3VOD A;  4MTD A;  5E17 F;  1J5Y A;  1U3E M;  2K02 A;  4CXF A;  1XDU A;  2GA1 A;  3GO5 A;  1OPC A;  2K4B A;  2WC2 A;  1U6G A;  2PQ8 A;  3M7G A;  3WGG A;  3VFZ A;  3BWG A;  3DP7 A;  2M87 A;  2XAS A;  3E3V A;  2CSO A;  4DQ2 A;  4PGH A;  4GXO A;  1U5T C;  4ENM A;  1FBU A;  3GF2 A;  3R0J A;  1STZ A;  3QAH A;  5ICG A;  4IRI A;  3WTW C;  1KYZ A;  2FRH A;  2P6T A;  5DV5 A;  3T8T A;  2PLY A;  5HOO A;  3F3X A;  3DEU A;  1X3U A;  2PMU A;  3WTV C;  3CLO A;  3DQV C;  4L9V A;  4HDV A;  3J80 K;  2AXL A;  3J80 Z;  2EV0 A;  4KFC A;  3WTT C;  4ZZD A;  2UXN A;  1D8J A;  4LMY A;  3QPH A;  1MZB A;  1YTY A;  2PBI A;  4CGZ A;  1KQ9 A;  2QBY B;  2RKH A;  4KIG A;  1WKM A;  5E18 F;  3DXJ F;  3I58 A;  4AWX B;  1MDM B;  4HDU A;  2RN7 A;  1J2X A;  3F8M A;  4RAZ A;  2VC1 A;  1E2X A;  2RGV A;  3DF8 A;  4HW0 A;  2ZNY A;  4I98 B;  1GVJ A;  2IW5 A;  2Z3Y A;  1ZG1 A;  3KZY A;  4U7D A;  3DPT A;  4WF2 A;  2O6G E;  2H6B A;  1J9I A;  4KIC A;  4L5J A;  1SMY F;  2W57 A;  3ULQ B;  1ZH5 A;  2R7D A;  1T6S A;  2ADU A;  1XGS A;  1S3J A;  5E1W A;  2DI3 A;  3LAJ A;  1A04 A;  4M72 A;  4Y15 A;  3V7C A;  1G3Y A;  1ZRD A;  4A5N A;  1MJA A;  5ICC A;  1BC7 C;  2YR2 A;  5CJ9 A;  3D0S A;  3WTX C;  2QBY A;  2VOO A;  2HDC A;  4CHU A;  3KP6 A;  2P7C B;  1MDM A;  4IHS A;  3OOP A;  2YPR A;  5K5R A;  1TBX A;  1NHA A;  5EEG A;  3ROU A;  3R6S A;  2EFO A;  5CVR A;  4RB0 A;  1K6O A;  4G6Q A;  3VEP A;  4PDK A;  1XGN A;  2MA3 A;  2BBY A;  1U78 A;  2QVO A;  1R00 A;  3TDZ C;  1Q1H A;  2EFQ A;  4EQQ A;  2GXG A;  4Y13 A;  3RIR A;  2DT5 A;  5FLX K;  2PFB A;  3RTR A;  4LD5 A;  1PP8 F;  4HX8 A;  2L4M A;  4UV9 A;  1SD5 A;  3E5X A;  1JHH A;  5D8K B;  3I0T A;  3LA7 A;  4G7H F;  4BHB A;  2CQK A;  4GGG A;  1XSV A;  4BAY A;  1W4M A;  3J81 K;  1FP1 D;  3KFW X;  3J81 Z;  2A69 F;  3JSP A;  3BPV A;  4BH9 A;  5F64 A;  2EA4 A;  2FBI A;  3LA3 A;  4L9J A;  1XGM A;  2H27 A;  2V1D A;  1TQI A;  1LEA A;  3JTH A;  5F1R A;  4YG2 F;  4LJZ F;  2L4A A;  3RKX A;  2NAZ A;  1ZLJ A;  1EH7 A;  4LGW A;  4NB5 A;  1YLF A;  4EJV A;  4RB3 C;  2R3S A;  1WWX A;  3P9C A;  1UHW A;  2KJB A;  2ZXJ A;  2CYY A;  1T38 A;  2YX4 A;  2VN2 A;  4G7Z F;  1IN7 A;  4S05 A;  3KZZ A;  1RZ4 A;  2ISY A;  4IJA A;  4IHT A;  1UCR A;  5DD8 A;  2ZO4 A;  3E6C C;  2W24 A;  3M9A A;  1F1Z A;  4HX4 A;  4HF2 A;  5D5W B;  5KVR A;  2HFH A;  2HZT A;  1OYY A;  2DK5 A;  3C18 A;  3WTY C;  3FM3 A;  5LHH A;  2JPB A;  1R5H A;  4XRF A;  3ML6 A;  5LGT A;  3GXO A;  1R1V A;  5CVU A;  3TGN A;  4LFU A;  3K1P A;  2GXB A;  4RB2 C;  4M9X A;  5E8G A;  5CVI A;  3RJP A;  4UV8 A;  3H3U A;  3OV8 A;  1YW8 A;  5L3C A;  3IWF A;  4G6D A;  2C6Y A;  4UXN A;  4WWC A;  1BBY A;  1W7P B;  3KE2 A;  2P4W A;  4P9U A;  2HYF A;  3ZMD A;  2EWN A;  4IPA A;  5LHG A;  2PI0 A;  3WGI A;  4L5I A;  5D5V B;  2G9W A;  3HYI A;  4GO1 A;  3L09 A;  4RGR A;  2G7H A;  4K2E A;  5HS7 A;  1UFM A;  2MH2 A;  2W85 A;  3F8N A;  3GUD A;  4KT5 C;  3ZN1 A;  5D6F A;  2A68 F;  4NHJ A;  3Q9V A;  2ZJ2 A;  2XRN A;  2F5F A;  1ODD A;  3L00 A;  1LQ1 A;  4HQE A;  4HLY A;  4D0P A;  3BY6 A;  2UWM A;  3WOD F;  3ZMV A;  1YO5 C;  2IRF G;  1WI9 A;  2IT0 A;  1UHM A;  5IT9 K;  5D5U B;  4HX7 A;  3REO A;  3SQN A;  2FF4 A;  1R7J A;  1HKS A;  2XKP A;  4Y17 A;  4ZH4 F;  1W7P A;  3ZMS A;  1KU7 A;  4FX0 A;  5HS8 A;  2ZME B;  4P5O A;  3GVA A;  4ASN A;  2IP2 A;  1Z1D A;  4P9F A;  1DP7 P;  3CDH A;  2VBX A;  2VBZ A;  1J7K A;  2D2W A;  4KN4 X;  1CF7 B;  4A2U A;  2A3S A;  4FT8 A;  3F72 A;  3BZ6 A;  2EFN A;  2OQG A;  3E6B A;  3F6V A;  1IN4 A;  1YFH A;  2BEO A;  2O61 A;  1ZGJ A;  2M8E A;  2P7V B;  1SMT A;  4KIF A;  3SHF A;  1Y0U A;  1IN5 A;  2L3D A;  3EYI A;  3DFG A;  4EJO A;  2QQA A;  5HDK A;  1FSH A;  3KLO A;  2L54 A;  4MGR A;  1FP2 A;  4MNU A;  1BIA A;  1FPQ A;  3D5L A;  3ECH A;  3JSO A;  2LDU A;  2F5E A;  4AIH A;  1JE8 A;  1ZYR F;  4MTE A;  1B1B A;  4ENN A;  1SD4 A;  4EGY A;  4KIB A;  5E1Z B;  3T5X A;  1S8N A;  4L9T A;  4ZYD A;  2H94 A;  5E1X A;  1C0W A;  3RYR A;  1FWZ A;  3QRF F;  3K9T A;  1HKQ A;  2E1N A;  2A6H F;  1R23 A;  2RQP A;  3TOB A;  2CFX A;  4U7B A;  1HKT A;  1GXQ A;  3K2Z A;  4JBA A;  1CF7 A;  2QUF A;  1Z7U A;  2RVC A;  3M8E A;  4OMZ A;  2O8X A;  2LNB A;  4JQF A;  1BI3 A;  4U0Y A;  4F7Z A;  4FX4 A;  2QEN A;  5L3D A;  3AAF A;  3TO7 A;  2A6E F;  2NYX A;  3MCZ A;  4BHC A;  3WU0 A;  2V9V A;  3RPU A;  3KP4 A;  4M73 A;  3IKV A;  1FYL A;  1ONV A;  2XAQ A;  1I1S A;  5CYV A;  3KLN A;  5BQT A;  1E17 A;  1SD7 A;  2GQQ A;  2DFI A;  1P6R A;  4G94 A;  3KEO A;  3DV8 A;  2XRO A;  2BYV E;  4Q47 A;  1IW7 F;  1ZLK A;  1O3T A;  5HDG A;  2FMY A;  4EJW A;  1U5T B;  5K5Q A;  1BI2 A;  3M1E A;  3MZY A;  2ETH A;  2D45 A;  1K7A A;  1FYM A;  5LRR A;  1F4K A;  3LA2 A;  1IRF A;  1HW1 A;  3T1B A;  2EFP A;  1FY7 A;  3P9K A;  1Z91 A;  1IZ1 A;  1QBJ A;  2WV0 A;  1YIO A;  2M1B A;  2JTV A;  4WK8 F;  4KDP A;  2ELH A;  2HQN A;  2QQB A;  5H6R A;  3C1D A;  5DCF A;  3CUO A;  2Z99 A;  1I1G A;  5HLG A;  1T39 A;  1P4A A;  3QU3 A;  3QP5 A;  3IRR A;  2ACJ A;  3FWE A;  2PN6 A;  1XSX A;  4LB5 A;  3RKW A;  2Q8K A;  2MLK A;  4CO8 A;  1U5T A;  1TLH B;  4BHP A;  2GZW A;  3N4M A;  4MEX F;  2KIU A;  2FNP A;  3BRO A;  3R4K A;  2HR3 A;  5ILS A;  3IL2 A;  2EV6 A;  2QZ8 A;  2NRA C;  2QM3 A;  5L3E A;  3R61 A;  2JSC A;  3IC7 A;  3RI4 A;  1BJA A;  3L7W A;  4G7O F;  4O6J A;  5DEQ A;  3GFI A;  2FSW A;  2DLL A;  2ZBK A;  2DBB A;  3FMS A;  1V3F A;  2FNA A;  2VBW A;  5AIQ A;  2L01 A;  3L9F A;  4OIP F;  1L3L A;  4XBF A;  4RS8 A;  2VC0 A;  1IAW A;  2TDX A;  2STW A;  1MJ9 A;  4UHT A;  3HTS B;  1HQC A;  1EV7 A;  2XAJ A;  1FOK A;  1KU2 A;  2VT2 A;  5HVQ C;  1P2F A;  3WE3 A;  1O3S A;  4UVA A;  4BYY A;  3SFZ A;  2IPQ X;  1G3W A;  3L2C A;  1ZGA A;  4BXU A;  4IF4 A;  2DPD A;  1BN5 A;  1P4X A;  4AVP A;  3RDI A;  1K79 A;  2UZK A;  3P7N A;  1GXP A;  5LBQ A;  4XLP F;  5FO5 A;  4DNC A;  2P5V A;  1FBS A;  3EQL F;  3F8C A;  1FLI A;  2FML A;  4B8X A;  3HRM A;  4N9H A;  3KP7 A;  2OAZ A;  3GZ6 A;  3CO6 C;  4ETS A;  4UNO A;  2PG4 A;  1ON1 A;  3LWF A;  3DPL C;  1AWC A;  2GIV A;  3WE2 A;  1OR7 A;  1FNN A;  5BPI A;  5ICE A;  4EM1 A;  3C3W A;  5LHI A;  1JGS A;  3COA C;  4RB1 A;  3HHH A;  1H0M A;  2FU4 A;  1JHF A;  4ZYG A;  1J75 A;  2LSO A;  4HAM A;  1L0O C;  4FHT A;  4WXD A;  3BJA A;  2XAG A;  2QLZ A;  2WWY A;  4OIQ F;  2DQR A;  3CO7 C;  4A6D A;  4QLC U;  2O0Y A;  4LB6 B;  3QU6 A;  2CWE A;  1BI1 A;  1QNT A;  5ERI A;  1FYK A;  4Q5S F;  1FZP B;  3RYP A;  5CLS A;  2MBF A;  3K69 A;  2A5Y B;  4EM2 A;  3KP3 A;  4KMU X;  3FX3 A;  1YYV A;  1YW9 A;  2HTJ A;  2KKO A;  5HLI A;  3FHZ A;  5ED4 A;  1LJ9 A;  1HW2 A;  3T8R A;  2DTR A;  1S6L A;  3V7R A;  2PMH A;  2VON A;  2OZU A;  2Z9O A;  5E8I A;  3V8K A;  6PAX A;  1H9T A;  3U2R A;  4KNY A;  3PQJ A;  3PQK A;  2F5C A;  5ILU A;  4WXH A;  3BDD A;  3BOQ A;  2MD5 A;  4RAY A;  2HS5 A;  4I7H A;  4PCQ A;  3MZH A;  5K5O A;  1S29 A;  3WU1 B;  2E7X A;  4ENK A;  3I59 A;  3MEX A;  1HW5 A;  5LLQ A;  5K1Y A;  4BQA A;  4I0B A;  5L3F A;  2HEO A;  1XCB A;  4I2O A;  3WTZ A;  4IRG A;  3TDU C;  3HUG A;  1RUN A;  5JHU A;  3IWZ A;  1IXS B;  1EH6 A;  2VE8 A;  2A61 A;  3GYH X;  3M8F A;  3F23 A;  4MQ9 F;  2G7U A;  3ISP A;  5E20 A;  5LEK A;  3U9G A;  2OZ6 A;  1ZAR A;  1HST A;  1TNT A;  2M5W A;  3W6K B;  2HWV A;  5HLH A;  1OMI A;  1D5V A;  1KU3 A;  1O3R A;  2JPC A;  1XSD A;  1FC3 A;  3HIF A;  5A2Q Z;  1FT9 A;  2F2E A;  3I4P A;  3N97 A;  2VE9 A;  1QZZ A;  4Q4Z F;  3HRT A;  3CJN A;  3ZPL A;  2O03 A;  2XKO A;  1YS6 A;  2IJL A;  5D6E A;  3CUQ C;  5BPD A;  2QQ9 A;  2GWR A;  4TV7 A;  4Q48 A;  4OIR F;  4E70 A;  3IHU A;  5DD4 A;  4GYG A;  2X0L A;  3MQ0 A;  4G9Y A;  5LGU A;  3TO6 A;  4LLL A;  3MFK A;  4GYI A;  2BGC A;  4CIC A;  3QP6 A;  2ESN A;  4A0Z A;  5IT3 A;  4A12 A;  3H92 A;  1ZHF A;  2EA2 A;  2J5P A;  2EFW A;  4EV0 A;  1D8K A;  4ZYE A;  3F6O A;  3Q5F A;  3WG9 A;  2ZFW A;  3I64 A;  4HV6 A;  3VB2 A;  2XGX A;  4A6E A;  4ZYH A;  4L0Z B;  5L3B A;  1IXC A;  4I09 A;  2PJP A;  4HA8 A;  3HSE A;  4HLX A;  4KMF A;  4M71 A;  2UXX A;  3VOE A;  1XMK A;  1DDN A;  1FSE A;  2F5D A;  2ISZ A;  3H3Z A;  2Y0M A;  4R1H A;  1RIO H;  2DO7 A;  1V4R A;  2W84 A;  3KET A;  3E6M A;  4L9N A;  1XB4 A;  1TTY A;  4I01 A;  5DCM B;  2XV4 S;  4LG0 B;  2COM A;  3ZQ7 A;  1ZN2 A;  2P5K A;  4BNC A;  4EVI A;  2MH9 A;  3MAJ A;  1ULY A;  3O3K A;  2OA4 A;  3LST A;  3ZMZ A;  3FXQ A;  1G3S A;  4MQV A;  3HRU A;  2V1X A;  2MC3 A;  4YFN F;  1SAX A;  3E5U A;  1LDJ A;  2FXA A;  3ECO A;  3KCC A;  2B0L A;  1XDS A;  4MHG A;  3BP8 A;  5CVJ A;  2EB7 A;  1LDD A;  3ABU A;  5H20 A;  1BI0 A;  3BJO A;  4S04 A;  5J8F A;  5KK1 A;  3SZP A;  1G3T A;  1IN6 A;  4IXA A;  3F8F A;  1B9N A;  3RPQ A;  2XVC A;  1MD0 A;  5FFX A;  4P55 A;  2BV6 A;  4M6Y A;  1I6X A;  4ESB A;  1O3Q A;  1R5G A;  1W5T A;  2CGP A;  1VTN C;  2L02 A;  1AOY A;  1W7P D;  4PZJ A;  2DW4 A;  2LF8 A;  5DCM A;  3RKY A;  4LG0 A;  1SD6 A;  3E97 A;  4HQM A;  4HZF A;  2H6C A;  3V8L A;  2OQR A;  2OBP A;  1FX7 A;  4M74 A;  1B59 A;  3QOP A;  4I02 A;  4ESF A;  4OOI A;  2EJR A;  2P8T A;  1YW7 A;  1PP7 U;  5FFZ A;  2EK5 A;  3R60 A;  5D4R A;  2E1C A;  4XSX F;  1Z05 A;  3HOT A;  3PFI A;  4HF1 A;  3GFL A;  1WQ2 A;  4EJU A;  3HSF A;  1I27 A;  1I5Z A;  1KGS A;  3TO9 A;  1QPM A;  1T0F A;  2AS5 F;  1LDK B;  1HSJ A;  2FQ3 A;  1OYW A;  1DPR A;  1R1U A;  4G8X A;  3F8B A;  2H09 A;  3W6J B;  3B73 A;  2FEZ A;  3HOS A;  2NS0 A;  1J0R A;  3K1M A;  5EEH A;  1Z9C A;  1D3Y A;  1WSU A;  3TKY A;  4ZZL A;  2VT3 A;  2HOE A;  2GA2 A;  4KN7 X;  3ZN0 A;  1XD7 A;  4HYE A;  1O57 A;  1HXD A;  2W25 A;  4O3M A;  4RGX A;  1S7O A;  3K0L A;  1MJB A;  3FMQ A;  3V8J A;  5DUK A;  4R8H A;  2ZKZ A;  2ESH A;  4CZZ A;  3V7S A;  3KEQ A;  2Z33 A;  5FGM A;  2QYO A;  5JVT A;  3V4G A;  2M30 A;  2VXZ A;  3DKW A;  4M6X A;  3E6D A;  2O3F A;  1YS7 A;  4P96 A;  5J6X A;  1JXS A;  2FA5 A;  4MEY F;  2Z5U A;  4Z2Y A;  2QWW A;  5H6Q A;  2Q2E A;  1IRG A;  4WXC A;  2XAF A;  1T98 A;  3F21 A;  1QO0 D;  2HKX A;  3SXY A;  3HTU A;  1B4A A;  2JT1 A;  4OIN F;  4RGS A;  1KQ0 A;  1ZG3 A;  3I71 A;  1F5T A;  5LEJ A;  4OU0 A;  1OKR A;  4WCG A;  2STT A;  2ZNZ A;  2J5O A;  5FLX Z;  4U88 A;  4N9I A;  3G3Z A;  1EH8 A;  2Y48 A;  3JAM K;  3JAM Z;  1IN8 A;  4U0V A;  2XUB A;  5J8C A;  3CTA A;  2HQR A;  1PUE E;  3J7A O;  2D1V A;  1XCV A;  4HBL A;  4OMY A;  1SFE A;  2K4J A;  2RDP A;  3I53 A;  5D5X B;  2A07 F;  3ABT A;  1IF1 A;  2CG4 A;  2IA1 A;  4HV5 A;  4A0Y A;  3SZT A;  3FXU A;  2LF7 A;  2Y75 A;  1PDN C;  3O2P E;  3NQO A;  3LQQ A;  2DK8 A;  4PGG A;  3F22 A;  3LFK A;  2V79 A;  4UUV A;  1KQ8 A;  3P9I A;  1GHC A;  1TNS A;  1ZAO A;  2YU3 A;  2GAU A;  1YQA A;  3NRV A;  4EM0 B;  1QQI A;  2PEX A;  3Q9S A;  3I59 B;  2LKP A;  1K78 B;  3IRQ A;  3G73 A;  1W5S A;  3GFM A;  1QGP A;  5ICF A;  2ZCW A;  1R1T A;  4JK1 X;  1H9G A;  3EYY A;  2WTE A;  2D1H A;  3C7J A;  1P4W A;  4UVC A;  1UST A;  3EDP A;  1RI7 A;  2JZY A;  1ON2 A;  1BC8 C;  1FBQ A;  4GCV A;  1SFX A;  5FD6 A;  1B9M A;  3WGH A;  4M9Z A;  2XAH A;  5AON A;  2VBY A;  4N0B A;  1R22 A;  1XN7 A;  2M45 A;  1SFU A;  4KA4 A;  2KRF A;  2BE5 F;  2XIG A;  3GFJ A;  3B02 A;  1LNW A;  3EET A;  1MKM A;  3T0Y A;  2FBH A;  5L3G A;  4M9S A;  1Z6R A;  1O7F A;  2MLG A;  2HYG D;  1KYW A;  3MWM A;  3I5U A;  5FB2 A;  1K78 A;  3JTG A;  2Q0O A;  3FXR A;  5AIP A;  4YFK F;  2K7L A;  1ZRE A;  4CYD A;  1G6N A;  4KUM A;  5DDG A;  3FM5 A;  3LQR A;  3ERE D;  3KP2 A;  2DU9 A;  5LRS A;  5D4S A;  2OD5 A;  1MGT A;  3TOA A;  5DYM A;  3GWZ A;  2RV8 A;  3E5Q A;  1LEB A;  1REP C;  1J59 A;  5HDN A;  3ELK A;  2NNN A;  3WTU C;  4B09 A;  4LLN A;  3I54 A;  1BIB A;  1DUX C;  1R58 A;  1O7L A;  4QWQ A;  1Z6T A;  4RGU A;  4AD9 A;  1CGP A;  3HRS A;  2VOP A;  1USS A;  1UB9 A;  4NQW A;  5A2Q K;  5JR3 A;  1R36 A;  2K27 A;  5TRD A;  5ILV A;  4EMS A;  2FBK A;  2NNY A;  1DPU A;  4YFX F;  1TW3 A;  5HS9 A;  5TJJ A;  4U0W A;  1TW2 A;  2V1U A;  1BOA A;  2IVM A;  2V6C A;  2RC4 A;  5IT9 Z;  4IVN A;  1ZG5 A;  4LK0 F;  1HBX G;  1XMA A;  1YG2 A;  2JRT A;  3QPT A;  2KIF A;  3CUQ B;  2CW0 F;  1IUY A;  3GZ5 A;  5BS6 A;  2DAO A;  4OIO F; 
#chains in the Genus database with same CATH topology
 3F9K A;  1T2K A;  3LSI A;  5DUI A;  2KMU A;  3BLY A;  1GV5 A;  4DYC A;  2DQL A;  3KYD B;  2HVS A;  3LAP A;  3H9G A;  1IDZ A;  4OWR B;  2LR8 A;  2LFB A;  4AIJ A;  3R0A A;  2GLO A;  2X4H A;  4HOB A;  1ZGW A;  3ZMT A;  3ZQG A;  4OAZ A;  3WTS C;  5BOX A;  2P5L C;  3IKT A;  4X1E A;  1D0X A;  4L18 B;  1U2W A;  2RNJ A;  3JW4 A;  2P6S A;  3MKW B;  2E34 A;  3TMO A;  4A3I J;  1U8R A;  5A2Q R;  1IXR C;  2HGC A;  4EGZ A;  2IA0 A;  2YUS A;  2R4G A;  3BZK A;  3FMR A;  3TL4 X;  4JP0 A;  3BR6 A;  3K4L A;  5FD5 A;  2R7F A;  3GW2 A;  3HJE A;  4CDG A;  1RUO A;  3ZP5 A;  2FE3 A;  5JFR A;  3DCF A;  4H0E A;  1ZRC A;  1LVA A;  4C30 A;  1S7A A;  4ANJ A;  3M4O J;  1EA3 A;  4W97 A;  2ELJ A;  1ZRF A;  3BR2 A;  5TGT A;  2EZI A;  5IT9 R;  4A0X A;  1OYI A;  2VB6 A;  3FKJ A;  1Z0X A;  4ON0 A;  3G6E I;  1ZQ3 P;  1TQP A;  1W36 D;  2F4M B;  3ZMU A;  1PUF A;  4KYW A;  3HSR A;  1FEX A;  2FOK A;  3O6B B;  3HHG A;  4AIK A;  2CW7 A;  2JRM A;  4I0A A;  3FZV A;  2NVT J;  2YSR A;  4XKC A;  1BW5 A;  2LD5 A;  1WHU A;  1D0Y A;  3NEU A;  3MVP A;  4IRH A;  3S2W A;  4BEH A;  1LVK A;  3LFU A;  1TQM A;  5CVV A;  5FKK A;  1MBJ A;  3KYC B;  1VF9 A;  4L0Y B;  2DCE A;  1I6H J;  3EUH A;  1Y1W J;  5E3L A;  1ITY A;  4UVB A;  2RAE A;  1XGO A;  2QKL B;  2M7B A;  1KA8 A;  3BJ6 A;  5B1A H;  2I10 A;  3CUQ A;  5J1R A;  1WJE A;  2IA2 A;  1B6A A;  3BPX A;  5GAG J;  3CMY A;  2LLK A;  1LB2 A;  2ZME A;  4A3G J;  4WX9 A;  3QYB A;  3KP5 A;  2K86 A;  1DU6 A;  2NOG A;  4A5M A;  1WRJ A;  5EG0 B;  4XSZ F;  2HKO A;  3U1D A;  1H88 C;  1G4D A;  4YIF A;  5LFA A;  2VOD A;  2QF7 A;  4E7H A;  4LLG F;  3GLX A;  1N77 A;  4ESJ A;  4AVZ A;  5LGN A;  1RNL A;  2BHY A;  3OYF A;  2HTS A;  2XHK A;  4HF0 A;  3GEZ A;  5JI6 A;  2KIM A;  3FF5 A;  3L2U A;  4ENJ A;  3H5R A;  4R79 A;  4XLN F;  4F93 B;  4LK1 F;  3X2Q H;  3GX4 X;  4OIO F;  3LMM A;  4O5V A;  3DEW A;  2CO5 A;  2KJC A;  2DDB A;  3K1N A;  2NVY J;  1K4T A;  1F9N A;  3GTO J;  1BM9 A;  5F6F A;  2ZJQ F;  1P92 A;  3M3Y J;  3JRH A;  2KFD A;  2OU2 A;  3DBH B;  2GOX B;  3L1P A;  1W0T A;  1XC5 A;  2YX7 A;  3GTQ J;  4YII A;  2E1M B;  4XLA A;  2DPU A;  2MD0 A;  1QZY A;  3TQN A;  5D8L B;  1KU9 A;  2E7W A;  5BMZ A;  2EV5 A;  3OS0 A;  4EJT A;  3VOD A;  4MTD A;  5E17 F;  1J5Y A;  5KHD A;  1U3E M;  2K02 A;  5E3O A;  4CXF A;  1XDU A;  2DA1 A;  2GA1 A;  3GO5 A;  1OPC A;  3L2R A;  2K4B A;  2XGC A;  2WC2 A;  1U6G A;  2PQ8 A;  2JA5 J;  1YJW I;  1YIT I;  3M7G A;  3WGG A;  3VFZ A;  3BWG A;  3DP7 A;  4CUG A;  2M87 A;  2XAS A;  3ASN H;  3SEQ A;  3E3V A;  2CSO A;  2M2E A;  4F91 B;  4DQ2 A;  2CRG A;  2IEK A;  5EG0 A;  1FTZ A;  1X1D A;  3NAR A;  4PGH A;  5J4Y A;  2E60 A;  3IV5 A;  4GXO A;  1U5T C;  2EZK A;  3DTK A;  4ENM A;  1FBU A;  3GF2 A;  3R0J A;  1STZ A;  4XOR A;  2KPM A;  3QAH A;  4II3 A;  4V2G A;  5ICG A;  4IRI A;  3WTW C;  1KYZ A;  2Q1Z B;  1AHD P;  1H89 C;  2QA4 I;  3K70 C;  2FRH A;  2P6T A;  5DV5 A;  1HF0 A;  3T8T A;  1MBF A;  2PLY A;  5HOO A;  1JJ6 C;  3F3X A;  4BQN A;  3DEU A;  3CLQ A;  1YRN B;  3S1N J;  2XSJ C;  1UAA A;  2R7W A;  1X3U A;  2PMU A;  3WTV C;  4CCL A;  3M07 A;  3CLO A;  4YRV A;  3D5R C;  3DQV C;  4L9V A;  3A03 A;  5EDN A;  2JVG A;  4A3D J;  4HDV A;  3J80 K;  2AXL A;  4QPO A;  3J80 Z;  2EV0 A;  4KFC A;  3G1O A;  3WTT C;  3CCM I;  3HXL A;  4ZZD A;  2QSH X;  2UXN A;  2EIN H;  4B4C A;  3MKY B;  3ZQL A;  2NVQ J;  1D8J A;  4LMY A;  4D7M A;  3LSH A;  3QPH A;  3TBI A;  2VUM J;  2LG4 A;  3BR0 A;  1MZB A;  4IX7 A;  2PBI A;  1YTY A;  2QSG X;  1X3Z B;  1F36 A;  4BE2 A;  3BCB A;  1KQ9 A;  4CGZ A;  2QBY B;  2RKH A;  4KIG A;  1WKM A;  3U21 A;  5E18 F;  5JHF A;  5K7Z A;  3DXJ F;  3I58 A;  4AWX B;  3LSJ A;  1MDM B;  3CF5 F;  2JA8 J;  4HDU A;  3UKG A;  1DQU A;  2RN7 A;  1MSF C;  2Y0S N;  3H1C A;  1J2X A;  3F8M A;  4RAZ A;  2VC1 A;  1E2X A;  1WH7 A;  2RGV A;  3DF8 A;  4UUT A;  4BE0 A;  3HKZ N;  4BBS J;  3CCR I;  4HW0 A;  1YX3 A;  2ZNY A;  4I98 B;  5FKL A;  1Y39 A;  2HNH A;  2M7A A;  1GVJ A;  4AU7 A;  2IW5 A;  1GUU A;  2Z3Y A;  1ZG1 A;  1E0E A;  3KZY A;  4U7D A;  3I55 I;  3DPT A;  1TZL A;  4WF2 A;  2O6G E;  2H6B A;  1X2N A;  4F92 B;  4RLQ A;  1YRN A;  3J80 R;  1J9I A;  4BXF A;  4KIC A;  4L5J A;  1SMY F;  2M0M A;  2W57 A;  3ULQ B;  1ZH5 A;  1Y8R B;  3LNQ A;  2CUJ A;  1T6S A;  2R7D A;  3LOC A;  5EJC A;  2ADU A;  1Z21 A;  1XGS A;  1R6R A;  1S3J A;  5E1W A;  2DI3 A;  3LAJ A;  1A04 A;  4M72 A;  4Y15 A;  4PJL A;  4FET A;  4RDU A;  2ZJP F;  4XLH A;  3V7C A;  4I99 C;  1G3Y A;  4A3K J;  1ZRD A;  4A5N A;  1DP3 A;  1MJA A;  2IBD A;  2IAI A;  5ICC A;  2XF5 A;  1BC7 C;  2YR2 A;  4M6V A;  5CJ9 A;  1IUF A;  3D0S A;  3WTX C;  2L9N A;  2QBY A;  2VOO A;  4XL9 A;  2HDC A;  4CHU A;  3BTI A;  4FE7 A;  3KP6 A;  2P7C B;  1OQY A;  1UJ8 A;  1MDM A;  4IHS A;  3OOP A;  2IXS A;  2YPR A;  1QHG A;  3PNY A;  5K5R A;  3H0D A;  1TBX A;  1NHA A;  4DBR A;  5EEG A;  2X1C A;  4XM3 A;  2MAB A;  3R6S A;  3ROU A;  2EFO A;  5CVR A;  4RB0 A;  4ZC3 A;  1XTA A;  1K6O A;  4G6Q A;  3VEP A;  4PDK A;  2EZL A;  1OR7 C;  1XGN A;  1HA8 A;  2DXI A;  2MA3 A;  2BBY A;  1U78 A;  3CMM A;  2JN6 A;  2QQ8 A;  2DJN A;  2QVO A;  3JCU C;  1R00 A;  1I50 J;  3S16 J;  3TDZ C;  1Q1H A;  2EFQ A;  4EQQ A;  4F55 A;  2GXG A;  2WB1 A;  4Y13 A;  3A52 A;  1BR2 A;  3GTK J;  3RIR A;  2DT5 A;  4XQF A;  1TL8 A;  2VLA A;  5FLX K;  3HOY J;  1GLN A;  2PFB A;  2ID6 A;  3RTR A;  3ZQF A;  4LD5 A;  1PP8 F;  4HX8 A;  5E3M A;  2H1K A;  2KIS A;  2L4M A;  3FHN A;  4UV9 A;  1SD5 A;  3E5X A;  3I56 I;  1JHH A;  5D8K B;  4JX6 A;  2KRC A;  3OYL A;  2LY9 A;  3I0T A;  5E3N A;  3LA7 A;  3C2G A;  4BY7 J;  2XRL A;  1IJW C;  4G7H F;  3PUB A;  1ETO A;  2CQK A;  4BHB A;  2EH3 A;  4GGG A;  1XSV A;  2M9H A;  4BAY A;  2KDO A;  1W4M A;  3J81 K;  2XDV A;  1FP1 D;  3KFW X;  3J81 Z;  3W6V A;  2MZ4 A;  2A69 F;  3JSP A;  3BPV A;  4BH9 A;  5IP7 J;  5F64 A;  3I9V 2;  1X4O A;  3CCV I;  5C4X J;  2EA4 A;  3FK7 A;  5EYR A;  2FBI A;  3LA3 A;  1ERD A;  4L9J A;  1XGM A;  2A05 A;  2H27 A;  3CF2 A;  2V1D A;  1TQI A;  1LEA A;  3JTH A;  1T33 A;  2IGO A;  2VKH A;  5F1R A;  4GRI A;  4YG2 F;  1ETK A;  4LJZ F;  2L4A A;  2DMT A;  1VZ0 A;  3QOE A;  3RKX A;  1G2H A;  2NAZ A;  1ZLJ A;  2CQ7 A;  1FIP A;  2R0Q C;  1EH7 A;  5FLX R;  2PJR B;  1TT5 B;  1MMD A;  3AG3 H;  4LGW A;  4ZDO A;  1S5L C;  4NB5 A;  1YLF A;  3PUF A;  4EJV A;  2E2H J;  1IV6 A;  2DA5 A;  4RB3 C;  1T56 A;  1WWX A;  2R3S A;  3P9C A;  1MH4 A;  3OS1 A;  3PJR A;  2XPU A;  1UHW A;  5FKN A;  1ZR2 A;  2KJB A;  3H36 A;  2KT0 A;  1G59 A;  2ZXJ A;  5E79 C;  1OIS A;  3OL3 A;  2ECB A;  4V19 K;  2CYY A;  2W1O A;  1RC9 A;  3FK6 A;  2YX4 A;  1T38 A;  2E1O A;  2VN2 A;  2L9R A;  3Q0V A;  4G7Z F;  2W48 A;  1IN7 A;  4S05 A;  3KZZ A;  1RZ4 A;  2ISY A;  3OIO A;  4IJA A;  4NC8 A;  3OYC A;  3J81 R;  2HYJ A;  2RQQ A;  9ANT A;  4A3C J;  4D1Q A;  2CV2 A;  4IHT A;  1UCR A;  2JSP A;  3FXO A;  5DD8 A;  2ZO4 A;  5CKT A;  4IHX A;  2R7Z J;  3E6C C;  1SAU A;  3PIP F;  2W24 A;  4CSW A;  5IOZ A;  3VSK A;  3M9A A;  1F1Z A;  4HX4 A;  4HF2 A;  3HL2 A;  5D5W B;  2P0W A;  5KVR A;  1OJL A;  2IGN A;  2HFH A;  2HZT A;  3HZJ A;  5EF6 A;  1OYY A;  2DK5 A;  1Y1V J;  2BY2 A;  2CQX A;  3C18 A;  3WTY C;  3FM3 A;  5LHH A;  2JPB A;  2OV7 A;  3OSG A;  3DLA A;  1R5H A;  1WH5 A;  4XRF A;  5JVG F;  1UG2 A;  3ML6 A;  2KIQ A;  5B3S H;  2MG4 A;  1HCR A;  1YOV B;  5LGT A;  1XPX A;  3SDG A;  3GXO A;  1R1V A;  5CVU A;  2E5Z A;  3TGN A;  4LFU A;  4XON A;  3K1P A;  2GXB A;  4RB2 C;  1JGG A;  2DMP A;  1TWF J;  1HC8 A;  4M9X A;  5E8G A;  2X6W A;  5CVI A;  3RJP A;  1MBK A;  5GPA A;  4M3D A;  1ENH A;  2XSD C;  5TIS C;  4UV8 A;  3H3U A;  3OV8 A;  2DOE A;  1YW8 A;  4G12 A;  5L3C A;  3IP4 B;  3IWF A;  4M3B A;  5GP9 A;  4DBQ A;  4G6D A;  2C6Y A;  4UXN A;  3OYI A;  4WWC A;  2JA2 A;  1BBY A;  2E71 A;  1W7P B;  3KE2 A;  2P4W A;  4P9U A;  1BW6 A;  2HYF A;  3ZMD A;  3B6C A;  2OTJ I;  2EWN A;  1S9H A;  4IPA A;  5LHG A;  3S3N A;  2PI0 A;  3WGI A;  1RET A;  4L5I A;  3OYG A;  5D5V B;  2G9W A;  3HYI A;  2Y2Z A;  4U87 A;  2AXT C;  4GO1 A;  3AL0 B;  2DOD A;  2W4S A;  1BOB A;  3QPL A;  3G71 I;  2B9S A;  3L09 A;  2VJI A;  4RGR A;  1DGR M;  2P81 A;  2G7H A;  4K2E A;  5HS7 A;  1UFM A;  2MH2 A;  2W85 A;  2VI6 A;  2QSF X;  3F8N A;  3GUD A;  4KT5 C;  3ZN1 A;  2HU9 A;  5D6F A;  2A68 F;  4NHJ A;  3Q9V A;  2LC2 A;  2ZJ2 A;  4RM2 A;  1X1C A;  2XRN A;  2F5F A;  1ODD A;  1SVM A;  3ZQI A;  1XG1 A;  3L00 A;  3UR3 C;  1LQ1 A;  5IYB J;  2KQR A;  4HQE A;  2LKX A;  4HLY A;  4D0P A;  3BY6 A;  3PIO F;  2UWM A;  3WOD F;  4HNU A;  3HOV J;  3ZMV A;  1WJ5 A;  4DGW B;  1YO5 C;  5M5W J;  3HOZ J;  2F5V A;  1PUF B;  2IRF G;  1WI9 A;  2IT0 A;  1UHM A;  5FLM J;  4XK4 A;  1I39 A;  3HB9 A;  5IT9 K;  4NBQ A;  2AQF A;  2LRD A;  2L0K A;  5D5U B;  4EEF G;  3DPU A;  4CCO A;  2DA2 A;  4HX7 A;  2MW8 A;  3REO A;  1D0Z A;  3SQN A;  2FF4 A;  4E7Z A;  2BY0 A;  3BR3 A;  3FXM A;  2R93 J;  1I3A A;  1R7J A;  1HKS A;  2XKP A;  3FKI J;  4X0G A;  3H35 A;  4LG3 A;  4Y17 A;  4ZH4 F;  1W7P A;  1JKO C;  4C3H J;  3ZMS A;  1KU7 A;  4FX0 A;  5HS8 A;  2JVH A;  2ZME B;  4UUS B;  4P5O A;  3GVA A;  4B44 A;  4ASN A;  3K6G A;  2IP2 A;  1Z1D A;  1BR1 A;  4P9F A;  3OSF A;  1DP7 P;  4CCM A;  3CDH A;  4M3G A;  2VBX A;  1ETW A;  2TRT A;  2VBZ A;  3VYS B;  2BY3 A;  3BTC A;  4Y3O A;  4QSH A;  2WAQ N;  3AFH A;  1J7K A;  2IGK A;  2D2W A;  3DTE A;  1FMV A;  4KN4 X;  4PJ0 C;  1CF7 B;  4A2U A;  2A3S A;  4FT8 A;  4AYB N;  3GTJ J;  3F72 A;  2DYR H;  3CQZ J;  2K85 A;  3BZ6 A;  2EFN A;  2JUG A;  2OQG A;  4IOC F;  3E6B A;  2Y9Z A;  3F6V A;  1IN4 A;  1YFH A;  2BEO A;  3OR2 C;  2O61 A;  1ZGJ A;  2M8E A;  2P7V B;  5HNF A;  2K5C A;  3ZQC A;  2HPM A;  1SMT A;  2QGU A;  4CCJ A;  4KIF A;  3SHF A;  1Y0U A;  1QU3 A;  3OMY A;  1IN5 A;  2L3D A;  5B5E C;  3DFG A;  4EJO A;  3EYI A;  2EPF A;  2QQA A;  5HDK A;  1FSH A;  3KLO A;  3KEY A;  1WCM J;  2L54 A;  4MGR A;  1FP2 A;  3NWT A;  4MNU A;  1BIA A;  4RAG A;  1FPQ A;  3D5L A;  3ECH A;  3HPG A;  3JSO A;  4F52 A;  2LDU A;  2F5E A;  2X1E A;  4AIH A;  1JE8 A;  1ZYR F;  4MO7 A;  4EAT A;  2VQC A;  5KAF C;  4MTE A;  3WHC A;  1LFU P;  1B1B A;  4ENN A;  5FJ8 J;  5EZH A;  2HOT A;  1SD4 A;  2AHQ A;  3AG2 H;  2LYC A;  4ITV A;  4EGY A;  4KIB A;  5E1Z B;  3Q0W A;  4UUS A;  4KJZ A;  2CUF A;  3T5X A;  1S8N A;  4L9T A;  4ZYD A;  4A3J J;  2H94 A;  1ETQ A;  5E1X A;  2KP6 A;  4E4H A;  4S0H B;  4XMY A;  1C0W A;  3RYR A;  1FWZ A;  4PFO A;  3QRF F;  3K9T A;  3CC4 I;  3HDD A;  2CQQ A;  1HKQ A;  2E1N A;  1X3W B;  1R23 A;  2A6H F;  2RQP A;  1Y56 A;  4E7I A;  3TOB A;  2CFX A;  3HPH A;  4U7B A;  1HKT A;  1GXQ A;  3K2Z A;  4JBA A;  1CF7 A;  2QUF A;  2Y30 A;  1Z7U A;  2RVC A;  3M8E A;  4OMZ A;  2O8X A;  2LNB A;  4JQF A;  2OPT A;  1BI3 A;  4U0Y A;  4F7Z A;  4FX4 A;  2CH0 A;  2VQL A;  2QEN A;  4B1R A;  5L3D A;  1UMQ A;  3AAF A;  3TO7 A;  1Q1V A;  2NXN B;  3IH2 A;  2FQ4 A;  2A6E F;  2LRE A;  4J01 A;  2NYX A;  3S1Q J;  1WZ2 A;  2I5U A;  3MCZ A;  2K40 A;  3BG5 A;  4BHC A;  5CQG A;  4RMN A;  3L2Q A;  2OUM A;  3WU0 A;  2V9V A;  3RPU A;  3ZQQ A;  2CUE A;  3KP4 A;  2BXY A;  4M73 A;  4GDF A;  1ORK A;  3IKV A;  2R7Q A;  1FYL A;  1ONV A;  2XAQ A;  3A1Y A;  2JA7 J;  1I1S A;  4BUP A;  5F08 A;  3OYD A;  3BG9 A;  1SAN A;  1JUS A;  2M34 A;  5CYV A;  3I4N J;  1AKH A;  1VI0 A;  1TWG J;  2UV1 A;  3KLN A;  5KCM A;  5BQT A;  2GM4 A;  1WJA A;  2JQ7 A;  2Y0S A;  1E17 A;  1SD7 A;  2GQQ A;  2DFI A;  1P6R A;  4G94 A;  3S32 A;  3KEO A;  1MSE C;  4P1W A;  3DV8 A;  2K9L A;  2DA7 A;  3HKZ A;  4LOC A;  3VYU B;  2XRO A;  2GXA A;  2BYV E;  2KDZ A;  1X1B A;  4Q47 A;  2LOO A;  4MLO A;  4D5F A;  5F0H A;  1IW7 F;  3IAS 2;  1ZLK A;  1O3T A;  2LMD A;  1N75 A;  5F0F A;  1JKR C;  5HDG A;  2FMY A;  2LY2 A;  4BQQ A;  1X2M A;  2HQA A;  4AID A;  4EJW A;  1QRY A;  1U5T B;  2FJ1 A;  1ZTR A;  3OIP A;  5K5Q A;  2R7O A;  1BI2 A;  3GCM A;  2HQ5 A;  1ETX A;  4PJM A;  3M1E A;  3MZY A;  2ETH A;  4C9Y A;  2D45 A;  2KLO A;  4XRS G;  2VJJ A;  3K4K A;  1LE8 B;  4A69 C;  1K7A A;  4MIM A;  1ZK8 A;  1FYM A;  5LRR A;  5C44 J;  1F4K A;  2V7F A;  4JX4 A;  3Q3S A;  1BA5 A;  4CZC A;  3SJM A;  3LA2 A;  1IRF A;  4AM3 A;  1HW1 A;  3T1B A;  2EFP A;  2E5N A;  1FY7 A;  3P9K A;  1Z91 A;  4PUS A;  3RSN A;  2NS8 A;  1QPI A;  1IZ1 A;  1QBJ A;  3ZCO A;  2WV0 A;  3JR9 A;  4PK4 A;  4J19 A;  1YIO A;  2M1B A;  4BS9 A;  2JTV A;  4HSR A;  1JT0 A;  4WK8 F;  4KDP A;  3CCL I;  3F0C A;  2ELH A;  2HQN A;  2QQB A;  3OR1 C;  5H6R A;  3G4S I;  3C1D A;  5DCF A;  3GME A;  3BR5 A;  2Z99 A;  3CUO A;  1I1G A;  5HLG A;  1T39 A;  3ABK H;  2L9S A;  1P4A A;  4XRM A;  2OTL I;  3QU3 A;  1WJB A;  3K4J A;  3KIO A;  3GTL J;  3QP5 A;  2EIK H;  3D1N I;  3GTP J;  1QA6 A;  1MH3 A;  3IRR A;  2ACJ A;  3CCE I;  2L7F P;  2M35 A;  3FWE A;  2PN6 A;  1X4P A;  2W00 A;  2WAF A;  3TW6 A;  4DYQ A;  2QEX I;  1XSX A;  4LB5 A;  3RKW A;  2ZJR F;  2Q8K A;  1M1E B;  2MLK A;  4CO8 A;  1U5T A;  2MVT A;  1TLH B;  3W3C A;  4I6Z A;  1POG A;  3K4N A;  4BHP A;  3S14 J;  2GZW A;  3N4M A;  2V4J C;  4MEX F;  2R7U A;  1MMN A;  2KIU A;  2M4G A;  2FNP A;  3BRO A;  2WBM A;  3HG9 A;  3JRF A;  1MW7 A;  3R4K A;  1LE8 A;  1D5Y A;  2HR3 A;  5ILS A;  4E6K G;  3IL2 A;  2EV6 A;  1JUM A;  2QZ8 A;  2NRA C;  2QM3 A;  5L3E A;  3R61 A;  2JSC A;  3AKZ A;  3CP2 A;  4XOT A;  3SDB A;  4IQJ A;  1VQ8 I;  3IC7 A;  3RI4 A;  2Y9Y A;  1BJA A;  3L7W A;  5GPC A;  2DFH A;  4C2M J;  2KRH A;  2X85 A;  4G7O F;  2ME0 A;  4DZJ A;  3OYA A;  4O6J A;  1OCC H;  5DEQ A;  3L2V A;  1DGW Y;  3GFI A;  1HDP A;  2FSW A;  2DLL A;  1WJF A;  2ZBK A;  2ID3 A;  1T08 B;  3GZN B;  2DBB A;  3ZXS A;  3FMS A;  2JK3 A;  1AA7 A;  4PJN A;  1V3F A;  2FNA A;  1A35 A;  3M1C A;  1BJZ A;  2VBW A;  2VAS A;  3RCO A;  5IYD J;  5CQE A;  4BDY A;  5AIQ A;  4HNT A;  2L01 A;  3L9F A;  4OIP F;  1L3L A;  4XBF A;  4RS8 A;  2VC0 A;  1IAW A;  3RPU D;  1VQL I;  4CYC B;  2TDX A;  3PNV A;  1MJ9 A;  4UHT A;  2STW A;  1HQC A;  3ASO H;  3HTS B;  2VQG A;  3RZO J;  3PFY A;  2WY7 Q;  3ZOB A;  1JI8 A;  4FCY A;  2DMN A;  3RQ4 A;  1EV7 A;  2XAJ A;  4DYR A;  1FOK A;  1KU2 A;  2VT2 A;  5HVQ C;  1P2F A;  3WE3 A;  1O3S A;  3BG7 A;  1ETY A;  3VWB A;  4UVA A;  4N4N B;  4Y33 A;  3A4C A;  2Y69 H;  4BYY A;  3SFZ A;  1PJR A;  4RBO A;  2IPQ X;  1G3W A;  3L2C A;  1ZGA A;  2VIX A;  1G8X A;  4DIQ A;  3FBN B;  4BXU A;  4IF4 A;  2DPD A;  2XB5 A;  2DT6 A;  1BN5 A;  2M4K A;  2L2O A;  2X1D A;  4IHV A;  1P4X A;  4AVP A;  2BVM A;  3RDI A;  1E3P A;  1OCZ H;  2FOW A;  1K79 A;  2I8D A;  4AC0 A;  2UZK A;  3DU5 A;  1T8I A;  2DFF A;  2DFE A;  3J7A Y;  2FD5 A;  3P7N A;  3H5N A;  1GXP A;  1D1C A;  5LBQ A;  3U1K A;  1N25 A;  1R5I D;  2ZB9 A;  2N8G A;  4XLP F;  4II2 A;  1FMW A;  3OYJ A;  1D1B A;  2MYS A;  5FO5 A;  1IDY A;  1SC7 A;  2AO9 A;  1W36 C;  5FRN A;  4C2U A;  1V55 H;  2WAE A;  1QVU A;  2OCE A;  4DNC A;  2IS2 A;  1YI2 I;  4G6T B;  2P5V A;  3HOW J;  3TW7 A;  1FOW A;  1FBS A;  3EQL F;  3F8C A;  3LSK A;  3OS2 A;  2CJJ A;  1FLI A;  2DOA A;  2FML A;  4B8X A;  3ABL H;  4XR6 A;  4CYC A;  4AUX A;  2JMW A;  2MGQ A;  5F27 A;  2ZXI A;  1ZKG A;  3HRM A;  3OYN A;  4N9H A;  3KP7 A;  4GFB A;  2OAZ A;  4IKF A;  1QVT A;  2A6T A;  3GZ6 A;  3CO6 C;  4ETS A;  1XMX A;  4UNO A;  2PG4 A;  1ON1 A;  3LWF A;  1JT6 A;  3DPL C;  4E7L A;  1W5C C;  2GIV A;  4FIS A;  1AWC A;  3WE2 A;  1OR7 A;  1FNN A;  4FE4 A;  5ICE A;  4EM1 A;  3S1R J;  5BPI A;  2X98 A;  1EKE A;  3MKL A;  2V6E A;  3C3W A;  3GTG J;  5LHI A;  4QIW N;  1JGS A;  3COA C;  2PMZ N;  4RB1 A;  4N4O B;  3S2H J;  4HG2 A;  3VPR A;  1P9Q C;  3HHH A;  1H0M A;  2FU4 A;  1JHF A;  4ZYG A;  1J75 A;  4BJ5 C;  1NTC A;  3JRB A;  1WJC A;  2LSO A;  4HAM A;  1L0O C;  2F4I A;  4FHT A;  1HDD C;  1RRJ A;  1WFX A;  3E1S A;  3BJA A;  4WXD A;  5JLX A;  4CA0 A;  4DJA A;  1GDT A;  1GV2 A;  2XAG A;  5EEA A;  1MBE A;  2QLZ A;  4IHY A;  3E7L A;  2WWY A;  4OIQ F;  1R4N B;  2DQR A;  2X9D A;  3CO7 C;  4A6D A;  2L7M P;  4QLC U;  1FTT A;  2O0Y A;  2IS1 A;  4LB6 B;  4A93 J;  3QU6 A;  2CWE A;  1BI1 A;  2Z16 A;  5H2F C;  1QNT A;  5GAH J;  5ERI A;  3HUG B;  1FYK A;  1B72 B;  4Q5S F;  2R7S A;  1Z3X A;  1EJ9 A;  3K70 D;  2HI3 A;  1FZP B;  1HOM A;  3RYP A;  5CLS A;  5KNL A;  2MBF A;  3K69 A;  5GAD J;  4V2F A;  2A5Y B;  4IEJ A;  3CC7 I;  4EM2 A;  4Y4R A;  3KP3 A;  1A6I A;  3QOD A;  1R9T J;  3ZR8 X;  4KMU X;  3FX3 A;  1YYV A;  3DKX A;  2CFO A;  1YW9 A;  2HTJ A;  2JJ7 A;  2FX0 A;  4PJJ A;  1OCP A;  2KKO A;  4RM3 A;  3ZQH A;  5HLI A;  3FHZ A;  2MSY A;  3O8G A;  5ED4 A;  1LJ9 A;  1P7J A;  3JRC A;  1HW2 A;  3OWT A;  3T8R A;  2DTR A;  1MNE A;  1S6L A;  3V7R A;  2PMH A;  1Z77 A;  2VON A;  2OZU A;  2JUC A;  2Z9O A;  1RPW A;  5E8I A;  4Z6Y A;  3KPH A;  3V8K A;  6PAX A;  5EGO B;  1H9T A;  3U2R A;  4KNY A;  3PQJ A;  3PQK A;  1S72 I;  3CMA I;  3K2A A;  2B7E A;  2F5C A;  5ILU A;  2M0C A;  4WXH A;  1R71 A;  3BDD A;  3BOQ A;  3LL7 A;  2MD5 A;  4RAY A;  2HS5 A;  4I7H A;  3B6A A;  4PCQ A;  5FLV A;  3I4M J;  2NVU B;  5K5O A;  3MZH A;  1S29 A;  3CZ6 A;  2V9K A;  3WU1 B;  3CJT B;  1FIA A;  5K7F A;  3V42 A;  3HBL A;  2E7X A;  4ENK A;  1V5G A;  3TED A;  3IUO A;  3I59 A;  3MEX A;  1IO2 A;  1HW5 A;  4IL6 C;  3VSL A;  5LLQ A;  2WAQ A;  5K1Y A;  4A3F J;  3HGY A;  4BQA A;  1GVD A;  1WVR A;  4I0B A;  4RA2 A;  5L3F A;  2HEO A;  1E3O C;  1XCB A;  3BQY A;  3WU2 C;  1ZEL A;  3QQA A;  5F04 A;  3IAM 2;  4LIU A;  4C3I J;  4I2O A;  3WTZ A;  4IRG A;  3TDU C;  4AYB A;  2HXO A;  1YJ9 I;  3HUG A;  3QPS A;  1RUN A;  1B72 A;  3OYH A;  5JHU A;  3IWZ A;  1IXS B;  1EH6 A;  2VE8 A;  2A61 A;  3GYH X;  1ACI A;  1XX5 A;  3M8F A;  2VJ5 A;  5HLT A;  3KX2 A;  3F23 A;  4MQ9 F;  2G7U A;  3ISP A;  3ZRG A;  2NVX J;  5E20 A;  1RKW A;  2MFZ A;  5LEK A;  1WGX A;  2K9N A;  3U9G A;  1MBH A;  2OZ6 A;  1ZAR A;  5C4J J;  3ABM H;  2Y31 A;  1HST A;  1TNT A;  2M5W A;  2OCC H;  3ESW B;  2XF6 A;  3W6K B;  2HWV A;  3ONQ A;  4ZDL A;  1OMI A;  5HLH A;  1D5V A;  1KU3 A;  1K61 A;  2LK2 A;  3FXJ A;  2R5Y B;  1O3R A;  2WY8 Q;  5M3F J;  5EGO A;  2JPC A;  1WI3 A;  1XSD A;  1IG7 A;  1FC3 A;  3HIF A;  5A2Q Z;  3GBG A;  1YIJ I;  1VQO I;  2ZFU A;  1FT9 A;  2F2E A;  3I4P A;  3N97 A;  5DM6 F;  4CH7 A;  2R7R A;  4IHW A;  2LTP A;  2VE9 A;  1QZZ A;  4Q4Z F;  3HRT A;  3CJN A;  3ZPL A;  1A5J A;  2H1L A;  2O03 A;  2XKO A;  4RLF A;  1QZE A;  2DA3 A;  3QYE A;  1J09 A;  1MMS A;  2VXD A;  1V5E A;  4Y7N J;  1YS6 A;  3S2D J;  2IJL A;  3EUH C;  3IH3 A;  2EBI A;  2L9V A;  4HNV A;  3GTM J;  5D6E A;  3OIQ A;  2F6C A;  2LVS A;  3CUQ C;  4B3A A;  1VQM I;  2ZSI B;  1U9N A;  5BPD A;  2QQ9 A;  4NC7 A;  2GWR A;  4XNF A;  1BR4 A;  4TV7 A;  4Q48 A;  1Y6I A;  1LFB A;  2EIJ H;  3BQZ A;  4OIR F;  4E70 A;  2M3A A;  3IHU A;  2B63 J;  5DD4 A;  2X6Y A;  4GYG A;  2X0L A;  2R5Z A;  3MQ0 A;  4G9Y A;  5LGU A;  3C2B A;  1MMG A;  3TO6 A;  4LLL A;  2BOL A;  3MFK A;  1NG6 A;  4GYI A;  2BGC A;  4CIC A;  3QP6 A;  2ESN A;  4BAC A;  1OCO H;  3A2K A;  4A0Z A;  5IT3 A;  5GTI C;  4A12 A;  3VDX A;  3H92 A;  4NNJ A;  4XIC A;  2R7X A;  3HGG A;  4BY1 J;  1ZHF A;  2EA2 A;  4QTR A;  4JX5 A;  3JRA A;  2J5P A;  2V9P A;  4IQ4 A;  3J7Z I;  2EFW A;  4EV0 A;  5IPA A;  4QPQ A;  4IOA F;  2R5Y A;  3CJQ B;  4RAF A;  1K4S A;  2K9Q A;  4HEA 2;  3MMY B;  2LP0 A;  3WHB A;  2Z1D A;  1D8K A;  2ZXH A;  2KL4 A;  4ZYE A;  1TT0 A;  3F6O A;  4ABZ A;  1LFP A;  3Q5F A;  3OL4 A;  4CCN A;  1IRX A;  2DT7 B;  3WG9 A;  2ZFW A;  5HNH A;  3FIW A;  5IYC J;  3I64 A;  1AKH B;  4HV6 A;  3VB2 A;  1VQ6 I;  2XGX A;  2MUN A;  3SYT A;  1TWA J;  3VYR B;  4A6E A;  3E0J B;  4ZYH A;  3K4B A;  4NC6 A;  4B47 A;  4L0Z B;  5L3B A;  1IXC A;  4I09 A;  3VYT B;  3MN2 A;  2WA0 A;  3S1M J;  1VQ4 I;  2VPL A;  2PJP A;  4YEL A;  2EIM H;  4HA8 A;  3HSE A;  4HLX A;  2GBY A;  2E19 A;  4KMF A;  2O9L A;  4M71 A;  2UXX A;  2F48 A;  3VOE A;  1OCR H;  1Y0N A;  1XMK A;  2VPR A;  2CW8 A;  1RQ6 A;  2DMQ A;  1DDN A;  1FSE A;  4KT6 A;  2F5D A;  2MC4 A;  2ISZ A;  3H3Z A;  2Y0M A;  1BL0 A;  4R1H A;  1RIO H;  2DO7 A;  1WPK A;  1V4R A;  2W84 A;  3M8J A;  3KET A;  2NOJ B;  5J4V A;  5FRM A;  3E6M A;  4HRI A;  4L9N A;  1OFC X;  1XB4 A;  1TTY A;  4I01 A;  2BHZ A;  4A3L J;  4D9J A;  5DCM B;  4A3M J;  2XV4 S;  4LG0 B;  2COM A;  3ZQ7 A;  1ZN2 A;  2OC6 A;  3MZ8 A;  2P5K A;  4CCK A;  2DN0 A;  4BNC A;  3DEE A;  4EVI A;  5J1Y A;  5IOY A;  2MH9 A;  3MAJ A;  1ULY A;  3K10 A;  2OA4 A;  2L7Z A;  3O3K A;  2IGM A;  3LST A;  3ZMZ A;  1W0U A;  2L7K A;  3FXQ A;  5J40 A;  1G3S A;  4MQV A;  3CES A;  2V1X A;  3HRU A;  4FAS D;  4L5E A;  2E1M C;  2MC3 A;  4YFN F;  1SAX A;  3E5U A;  1LDJ A;  4KIS A;  3SFI A;  2FXA A;  4BJ6 C;  3ECO A;  2K9M A;  1JJ8 C;  4F3Q A;  3KCC A;  4IZZ A;  1T0F C;  3DBR B;  3J7Y J;  3Q0U A;  5K7H A;  4BXX J;  2B0L A;  3OYM A;  4BL0 B;  1XDS A;  4MHG A;  2E35 A;  3BP8 A;  4JYK A;  5CVJ A;  4B3X A;  1MBG A;  2EB7 A;  1LDD A;  3ABU A;  2H8R A;  4BQO A;  1ZR4 A;  3LSR A;  5H20 A;  4OAY A;  3BC8 A;  1BI0 A;  1VFC A;  3BJO A;  4S04 A;  5J8F A;  5KK1 A;  4FTH A;  3SZP A;  1G3T A;  3O8H A;  3FDY A;  1IN6 A;  4IXA A;  3JRG A;  3F8F A;  1B9N A;  2EZH A;  3RPQ A;  4M3F A;  2XVC A;  1MMA A;  3FXL A;  3S3M A;  1MD0 A;  1NK3 P;  5FFX A;  4P55 A;  2BV6 A;  2CV0 A;  1VQK I;  2JA6 J;  4M6Y A;  4BBR J;  1I6X A;  4PFP A;  4D7N A;  4ESB A;  1O3Q A;  4XKW A;  5FKO A;  1RKT A;  1R5G A;  1Z3Y A;  1OCT C;  1W5T A;  3CDL A;  2CGP A;  2YS9 A;  1X1A A;  4ZDP A;  3H5A A;  1VTN C;  2VL8 A;  2L02 A;  2W82 A;  1AOY A;  1W7P D;  4PZJ A;  2DW4 A;  1VQ7 I;  2LF8 A;  1YJN I;  2BXZ A;  1V5F A;  5DCM A;  3RKY A;  3RKQ A;  2V1N A;  4LG0 A;  1SD6 A;  4H4K C;  3W2W A;  1VQ9 I;  3E97 A;  4HQM A;  5IY5 H;  4HZF A;  3KYL A;  4A3B J;  2H6C A;  2CMP A;  2OQR A;  3V8L A;  2OBP A;  1FX7 A;  4M74 A;  5GAE J;  4YIR X;  4BE1 A;  1B59 A;  3QOP A;  3K7A J;  4I02 A;  4ESF A;  4OOI A;  2EJR A;  2P8T A;  1YW7 A;  1PP7 U;  3FXK A;  2EK5 A;  2XPV A;  5FFZ A;  3R60 A;  5D4R A;  2E1C A;  2ME6 A;  4XSX F;  1Z05 A;  3HOT A;  3PFI A;  4HF1 A;  2O5R A;  3CCY A;  1SVO A;  3GFL A;  1WQ2 A;  4EJU A;  3HSF A;  2ECC A;  1I27 A;  1I5Z A;  1KGS A;  2CU7 A;  3TO9 A;  2YU9 J;  3LSP A;  2IS6 A;  1QPM A;  1T0F A;  2BY1 A;  2AS5 F;  3A0H C;  2V26 A;  1DU0 A;  2XPW A;  3JRE A;  1YHQ I;  1LDK B;  3A0B C;  1HSJ A;  5KAI C;  1FJL A;  3DBL B;  2FQ3 A;  1OYW A;  4LIT A;  2XF7 A;  1P7I A;  1DPR A;  1R1U A;  3CCS I;  4G8X A;  3F8B A;  3W2V A;  2H09 A;  2BZT A;  3OYE A;  3W6J B;  3B73 A;  1IC8 A;  3DU6 A;  3W2A A;  2R7T A;  2FEZ A;  2TCT A;  3HOS A;  2HDD A;  2EIL H;  2NS0 A;  1J0R A;  4E7J A;  3K1M A;  1ETV A;  2A5W A;  3I3L A;  4PSW A;  5C3E J;  5EEH A;  3UNG C;  4ZYA A;  1Z9C A;  2Q2E B;  1D3Y A;  2DYS H;  1WSU A;  3TKY A;  4ZZL A;  2LH9 A;  3H0G J;  5DM7 F;  2ZXW H;  1UEL B;  4BJT A;  2VT3 A;  2X51 A;  4XKB A;  2HOE A;  2GA2 A;  4KN7 X;  4PSX A;  2R92 J;  3CC2 I;  2OF7 A;  3ZN0 A;  1XD7 A;  4HYE A;  1O57 A;  2ZSH B;  2L5Q A;  1HXD A;  3FBI B;  2KHM A;  2W25 A;  4O3M A;  4RGX A;  1S7O A;  3K0L A;  4ZTF A;  3BG6 A;  3BCA A;  1MJB A;  5M5X J;  3FMQ A;  2ZC2 A;  3HM5 A;  3V8J A;  3S8P A;  5DUK A;  4R8H A;  3TP3 A;  1I3Q J;  2ZKZ A;  1NH3 A;  2ESH A;  3AG4 H;  1Z7L A;  3PL8 A;  1SEU A;  1JUP A;  2XB0 X;  4CZZ A;  2DA6 A;  2JWT A;  3CDI A;  4UB6 C;  3V7S A;  1TWH J;  3KEQ A;  1EF4 A;  2Z33 A;  4YEJ A;  1TWC J;  3RZD J;  2CS3 A;  5FGM A;  2PX9 A;  2QYO A;  4J00 A;  4I76 A;  2W7N A;  1AU7 A;  2NS7 A;  3H9Q A;  5JVT A;  2RNG A;  4XOP A;  2D5V A;  3G1L A;  1LPQ A;  2LKS A;  1H8A C;  3V4G A;  2K3F A;  4XN3 A;  2M30 A;  4A3E J;  2VXZ A;  2DTZ A;  3DKW A;  2HVR A;  4M6X A;  1RES A;  3E6D A;  4BKX A;  1SFO J;  1LKX A;  2O3F A;  1YS7 A;  4P96 A;  5FRO A;  5J47 A;  4C2T A;  5J6X A;  1N78 A;  1JXS A;  1UZC A;  2FA5 A;  1LUJ B;  4MEY F;  5F1J A;  3OYK A;  4DZP A;  4XRS A;  2CQN A;  2Z5U A;  4Z2Y A;  1FOX A;  5M3M J;  2QWW A;  5H6Q A;  2Q2E A;  3HC7 A;  1JTX A;  2PMZ A;  1IRG A;  4WXC A;  2XAF A;  1T98 A;  3F21 A;  1QO0 D;  2X6O A;  5GTH C;  2HKX A;  3G2B A;  2VKD A;  1QHH D;  3SXY A;  3HTU A;  5F0C A;  1K83 J;  1Y8Q B;  1B4A A;  1FOY A;  2JT1 A;  2Z2S B;  4OIN F;  4RGS A;  2F4O B;  1KQ0 A;  3WG7 H;  1ZG3 A;  3HOU J;  1S7E A;  3ERM A;  3I71 A;  1F5T A;  5LEJ A;  2CV1 A;  1CQT A;  1PYV A;  4OU0 A;  1OKR A;  3ZGK A;  4WCG A;  2STT A;  2ZNZ A;  5FKM A;  4ZTJ A;  2J5O A;  5BNG A;  5FLX Z;  3CCU I;  1VND A;  1YE9 A;  3FIS A;  2DJI A;  4D5C A;  2G0E A;  3A02 A;  4U88 A;  3PSF A;  4N9I A;  4Y52 J;  2FUG 2;  3G3Z A;  1EH8 A;  2R7V A;  1X19 A;  2O7O A;  2Y48 A;  4E7S A;  4KIT B;  3JAM K;  2HXI A;  3JAM Z;  1IN8 A;  1RR7 A;  3H9J A;  3HEF A;  3MD2 A;  3NAU A;  4U0V A;  2XUB A;  5J8C A;  3CTA A;  1KON A;  1IGN A;  2HQR A;  2BVL A;  1V54 H;  3PO3 J;  1XS9 A;  1PUE E;  3BTJ A;  1WJD A;  3J7A O;  3KZI C;  2D1V A;  1XCV A;  1VQN I;  4HBL A;  4OMY A;  1SFE A;  1U8B A;  2X48 A;  2K4J A;  4NDL A;  3JRD A;  2RDP A;  3EPZ A;  3I53 A;  1TC3 C;  5D5X B;  2A07 F;  2K3P A;  3PSI A;  3ABT A;  2XAU A;  1IF1 A;  2CG4 A;  2IA1 A;  2VQH A;  3OYB A;  5B66 C;  3PM1 A;  4DW6 A;  1B8I B;  4UY8 I;  2K9S A;  4HV5 A;  1MND A;  3SZT A;  4A0Y A;  3FXU A;  2LF7 A;  2Y75 A;  3CME I;  1PDN C;  3O2P E;  3NQO A;  3DKY A;  2DA4 A;  3OOU A;  4XKV A;  1NG7 A;  1APL C;  4B48 A;  3LQQ A;  2HOS A;  1A6Q A;  2DK8 A;  4PGG A;  2XGE A;  3F22 A;  3LFK A;  2V79 A;  4BGD A;  4UUV A;  1KQ8 A;  3P9I A;  3QYF A;  1GHC A;  2M8G X;  5J1U A;  1TNS A;  1ZAO A;  2ELK A;  2HOA A;  3CD6 I;  2YU3 A;  2GAU A;  1YQA A;  3NRV A;  4EM0 B;  1QQI A;  2PEX A;  4C3J J;  3Q9S A;  1UHS A;  2DOF A;  2LKP A;  2X6X A;  3I59 B;  4JOM A;  1Z67 A;  4XLC A;  3IRQ A;  3G73 A;  1K78 B;  1W5S A;  1A31 A;  3GFM A;  3S93 A;  1QGP A;  5ICF A;  2ZCW A;  1R1T A;  2BW3 B;  3JAM R;  2WB1 N;  3TP0 A;  2GIZ A;  5B1B H;  2ICW G;  2HPI A;  4JK1 X;  1H9G A;  3EYY A;  2WTE A;  1YX5 A;  1VQP I;  3BTL A;  3CP8 A;  2D1H A;  3C7J A;  1IRZ A;  1P4W A;  4HPQ A;  2E2J J;  4M3E A;  4UVC A;  5DS9 A;  1SVL A;  3L2W A;  1UST A;  3EDP A;  4DOZ A;  3C2H A;  4BDZ A;  1NK2 P;  3J7A W;  3A01 B;  3CCQ I;  1RI7 A;  2JZY A;  1ON2 A;  3D5S C;  1BC8 C;  2RRE A;  1FBQ A;  1UG0 A;  4GCV A;  3S15 J;  1MIJ A;  1SFX A;  5FD6 A;  1TP4 A;  1B9M A;  3WGH A;  1U9O A;  4M9Z A;  3H3V K;  2XAH A;  2VKE A;  2DDA A;  1T95 A;  1U0J A;  5AON A;  2VBY A;  4N0B A;  2UUZ A;  1R22 A;  3P5J A;  1XN7 A;  3QWL A;  1X1P A;  2H8W A;  2QKM B;  1B8I A;  3CJR B;  2M45 A;  1HLV A;  1SFU A;  4NQW B;  4KA4 A;  1D1A A;  4B43 A;  2KRF A;  2VKV A;  2LY1 A;  2BE5 F;  2XGD A;  2XIG A;  1IV8 A;  3GFJ A;  3CCJ I;  3B02 A;  1LNW A;  3EET A;  3MKZ A;  1MKM A;  3T0Y A;  4XLE A;  1X58 A;  2E36 A;  5LD2 C;  2FBH A;  5L3G A;  2KZG A;  1W1W E;  4M9S A;  5J3L A;  3GLL A;  1Z6R A;  4ZJZ A;  2PJR A;  1O7F A;  2WV1 A;  2LBF B;  2MLG A;  4NUB A;  1R4M B;  2HYG D;  1JKQ C;  1KYW A;  3LSM A;  2COB A;  3MWM A;  3I5U A;  4UB8 C;  3SEZ A;  5FB2 A;  3NWS A;  5M5Y J;  1O4X A;  1K78 A;  1K6Y A;  3JTG A;  2Q0O A;  3FXR A;  5AIP A;  4YFK F;  2K7L A;  3K4C A;  2OJE D;  1ZRE A;  2BW3 A;  3LSG A;  1A36 A;  3DTI A;  4CYD A;  1OLT A;  5CPR B;  1G6N A;  4KUM A;  1E3H A;  4X6A J;  4XID A;  5DDG A;  3FM5 A;  1PVE A;  3LQR A;  3PNT A;  3SZG A;  5JLW A;  3ERE D;  3G1M A;  3KP2 A;  4MFE A;  3EUK L;  4BU2 A;  2E2I J;  2DU9 A;  1F43 A;  5LRS A;  5D4S A;  2OD5 A;  1MGT A;  3HOX J;  4FQG A;  3TOA A;  2P0T A;  2R5Z B;  3DLL F;  5EZG A;  5DYM A;  3EUA A;  3A01 A;  3GWZ A;  3AL0 C;  2RV8 A;  3E5Q A;  1LEB A;  3N05 A;  4W1U A;  1REP C;  2O8K A;  1J59 A;  3BT9 A;  5HDN A;  4E7K A;  4XN0 A;  2IS4 A;  3ELK A;  2NNN A;  3WTU C;  4B09 A;  4LLN A;  3I54 A;  1BIB A;  3S3O A;  1DUX C;  3BZC A;  3K4M A;  1R58 A;  3S17 J;  1O7L A;  4IO9 F;  1JTY A;  4QWQ A;  1SFK A;  1GT0 C;  1Z6T A;  2HZD A;  4RGU A;  4AD9 A;  5HOD A;  1JKP C;  3BG3 A;  1CGP A;  3HRS A;  5IP6 A;  2VOP A;  1USS A;  3RQI A;  1UB9 A;  4NQW A;  3AG1 H;  1MNM C;  2GOM A;  3JRI A;  5A2Q K;  2VJ4 A;  5JR3 A;  2DMU A;  3IH4 A;  1R36 A;  2K27 A;  4MFD A;  5TRD A;  5ILV A;  5IP9 J;  4EMS A;  2AQE A;  2FBK A;  2NNY A;  1DPU A;  4YFX F;  2CUZ A;  1TW3 A;  5HS9 A;  2EQR A;  5TJJ A;  4U0W A;  2LBF A;  4LIV A;  1TW2 A;  2V1U A;  1BOA A;  2QCO A;  2IVM A;  2V6C A;  3BR1 A;  2RC4 A;  2KZV A;  4XLF A;  5IT9 Z;  4HST A;  4IVN A;  2HVQ A;  1ZG5 A;  3OY9 A;  4LK0 F;  4BEH B;  1HBX G;  1XMA A;  5DTD A;  1R49 A;  3DWL E;  2HDW A;  1YG2 A;  1KZH A;  2WAD A;  2XC7 A;  1RR8 C;  2JRT A;  2ZME C;  3QPT A;  3PO2 J;  2KIF A;  3CUQ B;  2CW0 F;  1IUY A;  3GZ5 A;  5BS6 A;  2DAO A;  1VQ5 I; 
#chains in the Genus database with same CATH homology
 1T2K A;  5DUI A;  2DQL A;  3LAP A;  4AIJ A;  3R0A A;  2X4H A;  4HOB A;  3ZMT A;  3WTS C;  5BOX A;  2P5L C;  3IKT A;  4L18 B;  1U2W A;  2RNJ A;  3JW4 A;  2P6S A;  1U8R A;  1IXR C;  2HGC A;  4EGZ A;  2IA0 A;  3FMR A;  5FD5 A;  2R7F A;  3GW2 A;  4CDG A;  1RUO A;  3ZP5 A;  2FE3 A;  5JFR A;  4H0E A;  1ZRC A;  1LVA A;  1S7A A;  1ZRF A;  4A0X A;  1OYI A;  4ON0 A;  1TQP A;  3ZMU A;  4KYW A;  3HSR A;  2FOK A;  3O6B B;  3HHG A;  4AIK A;  4I0A A;  3FZV A;  2YSR A;  3NEU A;  4IRH A;  3S2W A;  1TQM A;  5CVV A;  4L0Y B;  3EUH A;  4UVB A;  1XGO A;  3BJ6 A;  1KA8 A;  3CUQ A;  2IA2 A;  1B6A A;  3BPX A;  1LB2 A;  2ZME A;  4WX9 A;  3KP5 A;  2K86 A;  4A5M A;  1WRJ A;  4XSZ F;  2HKO A;  3U1D A;  1G4D A;  4YIF A;  2VOD A;  4LLG F;  3GLX A;  4ESJ A;  5LGN A;  1RNL A;  2HTS A;  2XHK A;  4HF0 A;  3GEZ A;  5JI6 A;  2KIM A;  3FF5 A;  4ENJ A;  4R79 A;  4XLN F;  3GX4 X;  4LK1 F;  4O5V A;  2CO5 A;  2KJC A;  3K1N A;  1F9N A;  1BM9 A;  5F6F A;  1P92 A;  2OU2 A;  2YX7 A;  4YII A;  2DPU A;  1QZY A;  3TQN A;  5D8L B;  1KU9 A;  2E7W A;  5BMZ A;  2EV5 A;  4EJT A;  3VOD A;  4MTD A;  5E17 F;  1J5Y A;  1U3E M;  2K02 A;  4CXF A;  1XDU A;  2GA1 A;  3GO5 A;  1OPC A;  2K4B A;  2WC2 A;  1U6G A;  2PQ8 A;  3M7G A;  3WGG A;  3VFZ A;  3BWG A;  3DP7 A;  2M87 A;  2XAS A;  3E3V A;  2CSO A;  4DQ2 A;  4PGH A;  4GXO A;  1U5T C;  4ENM A;  1FBU A;  3GF2 A;  3R0J A;  1STZ A;  3QAH A;  5ICG A;  4IRI A;  3WTW C;  1KYZ A;  2FRH A;  2P6T A;  5DV5 A;  3T8T A;  2PLY A;  5HOO A;  3F3X A;  3DEU A;  1X3U A;  2PMU A;  3WTV C;  3CLO A;  3DQV C;  4L9V A;  4HDV A;  3J80 K;  2AXL A;  3J80 Z;  2EV0 A;  4KFC A;  3WTT C;  4ZZD A;  2UXN A;  1D8J A;  4LMY A;  3QPH A;  1MZB A;  1YTY A;  2PBI A;  4CGZ A;  1KQ9 A;  2QBY B;  2RKH A;  4KIG A;  1WKM A;  5E18 F;  3DXJ F;  3I58 A;  4AWX B;  1MDM B;  4HDU A;  2RN7 A;  1J2X A;  3F8M A;  4RAZ A;  2VC1 A;  1E2X A;  2RGV A;  3DF8 A;  4HW0 A;  2ZNY A;  4I98 B;  1GVJ A;  2IW5 A;  2Z3Y A;  1ZG1 A;  3KZY A;  4U7D A;  3DPT A;  4WF2 A;  2O6G E;  2H6B A;  1J9I A;  4KIC A;  4L5J A;  1SMY F;  2W57 A;  3ULQ B;  1ZH5 A;  2R7D A;  1T6S A;  2ADU A;  1XGS A;  1S3J A;  5E1W A;  2DI3 A;  3LAJ A;  1A04 A;  4M72 A;  4Y15 A;  3V7C A;  1G3Y A;  1ZRD A;  4A5N A;  1MJA A;  5ICC A;  1BC7 C;  2YR2 A;  5CJ9 A;  3D0S A;  3WTX C;  2QBY A;  2VOO A;  2HDC A;  4CHU A;  3KP6 A;  2P7C B;  1MDM A;  4IHS A;  3OOP A;  2YPR A;  5K5R A;  1TBX A;  1NHA A;  5EEG A;  3ROU A;  3R6S A;  2EFO A;  5CVR A;  4RB0 A;  1K6O A;  4G6Q A;  3VEP A;  4PDK A;  1XGN A;  2MA3 A;  2BBY A;  1U78 A;  2QVO A;  1R00 A;  3TDZ C;  1Q1H A;  2EFQ A;  4EQQ A;  2GXG A;  4Y13 A;  3RIR A;  2DT5 A;  5FLX K;  2PFB A;  3RTR A;  4LD5 A;  1PP8 F;  4HX8 A;  2L4M A;  4UV9 A;  1SD5 A;  3E5X A;  1JHH A;  5D8K B;  3I0T A;  3LA7 A;  4G7H F;  4BHB A;  2CQK A;  4GGG A;  1XSV A;  4BAY A;  1W4M A;  3J81 K;  1FP1 D;  3KFW X;  3J81 Z;  2A69 F;  3JSP A;  3BPV A;  4BH9 A;  5F64 A;  2EA4 A;  2FBI A;  3LA3 A;  4L9J A;  1XGM A;  2H27 A;  2V1D A;  1TQI A;  1LEA A;  3JTH A;  5F1R A;  4YG2 F;  4LJZ F;  2L4A A;  3RKX A;  2NAZ A;  1ZLJ A;  1EH7 A;  4LGW A;  4NB5 A;  1YLF A;  4EJV A;  4RB3 C;  2R3S A;  1WWX A;  3P9C A;  1UHW A;  2KJB A;  2ZXJ A;  2CYY A;  1T38 A;  2YX4 A;  2VN2 A;  4G7Z F;  1IN7 A;  4S05 A;  3KZZ A;  1RZ4 A;  2ISY A;  4IJA A;  4IHT A;  1UCR A;  5DD8 A;  2ZO4 A;  3E6C C;  2W24 A;  3M9A A;  1F1Z A;  4HX4 A;  4HF2 A;  5D5W B;  5KVR A;  2HFH A;  2HZT A;  1OYY A;  2DK5 A;  3C18 A;  3WTY C;  3FM3 A;  5LHH A;  2JPB A;  1R5H A;  4XRF A;  3ML6 A;  5LGT A;  3GXO A;  1R1V A;  5CVU A;  3TGN A;  4LFU A;  3K1P A;  2GXB A;  4RB2 C;  4M9X A;  5E8G A;  5CVI A;  3RJP A;  4UV8 A;  3H3U A;  3OV8 A;  1YW8 A;  5L3C A;  3IWF A;  4G6D A;  2C6Y A;  4UXN A;  4WWC A;  1BBY A;  1W7P B;  3KE2 A;  2P4W A;  4P9U A;  2HYF A;  3ZMD A;  2EWN A;  4IPA A;  5LHG A;  2PI0 A;  3WGI A;  4L5I A;  5D5V B;  2G9W A;  3HYI A;  4GO1 A;  3L09 A;  4RGR A;  2G7H A;  4K2E A;  5HS7 A;  1UFM A;  2MH2 A;  2W85 A;  3F8N A;  3GUD A;  4KT5 C;  3ZN1 A;  5D6F A;  2A68 F;  4NHJ A;  3Q9V A;  2ZJ2 A;  2XRN A;  2F5F A;  1ODD A;  3L00 A;  1LQ1 A;  4HQE A;  4HLY A;  4D0P A;  3BY6 A;  2UWM A;  3WOD F;  3ZMV A;  1YO5 C;  2IRF G;  1WI9 A;  2IT0 A;  1UHM A;  5IT9 K;  5D5U B;  4HX7 A;  3REO A;  3SQN A;  2FF4 A;  1R7J A;  1HKS A;  2XKP A;  4Y17 A;  4ZH4 F;  1W7P A;  3ZMS A;  1KU7 A;  4FX0 A;  5HS8 A;  2ZME B;  4P5O A;  3GVA A;  4ASN A;  2IP2 A;  1Z1D A;  4P9F A;  1DP7 P;  3CDH A;  2VBX A;  2VBZ A;  1J7K A;  2D2W A;  4KN4 X;  1CF7 B;  4A2U A;  2A3S A;  4FT8 A;  3F72 A;  3BZ6 A;  2EFN A;  2OQG A;  3E6B A;  3F6V A;  1IN4 A;  1YFH A;  2BEO A;  2O61 A;  1ZGJ A;  2M8E A;  2P7V B;  1SMT A;  4KIF A;  3SHF A;  1Y0U A;  1IN5 A;  2L3D A;  3EYI A;  3DFG A;  4EJO A;  2QQA A;  5HDK A;  1FSH A;  3KLO A;  2L54 A;  4MGR A;  1FP2 A;  4MNU A;  1BIA A;  1FPQ A;  3D5L A;  3ECH A;  3JSO A;  2LDU A;  2F5E A;  4AIH A;  1JE8 A;  1ZYR F;  4MTE A;  1B1B A;  4ENN A;  1SD4 A;  4EGY A;  4KIB A;  5E1Z B;  3T5X A;  1S8N A;  4L9T A;  4ZYD A;  2H94 A;  5E1X A;  1C0W A;  3RYR A;  1FWZ A;  3QRF F;  3K9T A;  1HKQ A;  2E1N A;  2A6H F;  1R23 A;  2RQP A;  3TOB A;  2CFX A;  4U7B A;  1HKT A;  1GXQ A;  3K2Z A;  4JBA A;  1CF7 A;  2QUF A;  1Z7U A;  2RVC A;  3M8E A;  4OMZ A;  2O8X A;  2LNB A;  4JQF A;  1BI3 A;  4U0Y A;  4F7Z A;  4FX4 A;  2QEN A;  5L3D A;  3AAF A;  3TO7 A;  2A6E F;  2NYX A;  3MCZ A;  4BHC A;  3WU0 A;  2V9V A;  3RPU A;  3KP4 A;  4M73 A;  3IKV A;  1FYL A;  1ONV A;  2XAQ A;  1I1S A;  5CYV A;  3KLN A;  5BQT A;  1E17 A;  1SD7 A;  2GQQ A;  2DFI A;  1P6R A;  4G94 A;  3KEO A;  3DV8 A;  2XRO A;  2BYV E;  4Q47 A;  1IW7 F;  1ZLK A;  1O3T A;  5HDG A;  2FMY A;  4EJW A;  1U5T B;  5K5Q A;  1BI2 A;  3M1E A;  3MZY A;  2ETH A;  2D45 A;  1K7A A;  1FYM A;  5LRR A;  1F4K A;  3LA2 A;  1IRF A;  1HW1 A;  3T1B A;  2EFP A;  1FY7 A;  3P9K A;  1Z91 A;  1IZ1 A;  1QBJ A;  2WV0 A;  1YIO A;  2M1B A;  2JTV A;  4WK8 F;  4KDP A;  2ELH A;  2HQN A;  2QQB A;  5H6R A;  3C1D A;  5DCF A;  3CUO A;  2Z99 A;  1I1G A;  5HLG A;  1T39 A;  1P4A A;  3QU3 A;  3QP5 A;  3IRR A;  2ACJ A;  3FWE A;  2PN6 A;  1XSX A;  4LB5 A;  3RKW A;  2Q8K A;  2MLK A;  4CO8 A;  1U5T A;  1TLH B;  4BHP A;  2GZW A;  3N4M A;  4MEX F;  2KIU A;  2FNP A;  3BRO A;  3R4K A;  2HR3 A;  5ILS A;  3IL2 A;  2EV6 A;  2QZ8 A;  2NRA C;  2QM3 A;  5L3E A;  3R61 A;  2JSC A;  3IC7 A;  3RI4 A;  1BJA A;  3L7W A;  4G7O F;  4O6J A;  5DEQ A;  3GFI A;  2FSW A;  2DLL A;  2ZBK A;  2DBB A;  3FMS A;  1V3F A;  2FNA A;  2VBW A;  5AIQ A;  2L01 A;  3L9F A;  4OIP F;  1L3L A;  4XBF A;  4RS8 A;  2VC0 A;  1IAW A;  2TDX A;  2STW A;  1MJ9 A;  4UHT A;  3HTS B;  1HQC A;  1EV7 A;  2XAJ A;  1FOK A;  1KU2 A;  2VT2 A;  5HVQ C;  1P2F A;  3WE3 A;  1O3S A;  4UVA A;  4BYY A;  3SFZ A;  2IPQ X;  1G3W A;  3L2C A;  1ZGA A;  4BXU A;  4IF4 A;  2DPD A;  1BN5 A;  1P4X A;  4AVP A;  3RDI A;  1K79 A;  2UZK A;  3P7N A;  1GXP A;  5LBQ A;  4XLP F;  5FO5 A;  4DNC A;  2P5V A;  1FBS A;  3EQL F;  3F8C A;  1FLI A;  2FML A;  4B8X A;  3HRM A;  4N9H A;  3KP7 A;  2OAZ A;  3GZ6 A;  3CO6 C;  4ETS A;  4UNO A;  2PG4 A;  1ON1 A;  3LWF A;  3DPL C;  1AWC A;  2GIV A;  3WE2 A;  1OR7 A;  1FNN A;  5BPI A;  5ICE A;  4EM1 A;  3C3W A;  5LHI A;  1JGS A;  3COA C;  4RB1 A;  3HHH A;  1H0M A;  2FU4 A;  1JHF A;  4ZYG A;  1J75 A;  2LSO A;  4HAM A;  1L0O C;  4FHT A;  4WXD A;  3BJA A;  2XAG A;  2QLZ A;  2WWY A;  4OIQ F;  2DQR A;  3CO7 C;  4A6D A;  4QLC U;  2O0Y A;  4LB6 B;  3QU6 A;  2CWE A;  1BI1 A;  1QNT A;  5ERI A;  1FYK A;  4Q5S F;  1FZP B;  3RYP A;  5CLS A;  2MBF A;  3K69 A;  2A5Y B;  4EM2 A;  3KP3 A;  4KMU X;  3FX3 A;  1YYV A;  1YW9 A;  2HTJ A;  2KKO A;  5HLI A;  3FHZ A;  5ED4 A;  1LJ9 A;  1HW2 A;  3T8R A;  2DTR A;  1S6L A;  3V7R A;  2PMH A;  2VON A;  2OZU A;  2Z9O A;  5E8I A;  3V8K A;  6PAX A;  1H9T A;  3U2R A;  4KNY A;  3PQJ A;  3PQK A;  2F5C A;  5ILU A;  4WXH A;  3BDD A;  3BOQ A;  2MD5 A;  4RAY A;  2HS5 A;  4I7H A;  4PCQ A;  3MZH A;  5K5O A;  1S29 A;  3WU1 B;  2E7X A;  4ENK A;  3I59 A;  3MEX A;  1HW5 A;  5LLQ A;  5K1Y A;  4BQA A;  4I0B A;  5L3F A;  2HEO A;  1XCB A;  4I2O A;  3WTZ A;  4IRG A;  3TDU C;  3HUG A;  1RUN A;  5JHU A;  3IWZ A;  1IXS B;  1EH6 A;  2VE8 A;  2A61 A;  3GYH X;  3M8F A;  3F23 A;  4MQ9 F;  2G7U A;  3ISP A;  5E20 A;  5LEK A;  3U9G A;  2OZ6 A;  1ZAR A;  1HST A;  1TNT A;  2M5W A;  3W6K B;  2HWV A;  5HLH A;  1OMI A;  1D5V A;  1KU3 A;  1O3R A;  2JPC A;  1XSD A;  1FC3 A;  3HIF A;  5A2Q Z;  1FT9 A;  2F2E A;  3I4P A;  3N97 A;  2VE9 A;  1QZZ A;  4Q4Z F;  3HRT A;  3CJN A;  3ZPL A;  2O03 A;  2XKO A;  1YS6 A;  2IJL A;  5D6E A;  3CUQ C;  5BPD A;  2QQ9 A;  2GWR A;  4TV7 A;  4Q48 A;  4OIR F;  4E70 A;  3IHU A;  5DD4 A;  4GYG A;  2X0L A;  3MQ0 A;  4G9Y A;  5LGU A;  3TO6 A;  4LLL A;  3MFK A;  4GYI A;  2BGC A;  4CIC A;  3QP6 A;  2ESN A;  4A0Z A;  5IT3 A;  4A12 A;  3H92 A;  1ZHF A;  2EA2 A;  2J5P A;  2EFW A;  4EV0 A;  1D8K A;  4ZYE A;  3F6O A;  3Q5F A;  3WG9 A;  2ZFW A;  3I64 A;  4HV6 A;  3VB2 A;  2XGX A;  4A6E A;  4ZYH A;  4L0Z B;  5L3B A;  1IXC A;  4I09 A;  2PJP A;  4HA8 A;  3HSE A;  4HLX A;  4KMF A;  4M71 A;  2UXX A;  3VOE A;  1XMK A;  1DDN A;  1FSE A;  2F5D A;  2ISZ A;  3H3Z A;  2Y0M A;  4R1H A;  1RIO H;  2DO7 A;  1V4R A;  2W84 A;  3KET A;  3E6M A;  4L9N A;  1XB4 A;  1TTY A;  4I01 A;  5DCM B;  2XV4 S;  4LG0 B;  2COM A;  3ZQ7 A;  1ZN2 A;  2P5K A;  4BNC A;  4EVI A;  2MH9 A;  3MAJ A;  1ULY A;  3O3K A;  2OA4 A;  3LST A;  3ZMZ A;  3FXQ A;  1G3S A;  4MQV A;  3HRU A;  2V1X A;  2MC3 A;  4YFN F;  1SAX A;  3E5U A;  1LDJ A;  2FXA A;  3ECO A;  3KCC A;  2B0L A;  1XDS A;  4MHG A;  3BP8 A;  5CVJ A;  2EB7 A;  1LDD A;  3ABU A;  5H20 A;  1BI0 A;  3BJO A;  4S04 A;  5J8F A;  5KK1 A;  3SZP A;  1G3T A;  1IN6 A;  4IXA A;  3F8F A;  1B9N A;  3RPQ A;  2XVC A;  1MD0 A;  5FFX A;  4P55 A;  2BV6 A;  4M6Y A;  1I6X A;  4ESB A;  1O3Q A;  1R5G A;  1W5T A;  2CGP A;  1VTN C;  2L02 A;  1AOY A;  1W7P D;  4PZJ A;  2DW4 A;  2LF8 A;  5DCM A;  3RKY A;  4LG0 A;  1SD6 A;  3E97 A;  4HQM A;  4HZF A;  2H6C A;  3V8L A;  2OQR A;  2OBP A;  1FX7 A;  4M74 A;  1B59 A;  3QOP A;  4I02 A;  4ESF A;  4OOI A;  2EJR A;  2P8T A;  1YW7 A;  1PP7 U;  5FFZ A;  2EK5 A;  3R60 A;  5D4R A;  2E1C A;  4XSX F;  1Z05 A;  3HOT A;  3PFI A;  4HF1 A;  3GFL A;  1WQ2 A;  4EJU A;  3HSF A;  1I27 A;  1I5Z A;  1KGS A;  3TO9 A;  1QPM A;  1T0F A;  2AS5 F;  1LDK B;  1HSJ A;  2FQ3 A;  1OYW A;  1DPR A;  1R1U A;  4G8X A;  3F8B A;  2H09 A;  3W6J B;  3B73 A;  2FEZ A;  3HOS A;  2NS0 A;  1J0R A;  3K1M A;  5EEH A;  1Z9C A;  1D3Y A;  1WSU A;  3TKY A;  4ZZL A;  2VT3 A;  2HOE A;  2GA2 A;  4KN7 X;  3ZN0 A;  1XD7 A;  4HYE A;  1O57 A;  1HXD A;  2W25 A;  4O3M A;  4RGX A;  1S7O A;  3K0L A;  1MJB A;  3FMQ A;  3V8J A;  5DUK A;  4R8H A;  2ZKZ A;  2ESH A;  4CZZ A;  3V7S A;  3KEQ A;  2Z33 A;  5FGM A;  2QYO A;  5JVT A;  3V4G A;  2M30 A;  2VXZ A;  3DKW A;  4M6X A;  3E6D A;  2O3F A;  1YS7 A;  4P96 A;  5J6X A;  1JXS A;  2FA5 A;  4MEY F;  2Z5U A;  4Z2Y A;  2QWW A;  5H6Q A;  2Q2E A;  1IRG A;  4WXC A;  2XAF A;  1T98 A;  3F21 A;  1QO0 D;  2HKX A;  3SXY A;  3HTU A;  1B4A A;  2JT1 A;  4OIN F;  4RGS A;  1KQ0 A;  1ZG3 A;  3I71 A;  1F5T A;  5LEJ A;  4OU0 A;  1OKR A;  4WCG A;  2STT A;  2ZNZ A;  2J5O A;  5FLX Z;  4U88 A;  4N9I A;  3G3Z A;  1EH8 A;  2Y48 A;  3JAM K;  3JAM Z;  1IN8 A;  4U0V A;  2XUB A;  5J8C A;  3CTA A;  2HQR A;  1PUE E;  3J7A O;  2D1V A;  1XCV A;  4HBL A;  4OMY A;  1SFE A;  2K4J A;  2RDP A;  3I53 A;  5D5X B;  2A07 F;  3ABT A;  1IF1 A;  2CG4 A;  2IA1 A;  4HV5 A;  4A0Y A;  3SZT A;  3FXU A;  2LF7 A;  2Y75 A;  1PDN C;  3O2P E;  3NQO A;  3LQQ A;  2DK8 A;  4PGG A;  3F22 A;  3LFK A;  2V79 A;  4UUV A;  1KQ8 A;  3P9I A;  1GHC A;  1TNS A;  1ZAO A;  2YU3 A;  2GAU A;  1YQA A;  3NRV A;  4EM0 B;  1QQI A;  2PEX A;  3Q9S A;  3I59 B;  2LKP A;  1K78 B;  3IRQ A;  3G73 A;  1W5S A;  3GFM A;  1QGP A;  5ICF A;  2ZCW A;  1R1T A;  4JK1 X;  1H9G A;  3EYY A;  2WTE A;  2D1H A;  3C7J A;  1P4W A;  4UVC A;  1UST A;  3EDP A;  1RI7 A;  2JZY A;  1ON2 A;  1BC8 C;  1FBQ A;  4GCV A;  1SFX A;  5FD6 A;  1B9M A;  3WGH A;  4M9Z A;  2XAH A;  5AON A;  2VBY A;  4N0B A;  1R22 A;  1XN7 A;  2M45 A;  1SFU A;  4KA4 A;  2KRF A;  2BE5 F;  2XIG A;  3GFJ A;  3B02 A;  1LNW A;  3EET A;  1MKM A;  3T0Y A;  2FBH A;  5L3G A;  4M9S A;  1Z6R A;  1O7F A;  2MLG A;  2HYG D;  1KYW A;  3MWM A;  3I5U A;  5FB2 A;  1K78 A;  3JTG A;  2Q0O A;  3FXR A;  5AIP A;  4YFK F;  2K7L A;  1ZRE A;  4CYD A;  1G6N A;  4KUM A;  5DDG A;  3FM5 A;  3LQR A;  3ERE D;  3KP2 A;  2DU9 A;  5LRS A;  5D4S A;  2OD5 A;  1MGT A;  3TOA A;  5DYM A;  3GWZ A;  2RV8 A;  3E5Q A;  1LEB A;  1REP C;  1J59 A;  5HDN A;  3ELK A;  2NNN A;  3WTU C;  4B09 A;  4LLN A;  3I54 A;  1BIB A;  1DUX C;  1R58 A;  1O7L A;  4QWQ A;  1Z6T A;  4RGU A;  4AD9 A;  1CGP A;  3HRS A;  2VOP A;  1USS A;  1UB9 A;  4NQW A;  5A2Q K;  5JR3 A;  1R36 A;  2K27 A;  5TRD A;  5ILV A;  4EMS A;  2FBK A;  2NNY A;  1DPU A;  4YFX F;  1TW3 A;  5HS9 A;  5TJJ A;  4U0W A;  1TW2 A;  2V1U A;  1BOA A;  2IVM A;  2V6C A;  2RC4 A;  5IT9 Z;  4IVN A;  1ZG5 A;  4LK0 F;  1HBX G;  1XMA A;  1YG2 A;  2JRT A;  3QPT A;  2KIF A;  3CUQ B;  2CW0 F;  1IUY A;  3GZ5 A;  5BS6 A;  2DAO A;  4OIO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...