2F5EA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ab conformation, ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
135
structure length
131
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 52
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5eA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5eA02
3EQLF 4XLPF 4M73A 2EWNA 5CVIA 3V8KA 4A6DA 4A2UA 5LHHA 3GXOA 3L00A 2IVMA 3R61A 1KU9A 4HX7A 4LJZF 4P9FA 3CO7C 3BROA 2IA1A 2P6TA 4HLYA 2VODA 3KE2A 3QU3A 3WE2A 4H0EA 2L01A 3WTYC 2EFNA 1L0OC 3E3VA 3JW4A 3RKXA 3U9GA 3CTAA 3KZZA 4ZYGA 3ZQ7A 3ZMTA 3R0AA 4KDPA 2GXGA 4KIBA 4EJWA 1R1UA 2W85A 3SZTA 4RB1A 3QP6A 4M6XA 2V1UA 2HDCA 4KIGA 5E1ZB 2W25A 5L3BA 1KQ0A 4UUVA 3LQRA 3RI4A 1LNWA 2PBIA 2Y48A 3GO5A 2TDXA 2QZ8A 2HWVA 3OV8A 3T5XA 1XGOA 1J2XA 3GFIA 3LWFA 4LG0A 5ICEA 2YPRA 3F21A 3IKTA 3E5XA 2Z99A 5E8GA 1ZRCA 5IT9Z 1ZHFA 4NHJA 2D2WA 4Y13A 3HTSB 2H6CA 4LK0F 1EH7A 5LBQA 3BOQA 2ESHA 3WG9A 4HW0A 4LG0B 5D5WB 4GYIA 5DDGA 3IRRA 2EFWA 3BPXA 4G7ZF 3ZP5A 3V8LA 3ZMVA 3HHGA 4ENMA 3ZN0A 1YFHA 1ZG3A 4HQMA 2EV5A 4U0YA 4QWQA 1ZH5A 2FA5A 3I5UA 1S7OA 4KNYA 1D5VA 1BC8C 1YIOA 5HS8A 4JBAA 2M30A 2A68F 2FQ3A 1ZRDA 1LEAA 5HLGA 2OAZA 4MGRA 4RGUA 3DPTA 4U7DA 3KCCA 3V7CA 2P6SA 4IHSA 1QZYA 4CO8A 1SD5A 3L2CA 4RB3C 1HW1A 3M9AA 4N9HA 1EV7A 3I54A 3J81Z 1TW3A 1C0WA 3TO7A 5K5OA 1ZG1A 1SFXA 2Z33A 2FMYA 5D5XB 4B09A 2ZNYA 1FLIA 2HKOA 4DNCA 5FLXK 3K9TA 1ZAOA 3S2WA 4EMSA 2Q2EA 2VC0A 4GCVA 3V7SA 1R58A 4BXUA 1LQ1A 2X0LA 2F5FA 4Q4ZF 2F5DA 2CG4A 1OYYA 2L02A 3ECHA 3E97A 1FSHA 5FO5A 2XIGA 3BJOA 1SD6A 4ENNA 3J81K 2NAZA 3GFMA 1JHFA 3IRQA 1KU3A 2H09A 1YTYA 1LDDA 4YIIA 3WTZA 4KUMA 3KEOA 3V4GA 2PLYA 1EH6A 2FU4A 2CQKA 3R4KA 3FX3A 2DT5A 4RAZA 3ZMUA 2E1CA 1ZLKA 1CF7A 4WCGA 3F23A 5BPIA 3F8BA 4IVNA 3VB2A 2KIMA 1U8RA 1DUXC 5AIPA 3FXRA 1A04A 2KIFA 3RYPA 4ZYEA 3LA2A 2K02A 5L3CA 2FNPA 3ABTA 2G7HA 2O8XA 2V6CA 1CF7B 2VN2A 1E2XA 2FRHA 5K5RA 4LLNA 2VT2A 3R6SA 3QRFF 3HYIA 3REOA 1BIBA 4ENKA 2DTRA 1Y0UA 2DPUA 1BM9A 1YLFA 3TDUC 3CDHA 3GYHX 4YFKF 4YFNF 2KRFA 4I02A 1HSTA 1HBXG 2Q8KA 3BJAA 4MQ9F 1J59A 4WXDA 4Q47A 3SXYA 1D8KA 2PMUA 6PAXA 2A69F 3ECOA 3HRSA 4EGYA 2STWA 5JHUA 2HEOA 4XBFA 3M8EA 4O5VA 2EA4A 3I4PA 1R5HA 3M1EA 1MJAA 2RC4A 2XVCA 3BP8A 3O2PE 5BQTA 3FF5A 3KETA 4K2EA 4MHGA 1K7AA 3IL2A 4I7HA 4ZYHA 4Q5SF 2PI0A 4BH9A 3O3KA 1KYWA 1KU2A 5EEGA 3B73A 1GXPA 3C7JA 4O6JA 2VXZA 2G7UA 2ZKZA 1G3YA 1RUNA 4IRIA 1H0MA 4MQVA 2HKXA 4L18B 3FXQA 2XUBA 3IHUA 1XSDA 4WXCA 1K78B 4RGRA 3DXJF 2J5OA 1UB9A 1XB4A 1H9GA 4DQ2A 2ISYA 5E17F 3SZPA 4Y15A 1I1SA 4YIFA 3T8TA 2HR3A 3F8CA 1HKTA 1ODDA 3F8NA 5FB2A 1F1ZA 1MZBA 1Z1DA 2HFHA 4G9YA 1HKQA 1J9IA 2BYVE 3H3UA 2MBFA 4G94A 2ZCWA 3NQOA 2YR2A 3HRTA 1REPC 1V4RA 3I0TA 4MNUA 3GWZA 1YW9A 2FMLA 2P7CB 4F7ZA 1OKRA 2DW4A 1O7LA 2BGCA 5H6RA 3HRMA 3WODF 2VBZA 3MQ0A 3I59B 1B4AA 1ONVA 5HDKA 4NB5A 3ELKA 2E7XA 3HSRA 3WTTC 4M71A 3U2RA 1FBQA 4L0ZB 4A12A 3TQNA 2ADUA 5ICFA 1XSVA 2XHKA 5DCFA 2RQPA 4AVPA 4HF0A 2ACJA 3F8FA 2DQLA 2MC3A 2L4MA 2E1NA 1JHHA 1QQIA 1U2WA 1L3LA 2JSCA 1TNSA 1TW2A 1R7JA 3VFZA 2EFOA 4WWCA 1MD0A 2Z3YA 1LDKB 4KA4A 3JSOA 3P9KA 4GGGA 2XKPA 1LVAA 4Q48A 5HLHA 1X3UA 4MTEA 3KLOA 2RKHA 5DUKA 2K4BA 3JAMZ 4BQAA 3RKYA 3JSPA 2OD5A 3MZYA 1XGMA 2YX7A 1OYIA 3EYYA 4MEXF 5AONA 1IXRC 4I0AA 3Q9VA 1TQPA 2LKPA 1PP8F 3IC7A 3CJNA 4L9TA 3GX4X 3HRUA 4PCQA 2IJLA 4WF2A 3TKYA 1IF1A 4KMFA 5HS7A 2XAFA 1FBUA 1J0RA 1ZRFA 4OMZA 4ESFA 3DF8A 3EDPA 1B9NA 4ETSA 3BZ6A 2HQNA 1Z7UA 2IW5A 2XAJA 1YS7A 2QUFA 3ABUA 3EUHA 3HSFA 2JZYA 4RB2C 1WWXA 4BAYA 3FM3A 1I6XA 3KP2A 2ISZA 3JAMK 4CHUA 1P92A 5LGUA 4RS8A 3W6JB 3DP7A 2QBYB 3T8RA 1O3TA 2HTJA 4G6DA 1ON1A 4U88A 3TO6A 1FP2A 5LHIA 3HOTA 1U3EM 2YX4A 2GZWA 3L9FA 1FYLA 3IWFA 2HGCA 3VOEA 3HTUA 3BWGA 4A0XA 3G3ZA 4EQQA 1ZLJA 2GA2A 2H27A 4XSZF 1O3RA 5CYVA 1WKMA 5L3DA 5E8IA 3LA7A 1O57A 2Z5UA 4MEYF 5E1XA 2QM3A 3LAJA 3GFJA 1FWZA 4G6QA 5CLSA 2K27A 2A07F 2MA3A 4AIHA 4HQEA 3W6KB 4G7OF 1BBYA 1I5ZA 1IW7F 4B8XA 3F22A 4ESJA 5HVQC 2EV0A 2RNJA 5KK1A 2CW0F 2FE3A 3R60A 2DLLA 4FHTA 1LB2A 4EGZA 2HYFA 1G3SA 1HW5A 3WGIA 2BE5F 1AWCA 4L5IA 4PGHA 5IT9K 4IJAA 2OZUA 2OQGA 3WE3A 2ZMEB 4U7BA 5J6XA 4ASNA 2O03A 2KKOA 3I71A 4HDVA 4WXHA 1ZN2A 3FZVA 2CWEA 2XRNA 3K1PA 5DEQA 5D5VB 5ILVA 3P7NA 1QNTA 2QYOA 2NRAC 3ULQB 1XGNA 2XROA 1UHMA 3D5LA 3I58A 5DD4A 1XDSA 3WTSC 4UNOA 4UXNA 1SFEA 4NQWA 3KEQA 4R8HA 5D4RA 4UHTA 3P9IA 5D8KB 1IRFA 2K4JA 4P96A 2DPDA 2UZKA 2MLKA 5CVJA 4I0BA 4N9IA 3DQVC 3TO9A 3BPVA 1T6SA 2GWRA 1SD7A 2STTA 4HX4A 4OIQF 2O61A 3K1NA 2JPCA 3I64A 5HDNA 1TTYA 5IT3A 2YSRA 1USTA 3DEUA 1V3FA 2NNYA 2ESNA 4EM0B 3OOPA 3E6DA 4M72A 2F5CA 2HZTA 3LA3A 5KVRA 3KP3A 1S7AA 1J7KA 2O3FA 5D6EA 2F2EA 2FOKA 2KJBA 2YU3A 1QO0D 1R1TA 2KJCA 5DYMA 5FD5A 4UVBA 5EEHA 1MDMB 5CVRA 3TOBA 3KP7A 2H6BA 4HDUA 3GLXA 3WTXC 4WX9A 1W5SA 4OOIA 1DP7P 2UWMA 1YG2A 2D1HA 2E7WA 4RGXA 2W57A 3KFWX 4L5JA 3V8JA 1USSA 4KFCA 2RGVA 2EA2A 2M87A 3FM5A 1FZPB 2W24A 2XAGA 3GZ5A 1BI2A 3LSTA 5J8CA 3D0SA 4S05A 1FNNA 1W5TA 1ON2A 1XCVA 3GW2A 3SHFA 1XN7A 1ULYA 1P2FA 4HBLA 2VBWA 2A6EF 5LGTA 3MZHA 5J8FA 4HA8A 5DUIA 1J75A 4XLNF 5HS9A 3COAC 1D3YA 2IPQX 3KLNA 4EM2A 1WSUA 4CYDA 1SD4A 5H6QA 2CFXA 1IN5A 4EVIA 2EFPA 3TDZC 2ZNZA 2QENA 2Y75A 3VEPA 1HKSA 3FMSA 2LF7A 2V79A 2RDPA 5ED4A 3QOPA 4KIFA 1K78A 2RN7A 1UCRA 4D0PA 3L7WA 2DU9A 2DAOA 5CJ9A 3K0LA 2NS0A 2P7VB 2L4AA 2O0YA 1G6NA 3Q9SA 5LRSA 2MH2A 2GQQA 4OMYA 3ZN1A 2GAUA 1YYVA 2DFIA 2XAHA 5BMZA 1JE8A 2IA2A 3RKWA 1P4AA 1EH8A 2P5VA 3CUQC 3P9CA 1OMIA 2M8EA 4KN7X 1RIOH 5BOXA 1BC7C 2WC2A 3FMRA 1SAXA 1W7PB 1I27A 2GA1A 2VE8A 5BS6A 2PN6A 4YFXF 2VONA 1FOKA 1Z6RA 5HDGA 1IAWA 2PG4A 2LNBA 2JTVA 1JGSA 3I59A 2EFQA 4GO1A 4HZFA 2M1BA 1YS6A 1JXSA 3WTUC 1KYZA 1KU7A 3T1BA 3IWZA 2PJPA 4I2OA 3J80Z 4LLLA 3FWEA 1OR7A 5LGNA 4BNCA 3Q5FA 3ZMDA 5LHGA 1FC3A 3E6MA 2R3SA 4JK1X 4LGWA 3E5UA 4HOBA 2OZ6A 4S04A 3GF2A 3RIRA 3H3ZA 1YQAA 3J7AO 1BN5A 1KQ9A 3ZMSA 5ERIA 1IZ1A 1U78A 3WU0A 5TRDA 3H92A 4OINF 4GYGA 3LFKA 1OYWA 5HOOA 4ZYDA 1U5TB 3QP5A 1CGPA 4CDGA 2EV6A 1FP1D 3RPUA 3J80K 3GEZA 3LQQA 2FXAA 1KA8A 2A6HF 2WTEA 2HQRA 2O6GE 5DD8A 1HW2A 3N97A 1QPMA 2V9VA 2EJRA 2VBYA 3GUDA 2HYGD 2IT0A 5E1WA 4U0WA 3NRVA 2FNAA 4QLCU 4UV8A 5E18F 1B59A 4OIOF 4AWXB 4YG2F 2GIVA 2K86A 1R5GA 2JPBA 4ESBA 2VOPA 1STZA 5A2QZ 2Z9OA 1WI9A 4P55A 5FFXA 4BHPA 1ZARA 1BOAA 1HXDA 2MLGA 3JTGA 3VODA 4RB0A 1R22A 1NHAA 2VC1A 2BV6A 1VTNC 3KZYA 3HSEA 2M5WA 2QBYA 4I98B 4LB5A 1QZZA 5L3EA 3ERED 1KQ8A 3MEXA 5ILSA 1IN4A 3GFLA 1W7PD 4A6EA 3WTWC 5CVVA 4Y17A 4M9ZA 4IXAA 4KMUX 1PDNC 4EJUA 1BI3A 2COMA 2DBBA 4LLGF 1Z9CA 3T0YA 2DK8A 2GXBA 3MWMA 3F6OA 3FMQA 2PFBA 4HF1A 4IHTA 2ZFWA 3ISPA 3C3WA 5A2QK 4L9JA 3F3XA 4M9XA 3KP6A 1XD7A 2FSWA 1ZREA 4JQFA 1O7FA 3WGGA 4ENJA 4KICA 4A0YA 1S8NA 4I01A 1S29A 4EJVA 5L3FA 1AOYA 1RUOA 3RTRA 5ICCA 3JTHA 1W4MA 3PQKA 3DPLC 3G73A 2XV4S 2OA4A 1FYMA 3N4MA 4A5MA 2HOEA 1PP7U 1DDNA 2DK5A 1WRJA 1U5TC 2BEOA 3CO6C 2ZMEA 1R36A 1RI7A 5LLQA 3QPTA 1S6LA 3HHHA 2Q0OA 4EV0A 4HX8A 4HLXA 4Z2YA 2P5LC 5LEKA 2DI3A 2EK5A 1XCBA 3K2ZA 2VT3A 5K1YA 3E5QA 1OPCA 3QAHA 2XASA 3E6CC 4AIJA 4AD9A 1IN8A 2OBPA 3R0JA 1D8JA 1QGPA 3RPQA 5HLIA 1SMTA 2R7FA 5FLXZ 1I1GA 2VE9A 1R00A 2AS5F 2V1XA 3AAFA 2ETHA 5DCMA 1K79A 1P4WA 3I53A 3WU1B 1T98A 4WK8F 1LDJA 4BYYA 2J5PA 3QPHA 1LJ9A 3M7GA 4LMYA 4E70A 1O3SA 4FT8A 3DFGA 1DPRA 3QU6A 3C18A 3F72A 3FHZA 2IP2A 3DKWA 1ZGAA 5F64A 1GXQA 5DCMB 1FT9A 2QQ9A 4ZZDA 2Y0MA 4HV6A 1B1BA 4TV7A 2HTSA 4OIPF 1UHWA 1HSJA 2R7DA 3CUQA 2UXNA 2IRFG 5FD6A 3K1MA 1ZG5A 1IN7A 5TJJA 4R79A 1MDMA 4HV5A 3HOSA 4HF2A 3BJ6A 4PGGA 4CGZA 5JFRA 3GZ6A 4L9VA 1YW7A 2XAQA 3M8FA 5D5UB 2ZBKA 2MH9A 2L54A 3F8MA 1F9NA 4HYEA 2G9WA 4PZJA 3CUQB 1P4XA 1GHCA 3MAJA 2X4HA 1ZGJA 1XDUA 2P5KA 2C6YA 1IXCA 2MD5A 1F5TA 1IN6A 2V1DA 1TLHB 3RYRA 4CICA 4UV9A 2IA0A 5JVTA 2CYYA 1IRGA 1RZ4A 1PUEE 3O6BB 3KP5A 4LB6B 2ELHA 2L3DA 2BBYA 1R1VA 3BDDA 2D1VA 2A5YB 4G8XA 4ZH4F 1XSXA 1P6RA 2PMHA 4IPAA 2OQRA 4L9NA 5D6FA 5L3GA 2OU2A 4BHCA 5F6FA 2WWYA 1GVJA 1DPUA 1XGSA 4KN4X 2XGXA 1BIAA 2AXLA 2FBIA 2JT1A 2WV0A 4A5NA 3WTVC 5ILUA 1BI0A 2FEZA 1K6OA 3MFKA 3SQNA 1T2KA 3ZPLA 5D4SA 4G7HF 4R1HA 1T39A 1T38A 2H94A 1FBSA 1BJAA 3HIFA 2CO5A 1BI1A 4FX0A 2HS5A 1WQ2A 3KP4A 1IXSB 2K7LA 4IRHA 2M45A 1IUYA 1G3TA 3HUGA 3RJPA 4KYWA 1FSEA 1F4KA 4MTDA 5DV5A 2A61A 2PEXA 4OIRF 1T0FA 1R23A 1U6GA 3DV8A 5H20A 4O3MA 1B9MA 4P9UA 1MKMA 1HQCA 1XMAA 2DO7A 2PQ8A 1H9TA 4L0YB 1RNLA 2FBKA 2UXXA 3MCZA 2ZJ2A 1FX7A 5CVUA 2D45A 4CXFA 1W7PA 2NYXA 2DQRA 4OU0A 1MJ9A 4M6YA 2F5EA 4ZZLA 2XKOA 4LD5A 5JI6A 2QWWA 2LSOA 2ZXJA 4IF4A 3TGNA 1SMYF 1TNTA 1Z91A 4M9SA 4XSXF 3WGHA 1G3WA 3RDIA 5ICGA 2QQAA 2QLZA 4EJTA 4HAMA 1J5YA 2LDUA 2VOOA 2P8TA 5JR3A 1TBXA 3K69A 5AIQA 4M74A 3NEUA 2B0LA 4BHBA 3ROUA 3V7RA 4UVCA 4N0BA 1UFMA 2FF4A 2W84A 1SFUA 5E20A 1TQMA 3FXUA 2VBXA 3B02A 3BY6A 4EM1A 2A3SA 1Z05A 2QVOA 4EJOA 3LAPA 4GXOA 4A0ZA 1FYKA 1G4DA 5FFZA 2LF8A 1O3QA 5F1RA 3ZMZA 1U5TA 1QBJA 4XRFA 4LFUA 1YO5C 2FBHA 3SFZA 4KT5C 5FGMA 4P5OA 4AIKA 5LEJA 4IRGA 4ON0A 1FPQA 5LRRA 2QQBA 3IKVA 3EETA 3EYIA 3PQJA 4CZZA 1XMKA 1YW8A 3GVAA 3L09A 1E17A 1MJBA 5K5QA 2CGPA 3C1DA 1S3JA 3ML6A 4RAYA 2EB7A 3CLOA 1ZYRF 1MGTA 3PFIA 2NNNA 2KIUA 4LK1F 2JRTA 2RVCA 1FY7A 4FX4A 1KGSA 4I09A 1Z6TA 1TQIA 4U0VA 3F6VA 3TOAA 1LEBA 3CUOA 3E6BA 4PDKA 2P4WA 5BPDA 1B6AA 2CSOA 2ZO4A 1Q1HA 4RGSA 3U1DA 4UVAA 5D8LB 2RV8A
chains in the Genus database with same CATH superfamily
3EQLF 4XLPF 3FK6A 2LR8A 4JX4A 4M73A 2EWNA 5CVIA 2XF6A 3V8KA 4A6DA 4A2UA 5LHHA 1HOMA 3GXOA 4XKBA 3L00A 3IP4B 2ZSHB 2IVMA 3R61A 3GZNB 1JGGA 1KU9A 4HX7A 4LJZF 4P9FA 2GLOA 2R5ZA 3CO7C 3S1RJ 3S3MA 3BROA 2NOJB 2QCOA 4NC6A 1T8IA 4J19A 2IA1A 1IV8A 2F4OB 2P6TA 4HLYA 4MO7A 2VODA 2DOEA 2R7SA 3KE2A 3QU3A 1QVUA 3WE2A 4H0EA 2L01A 1ZR4A 1IDYA 3MKZA 3WTYC 2EFNA 3H3VK 1L0OC 3AG3H 3E3VA 3JW4A 3RKXA 3ZCOA 1A31A 2OCCH 3U9GA 3CTAA 4NC8A 3DU6A 3KZZA 3LSMA 3ZQ7A 4ZYGA 2HOTA 3ZMTA 2X85A 3R0AA 4BKXA 3DLAA 2VQCA 5EGOB 1MW7A 4BJ5C 3F0CA 4KDPA 2HOSA 2GXGA 3PUBA 1JKOC 4KIBA 4EJWA 4CUGA 2CQQA 1R1UA 3JRHA 2E1OA 2W85A 1EKEA 3FXJA 3FXOA 5J47A 1F43A 3SZTA 1W36C 3KPHA 4RB1A 3QP6A 4M6XA 2V1UA 3AKZA 2HDCA 1YOVB 4KIGA 5E1ZB 4BGDA 2W25A 2JRMA 4ITVA 2DA1A 5L3BA 1KQ0A 4UUVA 1Y1WJ 3LQRA 3AG1H 3RI4A 2CU7A 3S16J 1S5LC 1LNWA 1TWFJ 2PBIA 2Y48A 3GO5A 4A69C 2TDXA 2QZ8A 5CQEA 2HWVA 3H5RA 3OV8A 3T5XA 1XGOA 4RDUA 1J2XA 2E5NA 3GFIA 1ETQA 5GPCA 3LWFA 4LG0A 3HOXJ 2W00A 3KIOA 5ICEA 2YPRA 1H8AC 4XONA 5EG0A 3F21A 3K4CA 3RZDJ 3IKTA 3E5XA 2Z99A 3ESWB 3GTLJ 1LFPA 4IO9F 1GUUA 5E8GA 2LYCA 1G2HA 1ZRCA 5IT9Z 4JOMA 2OJED 4IHWA 1ZHFA 3KYCB 4NHJA 2D2WA 4Y13A 1S9HA 3KX2A 3CF5F 1ZQ3P 3HTSB 4ZDLA 1VQLI 2H6CA 4LK0F 3G2BA 1EH7A 2KISA 3A0BC 3SEQA 1OR7C 1Y8QB 2MYSA 3H9JA 5LBQA 1JKQC 2LREA 2LRDA 1TL8A 3BOQA 2DODA 2ESHA 2ZB9A 4B3XA 3WG9A 2HQ5A 3CC4I 4HW0A 4LG0B 5D5WB 1TWHJ 4GYIA 5DDGA 1Y6IA 3IRRA 2EFWA 3BPXA 2KRHA 4A3EJ 4G7ZF 2VLAA 2VKVA 1K61A 3ZP5A 3V8LA 3ZMVA 3HHGA 4ENMA 3FKJA 3ZN0A 1BR1A 3OYCA 1YFHA 3S17J 1D5YA 4GRIA 2Z16A 1ZG3A 4HQMA 1HDPA 2EV5A 4U0YA 4QWQA 2LBFB 5IP7J 1ZH5A 2CUEA 2FA5A 3FK7A 3I5UA 3A4CA 2P0TA 1YHQI 4IOAF 1S7OA 4KNYA 2WB1A 1Y1VJ 5DM7F 2MGQA 2ZFUA 2E5ZA 4XN0A 3CDLA 1JTXA 1D5VA 1BC8C 2M0MA 3VWBA 1K4TA 3K7AJ 1YIOA 4EATA 2JA2A 3BG5A 5HS8A 4JBAA 2IS1A 2M30A 2FQ3A 1XTAA 2A68F 4E4HA 1LEAA 1IV6A 1ZRDA 3PO2J 5HLGA 4XLFA 2XGCA 2OAZA 3K2AA 4MGRA 4RGUA 1WGXA 3DPTA 4U7DA 4A3IJ 3J7AW 3BR6A 3KCCA 3V7CA 2P6SA 3K6GA 4IHSA 2X6XA 4MFEA 1QZYA 3J7ZI 1MMDA 2JSPA 4CO8A 3CMAI 1U9OA 1SD5A 3L2CA 4RB3C 2JA6J 2RNGA 1HW1A 3TMOA 3M9AA 4N9HA 5EJCA 2ZJQF 2DYSH 1EV7A 2O9LA 3I54A 3OYAA 3J81Z 1TW3A 1X1BA 3VPRA 1C0WA 1N75A 1TT0A 2YS9A 1NG6A 3TO7A 4ZJZA 1H89C 1Z0XA 5K5OA 1ZG1A 1BOBA 1SFXA 2Z33A 2EIMH 2FMYA 1ZTRA 2V9PA 2CFOA 1R6RA 2R7XA 5D5XB 4B09A 2ZNYA 1FLIA 2HKOA 5M5YJ 4DNCA 5B1AH 4Y33A 5FLXK 3HG9A 3K9TA 2ELJA 1DU0A 4A3JJ 1ZAOA 3H0DA 3DTKA 3S2WA 2FUG2 2OTJI 1HA8A 2LP0A 4EMSA 2Q2EA 3LL7A 5E3MA 4BE0A 1V5GA 1D0ZA 2VC0A 4GCVA 3V7SA 3CJRB 2DN0A 1R58A 4BXUA 1LQ1A 2X0LA 2M34A 2F5FA 4Q4ZF 2F5DA 2CG4A 4XKVA 4B48A 1OYYA 2ZXWH 3CESA 3VDXA 2L02A 3HPGA 1MBGA 2CW7A 3E97A 3ECHA 2R7VA 3CMYA 1FSHA 4A3FJ 1SVOA 5FO5A 2DFHA 4XN3A 4XLEA 2M4KA 1FOYA 4PSXA 4NQWB 1LUJB 2XIGA 3BJOA 2L9NA 2L9RA 1SD6A 4ENNA 3J81K 2ZC2A 4CSWA 1LE8A 2NAZA 2D5VA 3L2QA 3GFMA 1A36A 1JHFA 1E3HA 3IRQA 4YIRX 5FROA 1KU3A 1W0UA 3DEWA 1MNEA 2W1OA 2H09A 3CCRI 1YTYA 3FDYA 4HG2A 3OYHA 2VQGA 1LDDA 4F3QA 2B7EA 2KRCA 4YIIA 3WTZA 3LOCA 1FMWA 4KUMA 3I3LA 3KEOA 2YU9J 3V4GA 2PLYA 3GCMA 1EH6A 3PO3J 2H8RA 2OF7A 1HC8A 2FU4A 3B6AA 2CQKA 3CMMA 3LNQA 3R4KA 4FQGA 1ORKA 3FX3A 4KITB 2DT5A 4RAGA 3VSLA 3BR1A 4RAZA 3ZMUA 2E1CA 1ZLKA 2ICWG 2K9MA 1CF7A 4WCGA 4DBQA 3F23A 2I5UA 2JN6A 3DTEA 3JRAA 5BPIA 1QVTA 3F8BA 4IVNA 1QHGA 3VB2A 2KIMA 3H1CA 3G4SI 1GVDA 2KPMA 1U8RA 1DUXC 5AIPA 2F6CA 2E34A 5M3FJ 4B47A 2QSGX 3FXRA 1A04A 2KIFA 3RYPA 2BVLA 4C3JJ 3SFIA 4ZYEA 3LA2A 2K02A 5L3CA 5M3MJ 2FNPA 1ZR2A 3M4OJ 1EJ9A 3ABTA 2L7MP 3OL4A 3OOUA 2G7HA 1VQ5I 1X4PA 2O8XA 2V6CA 4C9YA 3DKXA 3OS0A 1CF7B 1U0JA 3CCJI 3RKQA 2CRGA 3BTCA 2CH0A 2VN2A 1E2XA 2FRHA 1I3AA 5K5RA 3MVPA 1FOXA 2DJNA 4LLNA 2VT2A 3R6SA 3QRFF 1X3ZB 3HYIA 3REOA 1P7JA 2A05A 1BIBA 4ENKA 1AKHB 4NBQA 2DTRA 1Y0UA 2FX0A 4QPQA 3CMEI 3K4JA 4AC0A 2DPUA 1BM9A 1YLFA 3TDUC 4AU7A 3CDHA 3GYHX 3HOWJ 4YFKF 1RPWA 5TISC 4YFNF 2KRFA 4I02A 2X51A 1HSTA 1FTTA 1HBXG 2Q8KA 3OS1A 4LIUA 3BJAA 1MBEA 4MQ9F 1VQKI 2XGEA 2PMZA 4L5EA 1J59A 5EEAA 4WXDA 4HRIA 3K10A 4Q47A 3SXYA 1D8KA 4M3BA 1AHDP 4CYCB 2PMUA 5B5EC 2R5YA 3ABLH 6PAXA 2A69F 1GLNA 3ECOA 2AQEA 3HRSA 4EGYA 5GAHJ 2STWA 3HGGA 5JHUA 1UMQA 4D9JA 3G71I 2HEOA 2H1LA 2NVYJ 2HPMA 4XBFA 3TEDA 3M8EA 4O5VA 1TT5B 2EA4A 3M1CA 1A6IA 2MG4A 1R5HA 3I4PA 1MJAA 3M1EA 2RC4A 1OQYA 2XVCA 2K40A 3BP8A 3O2PE 5BQTA 2NS8A 3FF5A 3KETA 1Y56A 4K2EA 4V2FA 3ZQIA 4MHGA 1K7AA 4PFOA 3IL2A 2Y2ZA 4I7HA 4ZYHA 3JAMR 3OIPA 2HNHA 2K3PA 4Q5SF 4XKCA 2PI0A 4BH9A 5FRNA 3O3KA 1KYWA 2EIKH 4II2A 1VQMI 4DZJA 4RBOA 3FXMA 1KU2A 2E2JJ 5EEGA 3B73A 1PJRA 1GXPA 4Y4RA 3C7JA 2L2OA 4O6JA 2R7ZJ 1V5EA 2VXZA 3S93A 2LKXA 3OYGA 3H36A 2G7UA 2BHZA 2ZKZA 1G3YA 3A52A 5J40A 4XMYA 2E2HJ 3HB9A 1RUNA 2JA7J 4IRIA 1UJ8A 4E7IA 5IOYA 1H0MA 4MQVA 1Z77A 1JKRC 2HKXA 4L18B 4BS9A 3FXQA 1TWGJ 1MBJA 2XUBA 3IHUA 4WXCA 1XSDA 5FRMA 1K78B 4RGRA 3DXJF 2J5OA 3EUAA 2WAEA 2LY1A 1UB9A 3H9GA 4MIMA 5GTHC 1XB4A 2Y9ZA 3GTOJ 2E60A 1H9GA 4DQ2A 1Z3XA 2ISYA 3E0JB 4V19K 1X3WB 1ZK8A 2WV1A 3SZPA 5E17F 4Y15A 1I1SA 2WY7Q 2X6WA 4YIFA 3CC7I 2CV1A 5F1JA 2EZHA 3T8TA 2L9SA 3A0HC 1X4OA 2HR3A 3F8CA 1HKTA 3A02A 1SFKA 4E7LA 2V1NA 2MFZA 1WCMJ 1ODDA 4BQQA 3F8NA 4BXXJ 3L2WA 3L1PA 3MN2A 2BVMA 5FB2A 2CUFA 4DIQA 4G12A 5E3OA 2E2IJ 3M8JA 5KAFC 1F1ZA 2BZTA 5E3NA 1MZBA 1Z1DA 2CV0A 1KONA 4YRVA 2HFHA 2ID3A 1QRYA 4G9YA 1HKQA 1J9IA 2BYVE 3H3UA 2MBFA 1Q1VA 4G94A 4DBRA 3CCUI 1ENHA 2ZCWA 2DA7A 3NQOA 2YR2A 1ETXA 2I10A 2JJ7A 2DOFA 3HRTA 1REPC 1V4RA 3MKYB 2NVUB 2CUJA 4B4CA 1U8BA 3I0TA 4X1EA 1I3QJ 1WH7A 4MNUA 2BXYA 3GWZA 2VJ4A 1YW9A 2FMLA 2P7CB 1SVMA 4F7ZA 3GTGJ 4DZPA 1OKRA 2DW4A 1VQNI 5C4XJ 2BW3A 1O7LA 4E7HA 2BGCA 5H6RA 2DDAA 3HRMA 4DJAA 1FTZA 2XRLA 3WODF 2VBZA 2KL4A 3MQ0A 3I59B 3CCVI 3ASOH 1B4AA 1ONVA 3MMYB 5HDKA 3CCQI 2B9SA 2P81A 4I99C 4XM3A 4NB5A 5C44J 2KP6A 3ELKA 2E7XA 2ME0A 3HSRA 3WTTC 4M71A 5J1YA 5KCMA 3U2RA 1FBQA 1YIJI 4L0ZB 1WJ5A 4XKWA 4A12A 3TQNA 2ADUA 5ICFA 3ZGKA 1VQ7I 1XSVA 2XHKA 5DCFA 2RQPA 2LOOA 4AVPA 4HF0A 2ACJA 3F8FA 3CP8A 2DQLA 2MC3A 2Z1DA 2L4MA 2E1NA 1JHHA 1QQIA 2A5WA 1U2WA 2VJIA 1L3LA 2JSCA 4HNUA 1TNSA 4IQ4A 1TW2A 1R7JA 2Y0SN 1VZ0A 2KT0A 1IC8A 1A6QA 2HZDA 4PUSA 3FKIJ 3IAS2 3F9KA 3VFZA 2EFOA 3K4NA 4WWCA 1B72A 3PM1A 3Q0UA 2ZXIA 1MD0A 2HI3A 2Z3YA 1LDKB 3OYFA 4ABZA 2OPTA 1JTYA 4AUXA 4KA4A 1O4XA 3L2RA 3JSOA 1MNMC 5EGOA 3P9KA 4GGGA 4IEJA 2KZVA 2XKPA 1LVAA 2R0QC 4Q48A 5E3LA 5HLHA 1X3UA 4CH7A 3DWLE 4MTEA 2OUMA 3OR2C 4W1UA 2RREA 3KLOA 2RKHA 5DUKA 2R7QA 4BACA 2K4BA 3KEYA 3JAMZ 3JRCA 4BQAA 3RKYA 3JSPA 2XDVA 1JUSA 2OD5A 4RM2A 3MZYA 1XGMA 2YX7A 2UUZA 1OYIA 1G8XA 3EYYA 4MEXF 1Y39A 2PJRA 5AONA 3PIOF 1IXRC 4I0AA 1B72B 3Q9VA 1TQPA 2LKPA 1PP8F 3OYJA 4RA2A 3NWTA 3IC7A 2HVQA 5J1UA 4IKFA 3CJNA 4L9TA 2KIQA 1I6HJ 3GX4X 2BOLA 1TZLA 3HRUA 4IL6C 2KDZA 2JWTA 4PCQA 2IJLA 2M9HA 2RAEA 4WF2A 1IDZA 3HOZJ 3TKYA 1IF1A 3DLLF 3BLYA 2WAFA 5HS7A 4KMFA 2XAFA 1FBUA 1FOWA 2XPUA 1WI3A 1DQUA 1J0RA 1D1CA 3DBLB 1ZRFA 4I76A 4BQOA 1J09A 4OMZA 2QA4I 1D0YA 3DF8A 5F04A 4ESFA 3EDPA 3M3YJ 1R9TJ 1B9NA 4XNFA 4ETSA 2X1CA 3BZ6A 2HQNA 1Z7UA 1TWAJ 2IW5A 2PJRB 2XAJA 1YS7A 3PFYA 4QSHA 5FKOA 3D5RC 3HOYJ 3NAUA 1FIPA 2QUFA 3ABUA 3EUHA 2VKHA 2JUGA 2F48A 2VPRA 3HSFA 2JZYA 4RB2C 1WWXA 3ZXSA 1RETA 3FM3A 4BAYA 3CZ6A 2VKDA 2NVQJ 5K7ZA 3O8GA 1I6XA 3KP2A 2W7NA 2ISZA 2CW8A 3JAMK 1W36D 4CHUA 1P92A 5LGUA 3S8PA 4X0GA 4RS8A 3W6JB 3DP7A 2MD0A 2DMUA 2QBYB 3T8RA 2NVXJ 2XGDA 1O3TA 4XORA 2HTJA 4G6DA 3PUFA 1XPXA 1ON1A 2PMZN 4U88A 3TO6A 1FP2A 4DYQA 5LHIA 3HOTA 2YX4A 2GZWA 3L9FA 1U3EM 1FYLA 3C2BA 1EF4A 1EA3A 3FBNB 3IWFA 2HGCA 3VOEA 3HTUA 3HKZA 3BWGA 4A0XA 1QHHD 1Y0NA 3G3ZA 4EQQA 1ZLJA 1HDDC 2GA2A 2H27A 1RC9A 4XSZF 2CQ7A 2LBFA 1O3RA 4DGWB 5CYVA 1WKMA 3EUKL 5L3DA 5E8IA 3GTPJ 3LA7A 1O57A 1ZELA 2Z5UA 2TCTA 4MEYF 5E1XA 2QM3A 3LAJA 1FEXA 3JRDA 5F0CA 3GFJA 4BJTA 1FWZA 3HJEA 4G6QA 5CLSA 2K27A 3NARA 2A07F 2MA3A 4E7KA 4AIHA 3H5AA 5IYCJ 1YJNI 2ZJRF 3B6CA 4HQEA 3W6KB 4G7OF 1BBYA 1I5ZA 1IW7F 4B8XA 3F22A 4ESJA 5HVQC 2DFEA 2EV0A 5HNHA 1BL0A 3WHCA 1ZKGA 2DYRH 4UUSB 3OYIA 2RNJA 5IP6A 5KK1A 3KYLA 4AYBA 2CW0F 3IH4A 3HBLA 3OIQA 1XX5A 2K3FA 2FE3A 2F4MB 1YJ9I 2DT7B 3H0GJ 3H9QA 2CJJA 3R60A 2DLLA 2VKEA 3BTLA 4FHTA 4XR6A 4PJ0C 1WZ2A 2IEKA 5K7FA 1LB2A 4EGZA 3OYKA 2HYFA 1G3SA 1HW5A 3WGIA 4EEFG 2BE5F 3X2QH 4BBRJ 1AWCA 4L5IA 5CKTA 1ETVA 4PGHA 5IT9K 4IJAA 2OZUA 3HOUJ 4M6VA 3G6EI 4PJNA 1XC5A 3G1OA 1SEUA 2OQGA 3WE3A 3BQZA 2ZMEB 4U7BA 5J6XA 1JT6A 4F55A 4ASNA 3CD6I 1V5FA 2KKOA 2O03A 3I71A 1B8IB 1YE9A 4HDVA 3PNYA 3WHBA 3NWSA 1PUFB 4WXHA 1ZN2A 2XB5A 3FZVA 2CWEA 4RMNA 4Y7NJ 3FXLA 2XRNA 3K1PA 5DEQA 2MSYA 5D5VB 3OS2A 1MMNA 5ILVA 3P7NA 1QNTA 3LSRA 2QYOA 3OR1C 3ZQHA 4C2MJ 2Y9YA 2NRAC 3ULQB 1XGNA 1HF0A 4ZDPA 3RPUD 2XROA 1UHMA 3D5LA 3I58A 2VPLA 5DD4A 1DP3A 1XDSA 3WTSC 4UNOA 4UXNA 4A3KJ 1D0XA 3K4LA 1SFEA 1X58A 4NQWA 4J00A 3S1MJ 4E7ZA 3KEQA 4R8HA 4DW6A 5D4RA 3IH2A 4UHTA 3P9IA 2JUCA 5D8KB 1IRFA 2K4JA 5HNFA 4P96A 4V2GA 2DPDA 1RESA 2UZKA 3JCUC 3TL4X 2MLKA 5CVJA 4AM3A 4I0BA 4N9IA 3DQVC 3GTKJ 4QIWN 1QU3A 4B44A 1ZGWA 3TO9A 3ZQQA 3BPVA 1T6SA 2GWRA 2HYJA 2UV1A 1SD7A 2STTA 1MH3A 9ANTA 4HX4A 2ECCA 2BY1A 1OCTC 3I4MJ 3G1MA 4XQFA 2X1DA 3CP2A 3HM5A 3W2VA 3HPHA 2BY2A 1TWCJ 3W6VA 4OIQF 3K4MA 4XRSG 5TGTA 1RR7A 1X1PA 2L7KA 2O61A 3K1NA 2JPCA 4QTRA 2NXNB 2IAIA 3I64A 5HDNA 1TTYA 5IT3A 2YSRA 1USTA 1JUMA 4XLCA 2DTZA 3BR2A 3DEUA 1V3FA 2NNYA 2ESNA 2L9VA 2XC7A 4EM0B 5FKKA 2JQ7A 3OOPA 4OAZA 2LG4A 3Q0WA 3E6DA 2JMWA 1OISA 4M72A 1X1AA 2F5CA 2DDBA 2HZTA 1M1EB 4A93J 1T56A 3LA3A 2HQAA 5KVRA 3KP3A 1E3OC 3VYTB 1S7AA 4RAFA 3AL0C 1J7KA 3PL8A 2O3FA 3PSIA 3MKLA 4IQJA 5D6EA 2LTPA 3WU2C 3VYRB 2CS3A 2F2EA 2FOKA 2KJBA 2YU3A 1QO0D 1R1TA 2EPFA 2KJCA 5DYMA 5FD5A 4YELA 4UVBA 4YEJA 1IJWC 1K6YA 5EEHA 1MDMB 3LFUA 5CVRA 3TOBA 3KP7A 4XLAA 4JYKA 2H6BA 5IYBJ 5B1BH 3J80R 2WBMA 3GLXA 3WTXC 4HDUA 1ERDA 4WX9A 2WY8Q 1AKHA 3S14J 2IS2A 1W5SA 1MSEC 4OOIA 3V42A 2ZSIB 4XOPA 1DP7P 2UWMA 4Y52J 5HODA 3QYEA 2K85A 1R4NB 1OLTA 1X19A 1YG2A 4FETA 2D1HA 1N77A 2E7WA 1ETKA 4RGXA 2KMUA 4CCJA 2W57A 4CZCA 4IOCF 3W2AA 3KFWX 4FTHA 4KT6A 4ZYAA 2IXSA 4L5JA 3V8JA 1USSA 2KZGA 4KFCA 2ZMEC 1SC7A 2RGVA 2VIXA 2EA2A 2R4GA 1SVLA 2M87A 3FM5A 3SZGA 1FZPB 1IG7A 4CYCA 1MBKA 1TP4A 2W24A 3ZQCA 2XAGA 3GZ5A 2DMPA 1BI2A 3LSTA 2VASA 1YX5A 5J8CA 4XK4A 2E35A 3D0SA 4OAYA 4S05A 4HSRA 1Y8RB 3S1QJ 5CPRB 1FNNA 1W5TA 2VB6A 1ON2A 1XCVA 1DGWY 3GW2A 3SHFA 4D5FA 1XN7A 3GTMJ 4B43A 1ULYA 1P2FA 2FQ4A 4HBLA 5GTIC 2VBWA 2A6EF 5LGTA 4A3LJ 1NG7A 3MZHA 3BCAA 5J8FA 2W82A 4HA8A 2HOAA 5DUIA 4IZZA 1J75A 4HNVA 4XLNF 5HS9A 3COAC 1BR4A 2IS6A 1D3YA 2DMQA 2IPQX 1F36A 2K9NA 5IP9J 2IGOA 3KLNA 3LSPA 3CCEI 4MFDA 5KNLA 4EM2A 1WSUA 4CYDA 1QPIA 1SD4A 2L7ZA 5H6QA 2CFXA 1IN5A 4EVIA 2MW8A 2NS7A 3UR3C 5BNGA 3CCMI 2EFPA 3TDZC 2ZNZA 2QENA 2Y75A 5FJ8J 3VEPA 3RSNA 3I56I 2JVGA 1WHUA 1HKSA 3FMSA 1TC3C 2LF7A 4BJ6C 2JVHA 1VI0A 1W5CC 1LFBA 2O7OA 2V79A 2RDPA 5ED4A 2HXOA 3QOPA 2I8DA 1XG1A 1VQ8I 4OWRB 4KIFA 1K78A 2DMNA 2RN7A 1UCRA 4D0PA 5A2QR 1CQTA 3L7WA 3HKZN 1WJFA 2DU9A 3JR9A 2DAOA 5CJ9A 3AFHA 1IRZA 3K0LA 2NS0A 2P7VB 3K70C 2L4AA 3LSIA 2O0YA 1G6NA 3Q9SA 4RLQA 2Y69H 1LPQA 5LRSA 5B3SH 2MH2A 2DA2A 2GQQA 2WAQA 4OMYA 1XS9A 3ZN1A 2GAUA 1WVRA 1YYVA 2DFIA 2XAHA 5BMZA 1JE8A 2IA2A 3RKWA 1P4AA 1EH8A 2P5VA 3CUQC 3P9CA 3BZCA 4UB8C 5GPAA 1G59A 4A3GJ 1OMIA 3W3CA 2M8EA 4KN7X 1AU7A 1I39A 1RIOH 2H8WA 5BOXA 2IGKA 4AYBN 1R49A 3RQ4A 1BC7C 2WC2A 3FMRA 3H5NA 1SAXA 4PJMA 1K4SA 2R93J 4GDFA 3HC7A 2WB1N 3OYDA 3O8HA 1W7PB 1I27A 2DMTA 2GA1A 2HU9A 4F92B 2ID6A 2VE8A 2X9DA 5BS6A 4FE7A 1SANA 1JJ8C 2VQHA 2PN6A 4XL9A 4YFXF 1X2MA 2PX9A 2LY2A 3PNVA 2VONA 4NUBA 4CCLA 1FOKA 1Z6RA 5HDGA 1JKPC 1IAWA 3DBRB 4P1WA 2PG4A 5KHDA 3KYDB 4CA0A 1S72I 2LNBA 2JTVA 2WA0A 1JGSA 3I59A 4BEHB 2EFQA 4GO1A 4HZFA 2M1BA 2K9LA 3DTIA 1YS6A 1JXSA 3WTUC 1W0TA 1KYZA 1KU7A 1FIAA 3T1BA 2KLOA 1SAUA 2M7BA 3HXLA 3IWZA 1YX3A 2PJPA 3S1NJ 4I2OA 4DYCA 2KQRA 1MMAA 5E79C 4F93B 2QSHX 3J80Z 4LLLA 3FWEA 3BR0A 4QPOA 2DJIA 1OR7A 5LGNA 3E7LA 4BNCA 3Q5FA 3IAM2 2YUSA 3IV5A 2ME6A 3ZMDA 1JUPA 5LHGA 1FC3A 3E6MA 2R3SA 2GOMA 4F91B 3J81R 4JK1X 4LGWA 4BDZA 1YRNB 2X6OA 3QYBA 4BDYA 3E1SA 3E5UA 4HOBA 2OZ6A 4S04A 3GF2A 4ANJA 3RZOJ 1T95A 2OTLI 3JRFA 3RCOA 3RIRA 1DGRM 3H3ZA 1YQAA 3VYUB 2M0CA 1P9QC 4E7SA 1FJLA 3J7AO 3TBIA 1R5ID 1R4MB 1Z67A 3S2DJ 1BN5A 1KQ9A 3I9V2 4IHVA 3ZMSA 3BTJA 2VI6A 5ERIA 3SDGA 2R7UA 2E1MB 2MC4A 1IZ1A 2B63J 1NK3P 4D5CA 1U78A 1MSFC 1NH3A 3WU0A 5TRDA 2XSJC 4PJJA 5EDNA 3H92A 4NDLA 3L2UA 4OINF 4GYGA 3LFKA 2KHMA 1OYWA 3N05A 5HOOA 4ZYDA 1RKTA 3BR5A 1U5TB 3QP5A 5C3EJ 1BR2A 1VQOI 5HLTA 1VFCA 5GAEJ 3JRBA 4D7MA 3ZQLA 4U87A 1JT0A 4ZC3A 4CDGA 1CGPA 1T08B 2EV6A 1WJEA 2GOXB 3SEZA 1FP1D 3RPUA 3J80K 3GEZA 4MLOA 3LQQA 2FXAA 2OV7A 5GAGJ 1D1AA 1KA8A 2A6HF 2L0KA 2WTEA 2HQRA 4A3BJ 4AIDA 3VSKA 2R7WA 2AO9A 3PSFA 5DD8A 3ZQFA 1HW2A 3CJTB 2O6GE 3N97A 1QPMA 2V9VA 2EJRA 2VBYA 5F08A 3GUDA 5GADJ 5K7HA 1ETYA 2HYGD 4A3CJ 2IT0A 2VXDA 4XRSA 4BL0B 1OCZH 4JX6A 1A35A 2F5VA 5E1WA 2IS4A 4GFBA 4U0WA 3NRVA 1IO2A 1Z7LA 3BTIA 3OYMA 3FISA 1MBFA 5IPAA 2FNAA 3BC8A 2IBDA 3SDBA 4QLCU 2P0WA 4UV8A 5E18F 3I4NJ 1B59A 2BY3A 5J1RA 4OIOF 1X1DA 4AWXB 4BUPA 1LKXA 2GIVA 4YG2F 3A1YA 2K86A 3QPLA 2NVTJ 4HNTA 4PK4A 1R5GA 1T0FC 2JPBA 4KISA 4PSWA 4ESBA 4B1RA 3BT9A 1MBHA 3L2VA 2LD5A 5H2FC 1STZA 2VOPA 5A2QZ 2Z9OA 1WI9A 4P55A 3LSHA 5FFXA 4BHPA 1ZARA 1BOAA 1HXDA 2MLGA 3JTGA 3VODA 3P5JA 4RB0A 1R22A 5JLWA 1NHAA 2VC1A 2BV6A 3M07A 1VTNC 3KZYA 2XB0X 3HSEA 1K83J 2M5WA 2QBYA 3DU5A 4I98B 4LB5A 1QZZA 5J4YA 2M4GA 5L3EA 4BE1A 3ERED 2LVSA 3LSKA 1KQ8A 3MEXA 3QPSA 5ILSA 4BY1J 4UY8I 2IGNA 1IN4A 3GFLA 1W7PD 4A6EA 3WTWC 2R5ZB 5CVVA 4Y17A 4M9ZA 4IXAA 4Z6YA 1RQ6A 4KJZA 2QGUA 1UG0A 4J01A 4KMUX 1PDNC 3J7YJ 4EJUA 1BI3A 1WJDA 2COMA 3CC2I 4ZTJA 2VL8A 4HPQA 1I50J 2DBBA 2V9KA 4LLGF 1Z9CA 3PIPF 3T0YA 2DK8A 2HXIA 2GXBA 2AHQA 5F0HA 3MWMA 3F6OA 3FMQA 2PFBA 4HF1A 4IHTA 2ZFWA 3ISPA 1RKWA 3PJRA 3C3WA 5A2QK 4L9JA 3F3XA 4M9XA 3KP6A 3OYNA 1XD7A 2LMDA 5DS9A 2FSWA 4HSTA 3QQAA 2HPIA 1ZREA 2KDOA 3QOEA 2XPWA 4JQFA 1O7FA 4RLFA 4UUSA 1APLC 2QQ8A 3WGGA 2GM4A 4C3HJ 4ENJA 3OYBA 2LK2A 4KICA 4A0YA 2IGMA 1W1WE 1S8NA 4I01A 1S29A 2M35A 2E1MC 4EJVA 5L3FA 1AOYA 1E0EA 1RUOA 3RTRA 5ICCA 3JTHA 1W4MA 3PQKA 3DPLC 3G73A 2L7FP 2XV4S 2OA4A 1QA6A 3OIOA 1FYMA 2VQLA 3N4MA 4A5MA 2HOEA 1PP7U 3AL0B 1DDNA 2DK5A 3A03A 3GTJJ 1WRJA 2MUNA 5CQGA 4I6ZA 3D1NI 1U5TC 2BEOA 2E71A 3CO6C 1VQ9I 2ZMEA 1R36A 1RI7A 4G6TB 2O5RA 5LLQA 3HGYA 3CCSI 2MABA 2QF7A 3QPTA 2NOGA 3BG9A 1B8IA 1S6LA 3HHHA 2Q0OA 3SYTA 4IHYA 2BHYA 4EV0A 4HX8A 4HLXA 2WADA 4Z2YA 2P5LC 2X6YA 1PUFA 4BQNA 5LEKA 3FXKA 2DI3A 2EK5A 1MNDA 4RM3A 1XCBA 3K2ZA 1ACIA 2VT3A 1WPKA 3ABMH 5K1YA 3E5QA 5EG0B 3C2HA 3BQYA 2LFBA 1OPCA 3QAHA 2XASA 3E6CC 4AIJA 4AD9A 1IN8A 2V6EA 2OBPA 2CUZA 4FASD 3R0JA 2WAQN 1D8JA 1QGPA 3RPQA 5EYRA 4XICA 5HLIA 1SMTA 2R7FA 4NC7A 5FLXZ 3OSGA 1ITYA 1DU6A 1U9NA 2K5CA 1PYVA 1MMGA 5IOZA 3RQIA 3Q0VA 1I1GA 3AG4H 2VE9A 1NTCA 3CQZJ 1OCRH 1R00A 1JI8A 2AS5F 2V1XA 3AAFA 2ETHA 5DCMA 1K79A 1IUFA 1P4WA 3MKWB 3I53A 3WU1B 1OCPA 1T98A 5JVGF 3HDDA 4WK8F 1LDJA 2TRTA 3S15J 2HVSA 3HZJA 1BA5A 1WH5A 3CCLI 4A3DJ 4LITA 4BYYA 2J5PA 2CV2A 3QPHA 4H4KC 1LJ9A 2W48A 3M7GA 4E7JA 4LMYA 1H88C 3PNTA 4E70A 1O3SA 1D1BA 2ZXHA 4FT8A 3DFGA 1DPRA 5DM6F 1JJ6C 4II3A 3QU6A 3C18A 3F72A 3FHZA 4B3AA 2AXTC 2IP2A 3DKWA 1ZGAA 5F64A 2DCEA 1MMSA 2DOAA 1HCRA 1GXQA 5DCMB 1FT9A 4DYRA 5C4JJ 1V55H 2QQ9A 3OY9A 1R71A 5FKMA 4ZZDA 2Y0MA 3MD2A 2ZJPF 4HV6A 2XF7A 3ABKH 3KZIC 3BCBA 1XMXA 1B1BA 4BY7J 2M7AA 2HTSA 4TV7A 4OIPF 1UHWA 1HSJA 3ZOBA 2LY9A 2R7DA 1VQ6I 3DEEA 3CUQA 2UXNA 4XIDA 5EF6A 2IRFG 5FD6A 3K1MA 3ZRGA 1ZG5A 2JA8J 1IN7A 4JP0A 5TJJA 4M3EA 3ZQGA 2XSDC 3IH3A 4R79A 3CF2A 1MDMA 4HV5A 3HOSA 4HF2A 3BJ6A 1OCOH 3SJMA 4PGGA 5FKNA 3S3OA 1HLVA 5JFRA 4CGZA 3GZ6A 4L9VA 1YW7A 2XAQA 3M8FA 5D5UB 2ZBKA 1WJCA 2MH9A 2Y0SA 2DA5A 2BY0A 2Q2EB 2L54A 4CCKA 3F8MA 5EZHA 1F9NA 4HYEA 2G9WA 4PZJA 2EZLA 2ELKA 4LOCA 3S3NA 3CUQB 1P4XA 3UKGA 1GHCA 3MAJA 2R92J 1X1CA 2X4HA 3EUHC 1A5JA 3U21A 1YITI 1ZGJA 4XOTA 1XDUA 1OJLA 3I55I 2P5KA 2C6YA 1IXCA 2MD5A 1F5TA 1IN6A 2V1DA 3OSFA 1TLHB 2L5QA 3RYRA 4CICA 2HDDA 4UV9A 4AVZA 2JK3A 2IA0A 4LG3A 3TW6A 5JVTA 2CYYA 1IRGA 1LE8B 1RZ4A 1PUEE 3O6BB 2BXZA 2CMPA 3BZKA 3EPZA 3KP5A 4FE4A 4LB6B 2ELHA 2L3DA 2M8GX 2BBYA 1X2NA 2EIJH 4IX7A 1R1VA 3DPUA 2EZKA 2DT6A 3BDDA 4CCOA 1BW6A 3BG7A 1T33A 2D1VA 2A5YB 4G8XA 2W4SA 4ZH4F 3FIWA 1XSXA 2AQFA 3OL3A 3HL2A 1P6RA 2K9SA 2PMHA 3K4KA 2VJJA 2EINH 4IPAA 3G1LA 1UZCA 2OQRA 3GMEA 3TP0A 4L9NA 5D6FA 1NK2P 5L3GA 2OU2A 4BHCA 5F6FA 2WWYA 1GVJA 1DPUA 1XGSA 4NNJA 2V7FA 1N25A 2QKLB 2XGXA 1BIAA 2AXLA 2FBIA 4KN4X 2JT1A 2WV0A 4A5NA 3WTVC 4C2TA 3D5SC 5ILUA 5LD2C 1UG2A 4ZTFA 1BI0A 2FEZA 3FHNA 1YI2I 1K6OA 1RRJA 2DA3A 4S0HB 2ECBA 3MFKA 2X98A 4PJLA 3SQNA 1T2KA 3ZPLA 4IHXA 5D4SA 3GTQJ 4G7HF 4R1HA 1T39A 1T38A 1E3PA 2GXAA 2H94A 1FBSA 1BJAA 3QODA 3HIFA 4LIVA 5B66C 5GP9A 2MVTA 1GV5A 2CO5A 1BI1A 3GLLA 4FX0A 2HS5A 1WQ2A 5IYDJ 3K4BA 3KP4A 1IXSB 2CQNA 2K7LA 2XPVA 1BJZA 4N4NB 5M5XJ 2E19A 1IGNA 4HEA2 4IRHA 2M45A 1IUYA 1ETOA 1G3TA 2QSFX 2X1EA 3HUGA 4W97A 3RJPA 2OC6A 1S7EA 1WJBA 4KYWA 1FSEA 2GBYA 1F4KA 4CCNA 4MTDA 5DV5A 2A61A 2PEXA 4BE2A 1GDTA 2FD5A 3Q3SA 4OIRF 1T0FA 1R23A 1U6GA 3DV8A 5H20A 3WG7H 1VNDA 4O3MA 1B9MA 4P9UA 1MKMA 1N78A 2V4JC 4BBSJ 4M3FA 1HQCA 1XMAA 3TP3A 2DO7A 2PQ8A 4C3IJ 3OMYA 1H9TA 4L0YB 1RNLA 2FBKA 4D1QA 2UXXA 5JHFA 3MCZA 1BW5A 2ZJ2A 3BG6A 1FX7A 5CVUA 2D45A 4CXFA 3HUGB 2LC2A 1W7PA 1UHSA 2NYXA 2R5YB 2DQRA 2EQRA 4OU0A 1MJ9A 2MZ4A 4M6YA 2F5EA 4UUTA 3CCYA 1MH4A 3S2HJ 4ZZLA 3ONQA 2JA5J 2N8GA 2X48A 2XKOA 2R7TA 4LD5A 2R7OA 2M2EA 3K70D 3OYEA 5JI6A 1LFUP 2QWWA 4F52A 3OWTA 4X6AJ 5KAIC 2Z2SB 3OYLA 2LSOA 2ZXJA 4IF4A 4BEHA 1WJAA 3ASNH 3S32A 3TGNA 1YJWI 4C2UA 1SMYF 2EILH 1TNTA 3BG3A 1VF9A 3JREA 1Z91A 4M9SA 4XSXF 5J3LA 3HOVJ 2M3AA 3WGHA 5FLMJ 5M5WJ 1P7IA 3CLQA 1G3WA 2G0EA 3FBIB 3RDIA 2FOWA 4C30A 5ICGA 1ETWA 2QQAA 2V26A 2QLZA 4EJTA 4HAMA 1J5YA 2LDUA 4BU2A 2VOOA 2P8TA 5JR3A 1TBXA 3A01A 1RR8C 1YRNA 3K69A 5F27A 5AIQA 1FMVA 4M74A 3NEUA 2QKMB 2B0LA 3GBGA 4Y3OA 4BHBA 3ROUA 3V7RA 4UVCA 4N0BA 3ERMA 1MIJA 1UFMA 2FF4A 2W84A 3DBHB 4UB6C 3HEFA 1SFUA 5E20A 1TQMA 3LMMA 1IRXA 3FXUA 4XRMA 1Z3YA 2XAUA 4FISA 2VBXA 3BR3A 3JRIA 3B02A 3BY6A 4EM1A 2A3SA 2LLKA 3JRGA 1Z05A 2QVOA 2HVRA 4EJOA 3LAPA 3QWLA 4A3MJ 4GXOA 2R7RA 4DOZA 4A0ZA 4CCMA 1FYKA 2EH3A 1WFXA 1G4DA 2VJ5A 5IT9R 5DTDA 5EZGA 3C2GA 2DFFA 2LH9A 2A6TA 5FFZA 3A01B 2COBA 2LF8A 1O3QA 5F1RA 3ZMZA 1UAAA 1U5TA 2CQXA 3J7AY 3U1KA 4FCYA 2E36A 5FKLA 1QBJA 4XLHA 2Y30A 4XRFA 4LFUA 1VQ4I 1YO5C 4JX5A 2FBHA 3QYFA 3SFZA 1V54H 1OCCH 4KT5C 2OCEA 5FGMA 4P5OA 2VUMJ 1OFCX 2LKSA 4AIKA 5LEJA 3AG2H 3LSJA 4IRGA 3H35A 4ON0A 1UELB 3W2WA 5IY5H 1SFOJ 1PVEA 1FPQA 5LRRA 2QQBA 4BXFA 2Y31A 3IKVA 2GIZA 2EZIA 3DCFA 2O8KA 3EETA 1POGA 3EYIA 2F4IA 3PQJA 4CZZA 1QZEA 3DKYA 1GT0C 1XMKA 1YW8A 4PFPA 5F0FA 2KFDA 3GVAA 3L09A 5FLXR 2HDWA 1E17A 1MJBA 3A2KA 3UNGC 5K5QA 2CGPA 3C1DA 2H1KA 1S3JA 2EBIA 3ML6A 1LVKA 4RAYA 5JLXA 2EB7A 3CLOA 1ZYRF 1MGTA 3IUOA 3PFIA 2NNNA 1KZHA 2KIUA 4LK1F 2JRTA 2RVCA 1FY7A 4M3GA 3LSGA 2BW3B 1KGSA 1GV2A 2Q1ZB 4N4OB 5LFAA 4I09A 4FX4A 2RQQA 1Z6TA 1Z21A 1TQIA 3CJQB 4U0VA 2K9QA 3F6VA 4M3DA 3TOAA 1LEBA 3CDIA 3CUOA 3VYSB 3E6BA 4PDKA 4D7NA 2FJ1A 2P4WA 5BPDA 2DXIA 1B6AA 2CSOA 3MZ8A 5FLVA 1AA7A 2ZO4A 1Q1HA 3ZR8X 5J4VA 3TW7A 4RGSA 1VQPI 3U1DA 4UVAA 5D8LB 2RV8A 2DA4A 2XF5A 2DA6A 4E6KG 4ZDOA 2QEXI
chains in the Genus database with same CATH topology
3EQLF 4XLPF 4M73A 2EWNA 5CVIA 3V8KA 4A6DA 4A2UA 5LHHA 3GXOA 3L00A 2IVMA 3R61A 1KU9A 4HX7A 4LJZF 4P9FA 3CO7C 3BROA 2IA1A 2P6TA 4HLYA 2VODA 3KE2A 3QU3A 3WE2A 4H0EA 2L01A 3WTYC 2EFNA 1L0OC 3E3VA 3JW4A 3RKXA 3U9GA 3CTAA 3KZZA 4ZYGA 3ZQ7A 3ZMTA 3R0AA 4KDPA 2GXGA 4KIBA 4EJWA 1R1UA 2W85A 3SZTA 4RB1A 3QP6A 4M6XA 2V1UA 2HDCA 4KIGA 5E1ZB 2W25A 5L3BA 1KQ0A 4UUVA 3LQRA 3RI4A 1LNWA 2PBIA 2Y48A 3GO5A 2TDXA 2QZ8A 2HWVA 3OV8A 3T5XA 1XGOA 1J2XA 3GFIA 3LWFA 4LG0A 5ICEA 2YPRA 3F21A 3IKTA 3E5XA 2Z99A 5E8GA 1ZRCA 5IT9Z 1ZHFA 4NHJA 2D2WA 4Y13A 3HTSB 2H6CA 4LK0F 1EH7A 5LBQA 3BOQA 2ESHA 3WG9A 4HW0A 4LG0B 5D5WB 4GYIA 5DDGA 3IRRA 2EFWA 3BPXA 4G7ZF 3ZP5A 3V8LA 3ZMVA 3HHGA 4ENMA 3ZN0A 1YFHA 1ZG3A 4HQMA 2EV5A 4U0YA 4QWQA 1ZH5A 2FA5A 3I5UA 1S7OA 4KNYA 1D5VA 1BC8C 1YIOA 5HS8A 4JBAA 2M30A 2A68F 2FQ3A 1ZRDA 1LEAA 5HLGA 2OAZA 4MGRA 4RGUA 3DPTA 4U7DA 3KCCA 3V7CA 2P6SA 4IHSA 1QZYA 4CO8A 1SD5A 3L2CA 4RB3C 1HW1A 3M9AA 4N9HA 1EV7A 3I54A 3J81Z 1TW3A 1C0WA 3TO7A 5K5OA 1ZG1A 1SFXA 2Z33A 2FMYA 5D5XB 4B09A 2ZNYA 1FLIA 2HKOA 4DNCA 5FLXK 3K9TA 1ZAOA 3S2WA 4EMSA 2Q2EA 2VC0A 4GCVA 3V7SA 1R58A 4BXUA 1LQ1A 2X0LA 2F5FA 4Q4ZF 2F5DA 2CG4A 1OYYA 2L02A 3ECHA 3E97A 1FSHA 5FO5A 2XIGA 3BJOA 1SD6A 4ENNA 3J81K 2NAZA 3GFMA 1JHFA 3IRQA 1KU3A 2H09A 1YTYA 1LDDA 4YIIA 3WTZA 4KUMA 3KEOA 3V4GA 2PLYA 1EH6A 2FU4A 2CQKA 3R4KA 3FX3A 2DT5A 4RAZA 3ZMUA 2E1CA 1ZLKA 1CF7A 4WCGA 3F23A 5BPIA 3F8BA 4IVNA 3VB2A 2KIMA 1U8RA 1DUXC 5AIPA 3FXRA 1A04A 2KIFA 3RYPA 4ZYEA 3LA2A 2K02A 5L3CA 2FNPA 3ABTA 2G7HA 2O8XA 2V6CA 1CF7B 2VN2A 1E2XA 2FRHA 5K5RA 4LLNA 2VT2A 3R6SA 3QRFF 3HYIA 3REOA 1BIBA 4ENKA 2DTRA 1Y0UA 2DPUA 1BM9A 1YLFA 3TDUC 3CDHA 3GYHX 4YFKF 4YFNF 2KRFA 4I02A 1HSTA 1HBXG 2Q8KA 3BJAA 4MQ9F 1J59A 4WXDA 4Q47A 3SXYA 1D8KA 2PMUA 6PAXA 2A69F 3ECOA 3HRSA 4EGYA 2STWA 5JHUA 2HEOA 4XBFA 3M8EA 4O5VA 2EA4A 3I4PA 1R5HA 3M1EA 1MJAA 2RC4A 2XVCA 3BP8A 3O2PE 5BQTA 3FF5A 3KETA 4K2EA 4MHGA 1K7AA 3IL2A 4I7HA 4ZYHA 4Q5SF 2PI0A 4BH9A 3O3KA 1KYWA 1KU2A 5EEGA 3B73A 1GXPA 3C7JA 4O6JA 2VXZA 2G7UA 2ZKZA 1G3YA 1RUNA 4IRIA 1H0MA 4MQVA 2HKXA 4L18B 3FXQA 2XUBA 3IHUA 1XSDA 4WXCA 1K78B 4RGRA 3DXJF 2J5OA 1UB9A 1XB4A 1H9GA 4DQ2A 2ISYA 5E17F 3SZPA 4Y15A 1I1SA 4YIFA 3T8TA 2HR3A 3F8CA 1HKTA 1ODDA 3F8NA 5FB2A 1F1ZA 1MZBA 1Z1DA 2HFHA 4G9YA 1HKQA 1J9IA 2BYVE 3H3UA 2MBFA 4G94A 2ZCWA 3NQOA 2YR2A 3HRTA 1REPC 1V4RA 3I0TA 4MNUA 3GWZA 1YW9A 2FMLA 2P7CB 4F7ZA 1OKRA 2DW4A 1O7LA 2BGCA 5H6RA 3HRMA 3WODF 2VBZA 3MQ0A 3I59B 1B4AA 1ONVA 5HDKA 4NB5A 3ELKA 2E7XA 3HSRA 3WTTC 4M71A 3U2RA 1FBQA 4L0ZB 4A12A 3TQNA 2ADUA 5ICFA 1XSVA 2XHKA 5DCFA 2RQPA 4AVPA 4HF0A 2ACJA 3F8FA 2DQLA 2MC3A 2L4MA 2E1NA 1JHHA 1QQIA 1U2WA 1L3LA 2JSCA 1TNSA 1TW2A 1R7JA 3VFZA 2EFOA 4WWCA 1MD0A 2Z3YA 1LDKB 4KA4A 3JSOA 3P9KA 4GGGA 2XKPA 1LVAA 4Q48A 5HLHA 1X3UA 4MTEA 3KLOA 2RKHA 5DUKA 2K4BA 3JAMZ 4BQAA 3RKYA 3JSPA 2OD5A 3MZYA 1XGMA 2YX7A 1OYIA 3EYYA 4MEXF 5AONA 1IXRC 4I0AA 3Q9VA 1TQPA 2LKPA 1PP8F 3IC7A 3CJNA 4L9TA 3GX4X 3HRUA 4PCQA 2IJLA 4WF2A 3TKYA 1IF1A 4KMFA 5HS7A 2XAFA 1FBUA 1J0RA 1ZRFA 4OMZA 4ESFA 3DF8A 3EDPA 1B9NA 4ETSA 3BZ6A 2HQNA 1Z7UA 2IW5A 2XAJA 1YS7A 2QUFA 3ABUA 3EUHA 3HSFA 2JZYA 4RB2C 1WWXA 4BAYA 3FM3A 1I6XA 3KP2A 2ISZA 3JAMK 4CHUA 1P92A 5LGUA 4RS8A 3W6JB 3DP7A 2QBYB 3T8RA 1O3TA 2HTJA 4G6DA 1ON1A 4U88A 3TO6A 1FP2A 5LHIA 3HOTA 1U3EM 2YX4A 2GZWA 3L9FA 1FYLA 3IWFA 2HGCA 3VOEA 3HTUA 3BWGA 4A0XA 3G3ZA 4EQQA 1ZLJA 2GA2A 2H27A 4XSZF 1O3RA 5CYVA 1WKMA 5L3DA 5E8IA 3LA7A 1O57A 2Z5UA 4MEYF 5E1XA 2QM3A 3LAJA 3GFJA 1FWZA 4G6QA 5CLSA 2K27A 2A07F 2MA3A 4AIHA 4HQEA 3W6KB 4G7OF 1BBYA 1I5ZA 1IW7F 4B8XA 3F22A 4ESJA 5HVQC 2EV0A 2RNJA 5KK1A 2CW0F 2FE3A 3R60A 2DLLA 4FHTA 1LB2A 4EGZA 2HYFA 1G3SA 1HW5A 3WGIA 2BE5F 1AWCA 4L5IA 4PGHA 5IT9K 4IJAA 2OZUA 2OQGA 3WE3A 2ZMEB 4U7BA 5J6XA 4ASNA 2O03A 2KKOA 3I71A 4HDVA 4WXHA 1ZN2A 3FZVA 2CWEA 2XRNA 3K1PA 5DEQA 5D5VB 5ILVA 3P7NA 1QNTA 2QYOA 2NRAC 3ULQB 1XGNA 2XROA 1UHMA 3D5LA 3I58A 5DD4A 1XDSA 3WTSC 4UNOA 4UXNA 1SFEA 4NQWA 3KEQA 4R8HA 5D4RA 4UHTA 3P9IA 5D8KB 1IRFA 2K4JA 4P96A 2DPDA 2UZKA 2MLKA 5CVJA 4I0BA 4N9IA 3DQVC 3TO9A 3BPVA 1T6SA 2GWRA 1SD7A 2STTA 4HX4A 4OIQF 2O61A 3K1NA 2JPCA 3I64A 5HDNA 1TTYA 5IT3A 2YSRA 1USTA 3DEUA 1V3FA 2NNYA 2ESNA 4EM0B 3OOPA 3E6DA 4M72A 2F5CA 2HZTA 3LA3A 5KVRA 3KP3A 1S7AA 1J7KA 2O3FA 5D6EA 2F2EA 2FOKA 2KJBA 2YU3A 1QO0D 1R1TA 2KJCA 5DYMA 5FD5A 4UVBA 5EEHA 1MDMB 5CVRA 3TOBA 3KP7A 2H6BA 4HDUA 3GLXA 3WTXC 4WX9A 1W5SA 4OOIA 1DP7P 2UWMA 1YG2A 2D1HA 2E7WA 4RGXA 2W57A 3KFWX 4L5JA 3V8JA 1USSA 4KFCA 2RGVA 2EA2A 2M87A 3FM5A 1FZPB 2W24A 2XAGA 3GZ5A 1BI2A 3LSTA 5J8CA 3D0SA 4S05A 1FNNA 1W5TA 1ON2A 1XCVA 3GW2A 3SHFA 1XN7A 1ULYA 1P2FA 4HBLA 2VBWA 2A6EF 5LGTA 3MZHA 5J8FA 4HA8A 5DUIA 1J75A 4XLNF 5HS9A 3COAC 1D3YA 2IPQX 3KLNA 4EM2A 1WSUA 4CYDA 1SD4A 5H6QA 2CFXA 1IN5A 4EVIA 2EFPA 3TDZC 2ZNZA 2QENA 2Y75A 3VEPA 1HKSA 3FMSA 2LF7A 2V79A 2RDPA 5ED4A 3QOPA 4KIFA 1K78A 2RN7A 1UCRA 4D0PA 3L7WA 2DU9A 2DAOA 5CJ9A 3K0LA 2NS0A 2P7VB 2L4AA 2O0YA 1G6NA 3Q9SA 5LRSA 2MH2A 2GQQA 4OMYA 3ZN1A 2GAUA 1YYVA 2DFIA 2XAHA 5BMZA 1JE8A 2IA2A 3RKWA 1P4AA 1EH8A 2P5VA 3CUQC 3P9CA 1OMIA 2M8EA 4KN7X 1RIOH 5BOXA 1BC7C 2WC2A 3FMRA 1SAXA 1W7PB 1I27A 2GA1A 2VE8A 5BS6A 2PN6A 4YFXF 2VONA 1FOKA 1Z6RA 5HDGA 1IAWA 2PG4A 2LNBA 2JTVA 1JGSA 3I59A 2EFQA 4GO1A 4HZFA 2M1BA 1YS6A 1JXSA 3WTUC 1KYZA 1KU7A 3T1BA 3IWZA 2PJPA 4I2OA 3J80Z 4LLLA 3FWEA 1OR7A 5LGNA 4BNCA 3Q5FA 3ZMDA 5LHGA 1FC3A 3E6MA 2R3SA 4JK1X 4LGWA 3E5UA 4HOBA 2OZ6A 4S04A 3GF2A 3RIRA 3H3ZA 1YQAA 3J7AO 1BN5A 1KQ9A 3ZMSA 5ERIA 1IZ1A 1U78A 3WU0A 5TRDA 3H92A 4OINF 4GYGA 3LFKA 1OYWA 5HOOA 4ZYDA 1U5TB 3QP5A 1CGPA 4CDGA 2EV6A 1FP1D 3RPUA 3J80K 3GEZA 3LQQA 2FXAA 1KA8A 2A6HF 2WTEA 2HQRA 2O6GE 5DD8A 1HW2A 3N97A 1QPMA 2V9VA 2EJRA 2VBYA 3GUDA 2HYGD 2IT0A 5E1WA 4U0WA 3NRVA 2FNAA 4QLCU 4UV8A 5E18F 1B59A 4OIOF 4AWXB 4YG2F 2GIVA 2K86A 1R5GA 2JPBA 4ESBA 2VOPA 1STZA 5A2QZ 2Z9OA 1WI9A 4P55A 5FFXA 4BHPA 1ZARA 1BOAA 1HXDA 2MLGA 3JTGA 3VODA 4RB0A 1R22A 1NHAA 2VC1A 2BV6A 1VTNC 3KZYA 3HSEA 2M5WA 2QBYA 4I98B 4LB5A 1QZZA 5L3EA 3ERED 1KQ8A 3MEXA 5ILSA 1IN4A 3GFLA 1W7PD 4A6EA 3WTWC 5CVVA 4Y17A 4M9ZA 4IXAA 4KMUX 1PDNC 4EJUA 1BI3A 2COMA 2DBBA 4LLGF 1Z9CA 3T0YA 2DK8A 2GXBA 3MWMA 3F6OA 3FMQA 2PFBA 4HF1A 4IHTA 2ZFWA 3ISPA 3C3WA 5A2QK 4L9JA 3F3XA 4M9XA 3KP6A 1XD7A 2FSWA 1ZREA 4JQFA 1O7FA 3WGGA 4ENJA 4KICA 4A0YA 1S8NA 4I01A 1S29A 4EJVA 5L3FA 1AOYA 1RUOA 3RTRA 5ICCA 3JTHA 1W4MA 3PQKA 3DPLC 3G73A 2XV4S 2OA4A 1FYMA 3N4MA 4A5MA 2HOEA 1PP7U 1DDNA 2DK5A 1WRJA 1U5TC 2BEOA 3CO6C 2ZMEA 1R36A 1RI7A 5LLQA 3QPTA 1S6LA 3HHHA 2Q0OA 4EV0A 4HX8A 4HLXA 4Z2YA 2P5LC 5LEKA 2DI3A 2EK5A 1XCBA 3K2ZA 2VT3A 5K1YA 3E5QA 1OPCA 3QAHA 2XASA 3E6CC 4AIJA 4AD9A 1IN8A 2OBPA 3R0JA 1D8JA 1QGPA 3RPQA 5HLIA 1SMTA 2R7FA 5FLXZ 1I1GA 2VE9A 1R00A 2AS5F 2V1XA 3AAFA 2ETHA 5DCMA 1K79A 1P4WA 3I53A 3WU1B 1T98A 4WK8F 1LDJA 4BYYA 2J5PA 3QPHA 1LJ9A 3M7GA 4LMYA 4E70A 1O3SA 4FT8A 3DFGA 1DPRA 3QU6A 3C18A 3F72A 3FHZA 2IP2A 3DKWA 1ZGAA 5F64A 1GXQA 5DCMB 1FT9A 2QQ9A 4ZZDA 2Y0MA 4HV6A 1B1BA 4TV7A 2HTSA 4OIPF 1UHWA 1HSJA 2R7DA 3CUQA 2UXNA 2IRFG 5FD6A 3K1MA 1ZG5A 1IN7A 5TJJA 4R79A 1MDMA 4HV5A 3HOSA 4HF2A 3BJ6A 4PGGA 4CGZA 5JFRA 3GZ6A 4L9VA 1YW7A 2XAQA 3M8FA 5D5UB 2ZBKA 2MH9A 2L54A 3F8MA 1F9NA 4HYEA 2G9WA 4PZJA 3CUQB 1P4XA 1GHCA 3MAJA 2X4HA 1ZGJA 1XDUA 2P5KA 2C6YA 1IXCA 2MD5A 1F5TA 1IN6A 2V1DA 1TLHB 3RYRA 4CICA 4UV9A 2IA0A 5JVTA 2CYYA 1IRGA 1RZ4A 1PUEE 3O6BB 3KP5A 4LB6B 2ELHA 2L3DA 2BBYA 1R1VA 3BDDA 2D1VA 2A5YB 4G8XA 4ZH4F 1XSXA 1P6RA 2PMHA 4IPAA 2OQRA 4L9NA 5D6FA 5L3GA 2OU2A 4BHCA 5F6FA 2WWYA 1GVJA 1DPUA 1XGSA 4KN4X 2XGXA 1BIAA 2AXLA 2FBIA 2JT1A 2WV0A 4A5NA 3WTVC 5ILUA 1BI0A 2FEZA 1K6OA 3MFKA 3SQNA 1T2KA 3ZPLA 5D4SA 4G7HF 4R1HA 1T39A 1T38A 2H94A 1FBSA 1BJAA 3HIFA 2CO5A 1BI1A 4FX0A 2HS5A 1WQ2A 3KP4A 1IXSB 2K7LA 4IRHA 2M45A 1IUYA 1G3TA 3HUGA 3RJPA 4KYWA 1FSEA 1F4KA 4MTDA 5DV5A 2A61A 2PEXA 4OIRF 1T0FA 1R23A 1U6GA 3DV8A 5H20A 4O3MA 1B9MA 4P9UA 1MKMA 1HQCA 1XMAA 2DO7A 2PQ8A 1H9TA 4L0YB 1RNLA 2FBKA 2UXXA 3MCZA 2ZJ2A 1FX7A 5CVUA 2D45A 4CXFA 1W7PA 2NYXA 2DQRA 4OU0A 1MJ9A 4M6YA 2F5EA 4ZZLA 2XKOA 4LD5A 5JI6A 2QWWA 2LSOA 2ZXJA 4IF4A 3TGNA 1SMYF 1TNTA 1Z91A 4M9SA 4XSXF 3WGHA 1G3WA 3RDIA 5ICGA 2QQAA 2QLZA 4EJTA 4HAMA 1J5YA 2LDUA 2VOOA 2P8TA 5JR3A 1TBXA 3K69A 5AIQA 4M74A 3NEUA 2B0LA 4BHBA 3ROUA 3V7RA 4UVCA 4N0BA 1UFMA 2FF4A 2W84A 1SFUA 5E20A 1TQMA 3FXUA 2VBXA 3B02A 3BY6A 4EM1A 2A3SA 1Z05A 2QVOA 4EJOA 3LAPA 4GXOA 4A0ZA 1FYKA 1G4DA 5FFZA 2LF8A 1O3QA 5F1RA 3ZMZA 1U5TA 1QBJA 4XRFA 4LFUA 1YO5C 2FBHA 3SFZA 4KT5C 5FGMA 4P5OA 4AIKA 5LEJA 4IRGA 4ON0A 1FPQA 5LRRA 2QQBA 3IKVA 3EETA 3EYIA 3PQJA 4CZZA 1XMKA 1YW8A 3GVAA 3L09A 1E17A 1MJBA 5K5QA 2CGPA 3C1DA 1S3JA 3ML6A 4RAYA 2EB7A 3CLOA 1ZYRF 1MGTA 3PFIA 2NNNA 2KIUA 4LK1F 2JRTA 2RVCA 1FY7A 4FX4A 1KGSA 4I09A 1Z6TA 1TQIA 4U0VA 3F6VA 3TOAA 1LEBA 3CUOA 3E6BA 4PDKA 2P4WA 5BPDA 1B6AA 2CSOA 2ZO4A 1Q1HA 4RGSA 3U1DA 4UVAA 5D8LB 2RV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQL F;  4XLP F;  4M73 A;  2EWN A;  5CVI A;  3V8K A;  4A6D A;  4A2U A;  5LHH A;  3GXO A;  3L00 A;  2IVM A;  3R61 A;  1KU9 A;  4HX7 A;  4LJZ F;  4P9F A;  3CO7 C;  3BRO A;  2IA1 A;  2P6T A;  4HLY A;  2VOD A;  3KE2 A;  3QU3 A;  3WE2 A;  4H0E A;  2L01 A;  3WTY C;  2EFN A;  1L0O C;  3E3V A;  3JW4 A;  3RKX A;  3U9G A;  3CTA A;  3KZZ A;  4ZYG A;  3ZQ7 A;  3ZMT A;  3R0A A;  4KDP A;  2GXG A;  4KIB A;  4EJW A;  1R1U A;  2W85 A;  3SZT A;  4RB1 A;  3QP6 A;  4M6X A;  2V1U A;  2HDC A;  4KIG A;  5E1Z B;  2W25 A;  5L3B A;  1KQ0 A;  4UUV A;  3LQR A;  3RI4 A;  1LNW A;  2PBI A;  2Y48 A;  3GO5 A;  2TDX A;  2QZ8 A;  2HWV A;  3OV8 A;  3T5X A;  1XGO A;  1J2X A;  3GFI A;  3LWF A;  4LG0 A;  5ICE A;  2YPR A;  3F21 A;  3IKT A;  3E5X A;  2Z99 A;  5E8G A;  1ZRC A;  5IT9 Z;  1ZHF A;  4NHJ A;  2D2W A;  4Y13 A;  3HTS B;  2H6C A;  4LK0 F;  1EH7 A;  5LBQ A;  3BOQ A;  2ESH A;  3WG9 A;  4HW0 A;  4LG0 B;  5D5W B;  4GYI A;  5DDG A;  3IRR A;  2EFW A;  3BPX A;  4G7Z F;  3ZP5 A;  3V8L A;  3ZMV A;  3HHG A;  4ENM A;  3ZN0 A;  1YFH A;  1ZG3 A;  4HQM A;  2EV5 A;  4U0Y A;  4QWQ A;  1ZH5 A;  2FA5 A;  3I5U A;  1S7O A;  4KNY A;  1D5V A;  1BC8 C;  1YIO A;  5HS8 A;  4JBA A;  2M30 A;  2A68 F;  2FQ3 A;  1ZRD A;  1LEA A;  5HLG A;  2OAZ A;  4MGR A;  4RGU A;  3DPT A;  4U7D A;  3KCC A;  3V7C A;  2P6S A;  4IHS A;  1QZY A;  4CO8 A;  1SD5 A;  3L2C A;  4RB3 C;  1HW1 A;  3M9A A;  4N9H A;  1EV7 A;  3I54 A;  3J81 Z;  1TW3 A;  1C0W A;  3TO7 A;  5K5O A;  1ZG1 A;  1SFX A;  2Z33 A;  2FMY A;  5D5X B;  4B09 A;  2ZNY A;  1FLI A;  2HKO A;  4DNC A;  5FLX K;  3K9T A;  1ZAO A;  3S2W A;  4EMS A;  2Q2E A;  2VC0 A;  4GCV A;  3V7S A;  1R58 A;  4BXU A;  1LQ1 A;  2X0L A;  2F5F A;  4Q4Z F;  2F5D A;  2CG4 A;  1OYY A;  2L02 A;  3ECH A;  3E97 A;  1FSH A;  5FO5 A;  2XIG A;  3BJO A;  1SD6 A;  4ENN A;  3J81 K;  2NAZ A;  3GFM A;  1JHF A;  3IRQ A;  1KU3 A;  2H09 A;  1YTY A;  1LDD A;  4YII A;  3WTZ A;  4KUM A;  3KEO A;  3V4G A;  2PLY A;  1EH6 A;  2FU4 A;  2CQK A;  3R4K A;  3FX3 A;  2DT5 A;  4RAZ A;  3ZMU A;  2E1C A;  1ZLK A;  1CF7 A;  4WCG A;  3F23 A;  5BPI A;  3F8B A;  4IVN A;  3VB2 A;  2KIM A;  1U8R A;  1DUX C;  5AIP A;  3FXR A;  1A04 A;  2KIF A;  3RYP A;  4ZYE A;  3LA2 A;  2K02 A;  5L3C A;  2FNP A;  3ABT A;  2G7H A;  2O8X A;  2V6C A;  1CF7 B;  2VN2 A;  1E2X A;  2FRH A;  5K5R A;  4LLN A;  2VT2 A;  3R6S A;  3QRF F;  3HYI A;  3REO A;  1BIB A;  4ENK A;  2DTR A;  1Y0U A;  2DPU A;  1BM9 A;  1YLF A;  3TDU C;  3CDH A;  3GYH X;  4YFK F;  4YFN F;  2KRF A;  4I02 A;  1HST A;  1HBX G;  2Q8K A;  3BJA A;  4MQ9 F;  1J59 A;  4WXD A;  4Q47 A;  3SXY A;  1D8K A;  2PMU A;  6PAX A;  2A69 F;  3ECO A;  3HRS A;  4EGY A;  2STW A;  5JHU A;  2HEO A;  4XBF A;  3M8E A;  4O5V A;  2EA4 A;  3I4P A;  1R5H A;  3M1E A;  1MJA A;  2RC4 A;  2XVC A;  3BP8 A;  3O2P E;  5BQT A;  3FF5 A;  3KET A;  4K2E A;  4MHG A;  1K7A A;  3IL2 A;  4I7H A;  4ZYH A;  4Q5S F;  2PI0 A;  4BH9 A;  3O3K A;  1KYW A;  1KU2 A;  5EEG A;  3B73 A;  1GXP A;  3C7J A;  4O6J A;  2VXZ A;  2G7U A;  2ZKZ A;  1G3Y A;  1RUN A;  4IRI A;  1H0M A;  4MQV A;  2HKX A;  4L18 B;  3FXQ A;  2XUB A;  3IHU A;  1XSD A;  4WXC A;  1K78 B;  4RGR A;  3DXJ F;  2J5O A;  1UB9 A;  1XB4 A;  1H9G A;  4DQ2 A;  2ISY A;  5E17 F;  3SZP A;  4Y15 A;  1I1S A;  4YIF A;  3T8T A;  2HR3 A;  3F8C A;  1HKT A;  1ODD A;  3F8N A;  5FB2 A;  1F1Z A;  1MZB A;  1Z1D A;  2HFH A;  4G9Y A;  1HKQ A;  1J9I A;  2BYV E;  3H3U A;  2MBF A;  4G94 A;  2ZCW A;  3NQO A;  2YR2 A;  3HRT A;  1REP C;  1V4R A;  3I0T A;  4MNU A;  3GWZ A;  1YW9 A;  2FML A;  2P7C B;  4F7Z A;  1OKR A;  2DW4 A;  1O7L A;  2BGC A;  5H6R A;  3HRM A;  3WOD F;  2VBZ A;  3MQ0 A;  3I59 B;  1B4A A;  1ONV A;  5HDK A;  4NB5 A;  3ELK A;  2E7X A;  3HSR A;  3WTT C;  4M71 A;  3U2R A;  1FBQ A;  4L0Z B;  4A12 A;  3TQN A;  2ADU A;  5ICF A;  1XSV A;  2XHK A;  5DCF A;  2RQP A;  4AVP A;  4HF0 A;  2ACJ A;  3F8F A;  2DQL A;  2MC3 A;  2L4M A;  2E1N A;  1JHH A;  1QQI A;  1U2W A;  1L3L A;  2JSC A;  1TNS A;  1TW2 A;  1R7J A;  3VFZ A;  2EFO A;  4WWC A;  1MD0 A;  2Z3Y A;  1LDK B;  4KA4 A;  3JSO A;  3P9K A;  4GGG A;  2XKP A;  1LVA A;  4Q48 A;  5HLH A;  1X3U A;  4MTE A;  3KLO A;  2RKH A;  5DUK A;  2K4B A;  3JAM Z;  4BQA A;  3RKY A;  3JSP A;  2OD5 A;  3MZY A;  1XGM A;  2YX7 A;  1OYI A;  3EYY A;  4MEX F;  5AON A;  1IXR C;  4I0A A;  3Q9V A;  1TQP A;  2LKP A;  1PP8 F;  3IC7 A;  3CJN A;  4L9T A;  3GX4 X;  3HRU A;  4PCQ A;  2IJL A;  4WF2 A;  3TKY A;  1IF1 A;  4KMF A;  5HS7 A;  2XAF A;  1FBU A;  1J0R A;  1ZRF A;  4OMZ A;  4ESF A;  3DF8 A;  3EDP A;  1B9N A;  4ETS A;  3BZ6 A;  2HQN A;  1Z7U A;  2IW5 A;  2XAJ A;  1YS7 A;  2QUF A;  3ABU A;  3EUH A;  3HSF A;  2JZY A;  4RB2 C;  1WWX A;  4BAY A;  3FM3 A;  1I6X A;  3KP2 A;  2ISZ A;  3JAM K;  4CHU A;  1P92 A;  5LGU A;  4RS8 A;  3W6J B;  3DP7 A;  2QBY B;  3T8R A;  1O3T A;  2HTJ A;  4G6D A;  1ON1 A;  4U88 A;  3TO6 A;  1FP2 A;  5LHI A;  3HOT A;  1U3E M;  2YX4 A;  2GZW A;  3L9F A;  1FYL A;  3IWF A;  2HGC A;  3VOE A;  3HTU A;  3BWG A;  4A0X A;  3G3Z A;  4EQQ A;  1ZLJ A;  2GA2 A;  2H27 A;  4XSZ F;  1O3R A;  5CYV A;  1WKM A;  5L3D A;  5E8I A;  3LA7 A;  1O57 A;  2Z5U A;  4MEY F;  5E1X A;  2QM3 A;  3LAJ A;  3GFJ A;  1FWZ A;  4G6Q A;  5CLS A;  2K27 A;  2A07 F;  2MA3 A;  4AIH A;  4HQE A;  3W6K B;  4G7O F;  1BBY A;  1I5Z A;  1IW7 F;  4B8X A;  3F22 A;  4ESJ A;  5HVQ C;  2EV0 A;  2RNJ A;  5KK1 A;  2CW0 F;  2FE3 A;  3R60 A;  2DLL A;  4FHT A;  1LB2 A;  4EGZ A;  2HYF A;  1G3S A;  1HW5 A;  3WGI A;  2BE5 F;  1AWC A;  4L5I A;  4PGH A;  5IT9 K;  4IJA A;  2OZU A;  2OQG A;  3WE3 A;  2ZME B;  4U7B A;  5J6X A;  4ASN A;  2O03 A;  2KKO A;  3I71 A;  4HDV A;  4WXH A;  1ZN2 A;  3FZV A;  2CWE A;  2XRN A;  3K1P A;  5DEQ A;  5D5V B;  5ILV A;  3P7N A;  1QNT A;  2QYO A;  2NRA C;  3ULQ B;  1XGN A;  2XRO A;  1UHM A;  3D5L A;  3I58 A;  5DD4 A;  1XDS A;  3WTS C;  4UNO A;  4UXN A;  1SFE A;  4NQW A;  3KEQ A;  4R8H A;  5D4R A;  4UHT A;  3P9I A;  5D8K B;  1IRF A;  2K4J A;  4P96 A;  2DPD A;  2UZK A;  2MLK A;  5CVJ A;  4I0B A;  4N9I A;  3DQV C;  3TO9 A;  3BPV A;  1T6S A;  2GWR A;  1SD7 A;  2STT A;  4HX4 A;  4OIQ F;  2O61 A;  3K1N A;  2JPC A;  3I64 A;  5HDN A;  1TTY A;  5IT3 A;  2YSR A;  1UST A;  3DEU A;  1V3F A;  2NNY A;  2ESN A;  4EM0 B;  3OOP A;  3E6D A;  4M72 A;  2F5C A;  2HZT A;  3LA3 A;  5KVR A;  3KP3 A;  1S7A A;  1J7K A;  2O3F A;  5D6E A;  2F2E A;  2FOK A;  2KJB A;  2YU3 A;  1QO0 D;  1R1T A;  2KJC A;  5DYM A;  5FD5 A;  4UVB A;  5EEH A;  1MDM B;  5CVR A;  3TOB A;  3KP7 A;  2H6B A;  4HDU A;  3GLX A;  3WTX C;  4WX9 A;  1W5S A;  4OOI A;  1DP7 P;  2UWM A;  1YG2 A;  2D1H A;  2E7W A;  4RGX A;  2W57 A;  3KFW X;  4L5J A;  3V8J A;  1USS A;  4KFC A;  2RGV A;  2EA2 A;  2M87 A;  3FM5 A;  1FZP B;  2W24 A;  2XAG A;  3GZ5 A;  1BI2 A;  3LST A;  5J8C A;  3D0S A;  4S05 A;  1FNN A;  1W5T A;  1ON2 A;  1XCV A;  3GW2 A;  3SHF A;  1XN7 A;  1ULY A;  1P2F A;  4HBL A;  2VBW A;  2A6E F;  5LGT A;  3MZH A;  5J8F A;  4HA8 A;  5DUI A;  1J75 A;  4XLN F;  5HS9 A;  3COA C;  1D3Y A;  2IPQ X;  3KLN A;  4EM2 A;  1WSU A;  4CYD A;  1SD4 A;  5H6Q A;  2CFX A;  1IN5 A;  4EVI A;  2EFP A;  3TDZ C;  2ZNZ A;  2QEN A;  2Y75 A;  3VEP A;  1HKS A;  3FMS A;  2LF7 A;  2V79 A;  2RDP A;  5ED4 A;  3QOP A;  4KIF A;  1K78 A;  2RN7 A;  1UCR A;  4D0P A;  3L7W A;  2DU9 A;  2DAO A;  5CJ9 A;  3K0L A;  2NS0 A;  2P7V B;  2L4A A;  2O0Y A;  1G6N A;  3Q9S A;  5LRS A;  2MH2 A;  2GQQ A;  4OMY A;  3ZN1 A;  2GAU A;  1YYV A;  2DFI A;  2XAH A;  5BMZ A;  1JE8 A;  2IA2 A;  3RKW A;  1P4A A;  1EH8 A;  2P5V A;  3CUQ C;  3P9C A;  1OMI A;  2M8E A;  4KN7 X;  1RIO H;  5BOX A;  1BC7 C;  2WC2 A;  3FMR A;  1SAX A;  1W7P B;  1I27 A;  2GA1 A;  2VE8 A;  5BS6 A;  2PN6 A;  4YFX F;  2VON A;  1FOK A;  1Z6R A;  5HDG A;  1IAW A;  2PG4 A;  2LNB A;  2JTV A;  1JGS A;  3I59 A;  2EFQ A;  4GO1 A;  4HZF A;  2M1B A;  1YS6 A;  1JXS A;  3WTU C;  1KYZ A;  1KU7 A;  3T1B A;  3IWZ A;  2PJP A;  4I2O A;  3J80 Z;  4LLL A;  3FWE A;  1OR7 A;  5LGN A;  4BNC A;  3Q5F A;  3ZMD A;  5LHG A;  1FC3 A;  3E6M A;  2R3S A;  4JK1 X;  4LGW A;  3E5U A;  4HOB A;  2OZ6 A;  4S04 A;  3GF2 A;  3RIR A;  3H3Z A;  1YQA A;  3J7A O;  1BN5 A;  1KQ9 A;  3ZMS A;  5ERI A;  1IZ1 A;  1U78 A;  3WU0 A;  5TRD A;  3H92 A;  4OIN F;  4GYG A;  3LFK A;  1OYW A;  5HOO A;  4ZYD A;  1U5T B;  3QP5 A;  1CGP A;  4CDG A;  2EV6 A;  1FP1 D;  3RPU A;  3J80 K;  3GEZ A;  3LQQ A;  2FXA A;  1KA8 A;  2A6H F;  2WTE A;  2HQR A;  2O6G E;  5DD8 A;  1HW2 A;  3N97 A;  1QPM A;  2V9V A;  2EJR A;  2VBY A;  3GUD A;  2HYG D;  2IT0 A;  5E1W A;  4U0W A;  3NRV A;  2FNA A;  4QLC U;  4UV8 A;  5E18 F;  1B59 A;  4OIO F;  4AWX B;  4YG2 F;  2GIV A;  2K86 A;  1R5G A;  2JPB A;  4ESB A;  2VOP A;  1STZ A;  5A2Q Z;  2Z9O A;  1WI9 A;  4P55 A;  5FFX A;  4BHP A;  1ZAR A;  1BOA A;  1HXD A;  2MLG A;  3JTG A;  3VOD A;  4RB0 A;  1R22 A;  1NHA A;  2VC1 A;  2BV6 A;  1VTN C;  3KZY A;  3HSE A;  2M5W A;  2QBY A;  4I98 B;  4LB5 A;  1QZZ A;  5L3E A;  3ERE D;  1KQ8 A;  3MEX A;  5ILS A;  1IN4 A;  3GFL A;  1W7P D;  4A6E A;  3WTW C;  5CVV A;  4Y17 A;  4M9Z A;  4IXA A;  4KMU X;  1PDN C;  4EJU A;  1BI3 A;  2COM A;  2DBB A;  4LLG F;  1Z9C A;  3T0Y A;  2DK8 A;  2GXB A;  3MWM A;  3F6O A;  3FMQ A;  2PFB A;  4HF1 A;  4IHT A;  2ZFW A;  3ISP A;  3C3W A;  5A2Q K;  4L9J A;  3F3X A;  4M9X A;  3KP6 A;  1XD7 A;  2FSW A;  1ZRE A;  4JQF A;  1O7F A;  3WGG A;  4ENJ A;  4KIC A;  4A0Y A;  1S8N A;  4I01 A;  1S29 A;  4EJV A;  5L3F A;  1AOY A;  1RUO A;  3RTR A;  5ICC A;  3JTH A;  1W4M A;  3PQK A;  3DPL C;  3G73 A;  2XV4 S;  2OA4 A;  1FYM A;  3N4M A;  4A5M A;  2HOE A;  1PP7 U;  1DDN A;  2DK5 A;  1WRJ A;  1U5T C;  2BEO A;  3CO6 C;  2ZME A;  1R36 A;  1RI7 A;  5LLQ A;  3QPT A;  1S6L A;  3HHH A;  2Q0O A;  4EV0 A;  4HX8 A;  4HLX A;  4Z2Y A;  2P5L C;  5LEK A;  2DI3 A;  2EK5 A;  1XCB A;  3K2Z A;  2VT3 A;  5K1Y A;  3E5Q A;  1OPC A;  3QAH A;  2XAS A;  3E6C C;  4AIJ A;  4AD9 A;  1IN8 A;  2OBP A;  3R0J A;  1D8J A;  1QGP A;  3RPQ A;  5HLI A;  1SMT A;  2R7F A;  5FLX Z;  1I1G A;  2VE9 A;  1R00 A;  2AS5 F;  2V1X A;  3AAF A;  2ETH A;  5DCM A;  1K79 A;  1P4W A;  3I53 A;  3WU1 B;  1T98 A;  4WK8 F;  1LDJ A;  4BYY A;  2J5P A;  3QPH A;  1LJ9 A;  3M7G A;  4LMY A;  4E70 A;  1O3S A;  4FT8 A;  3DFG A;  1DPR A;  3QU6 A;  3C18 A;  3F72 A;  3FHZ A;  2IP2 A;  3DKW A;  1ZGA A;  5F64 A;  1GXQ A;  5DCM B;  1FT9 A;  2QQ9 A;  4ZZD A;  2Y0M A;  4HV6 A;  1B1B A;  4TV7 A;  2HTS A;  4OIP F;  1UHW A;  1HSJ A;  2R7D A;  3CUQ A;  2UXN A;  2IRF G;  5FD6 A;  3K1M A;  1ZG5 A;  1IN7 A;  5TJJ A;  4R79 A;  1MDM A;  4HV5 A;  3HOS A;  4HF2 A;  3BJ6 A;  4PGG A;  4CGZ A;  5JFR A;  3GZ6 A;  4L9V A;  1YW7 A;  2XAQ A;  3M8F A;  5D5U B;  2ZBK A;  2MH9 A;  2L54 A;  3F8M A;  1F9N A;  4HYE A;  2G9W A;  4PZJ A;  3CUQ B;  1P4X A;  1GHC A;  3MAJ A;  2X4H A;  1ZGJ A;  1XDU A;  2P5K A;  2C6Y A;  1IXC A;  2MD5 A;  1F5T A;  1IN6 A;  2V1D A;  1TLH B;  3RYR A;  4CIC A;  4UV9 A;  2IA0 A;  5JVT A;  2CYY A;  1IRG A;  1RZ4 A;  1PUE E;  3O6B B;  3KP5 A;  4LB6 B;  2ELH A;  2L3D A;  2BBY A;  1R1V A;  3BDD A;  2D1V A;  2A5Y B;  4G8X A;  4ZH4 F;  1XSX A;  1P6R A;  2PMH A;  4IPA A;  2OQR A;  4L9N A;  5D6F A;  5L3G A;  2OU2 A;  4BHC A;  5F6F A;  2WWY A;  1GVJ A;  1DPU A;  1XGS A;  4KN4 X;  2XGX A;  1BIA A;  2AXL A;  2FBI A;  2JT1 A;  2WV0 A;  4A5N A;  3WTV C;  5ILU A;  1BI0 A;  2FEZ A;  1K6O A;  3MFK A;  3SQN A;  1T2K A;  3ZPL A;  5D4S A;  4G7H F;  4R1H A;  1T39 A;  1T38 A;  2H94 A;  1FBS A;  1BJA A;  3HIF A;  2CO5 A;  1BI1 A;  4FX0 A;  2HS5 A;  1WQ2 A;  3KP4 A;  1IXS B;  2K7L A;  4IRH A;  2M45 A;  1IUY A;  1G3T A;  3HUG A;  3RJP A;  4KYW A;  1FSE A;  1F4K A;  4MTD A;  5DV5 A;  2A61 A;  2PEX A;  4OIR F;  1T0F A;  1R23 A;  1U6G A;  3DV8 A;  5H20 A;  4O3M A;  1B9M A;  4P9U A;  1MKM A;  1HQC A;  1XMA A;  2DO7 A;  2PQ8 A;  1H9T A;  4L0Y B;  1RNL A;  2FBK A;  2UXX A;  3MCZ A;  2ZJ2 A;  1FX7 A;  5CVU A;  2D45 A;  4CXF A;  1W7P A;  2NYX A;  2DQR A;  4OU0 A;  1MJ9 A;  4M6Y A;  2F5E A;  4ZZL A;  2XKO A;  4LD5 A;  5JI6 A;  2QWW A;  2LSO A;  2ZXJ A;  4IF4 A;  3TGN A;  1SMY F;  1TNT A;  1Z91 A;  4M9S A;  4XSX F;  3WGH A;  1G3W A;  3RDI A;  5ICG A;  2QQA A;  2QLZ A;  4EJT A;  4HAM A;  1J5Y A;  2LDU A;  2VOO A;  2P8T A;  5JR3 A;  1TBX A;  3K69 A;  5AIQ A;  4M74 A;  3NEU A;  2B0L A;  4BHB A;  3ROU A;  3V7R A;  4UVC A;  4N0B A;  1UFM A;  2FF4 A;  2W84 A;  1SFU A;  5E20 A;  1TQM A;  3FXU A;  2VBX A;  3B02 A;  3BY6 A;  4EM1 A;  2A3S A;  1Z05 A;  2QVO A;  4EJO A;  3LAP A;  4GXO A;  4A0Z A;  1FYK A;  1G4D A;  5FFZ A;  2LF8 A;  1O3Q A;  5F1R A;  3ZMZ A;  1U5T A;  1QBJ A;  4XRF A;  4LFU A;  1YO5 C;  2FBH A;  3SFZ A;  4KT5 C;  5FGM A;  4P5O A;  4AIK A;  5LEJ A;  4IRG A;  4ON0 A;  1FPQ A;  5LRR A;  2QQB A;  3IKV A;  3EET A;  3EYI A;  3PQJ A;  4CZZ A;  1XMK A;  1YW8 A;  3GVA A;  3L09 A;  1E17 A;  1MJB A;  5K5Q A;  2CGP A;  3C1D A;  1S3J A;  3ML6 A;  4RAY A;  2EB7 A;  3CLO A;  1ZYR F;  1MGT A;  3PFI A;  2NNN A;  2KIU A;  4LK1 F;  2JRT A;  2RVC A;  1FY7 A;  4FX4 A;  1KGS A;  4I09 A;  1Z6T A;  1TQI A;  4U0V A;  3F6V A;  3TOA A;  1LEB A;  3CUO A;  3E6B A;  4PDK A;  2P4W A;  5BPD A;  1B6A A;  2CSO A;  2ZO4 A;  1Q1H A;  4RGS A;  3U1D A;  4UVA A;  5D8L B;  2RV8 A; 
#chains in the Genus database with same CATH topology
 3EQL F;  4XLP F;  3FK6 A;  2LR8 A;  4JX4 A;  4M73 A;  2EWN A;  5CVI A;  2XF6 A;  3V8K A;  4A6D A;  4A2U A;  5LHH A;  1HOM A;  3GXO A;  4XKB A;  3L00 A;  3IP4 B;  2ZSH B;  2IVM A;  3R61 A;  3GZN B;  1JGG A;  1KU9 A;  4HX7 A;  4LJZ F;  4P9F A;  2GLO A;  2R5Z A;  3CO7 C;  3S1R J;  3S3M A;  3BRO A;  2NOJ B;  2QCO A;  4NC6 A;  1T8I A;  4J19 A;  2IA1 A;  1IV8 A;  2F4O B;  2P6T A;  4HLY A;  4MO7 A;  2VOD A;  2DOE A;  2R7S A;  3KE2 A;  3QU3 A;  1QVU A;  3WE2 A;  4H0E A;  2L01 A;  1ZR4 A;  1IDY A;  3MKZ A;  3WTY C;  2EFN A;  3H3V K;  1L0O C;  3AG3 H;  3E3V A;  3JW4 A;  3RKX A;  3ZCO A;  1A31 A;  2OCC H;  3U9G A;  3CTA A;  4NC8 A;  3DU6 A;  3KZZ A;  3LSM A;  3ZQ7 A;  4ZYG A;  2HOT A;  3ZMT A;  2X85 A;  3R0A A;  4BKX A;  3DLA A;  2VQC A;  5EGO B;  1MW7 A;  4BJ5 C;  3F0C A;  4KDP A;  2HOS A;  2GXG A;  3PUB A;  1JKO C;  4KIB A;  4EJW A;  4CUG A;  2CQQ A;  1R1U A;  3JRH A;  2E1O A;  2W85 A;  1EKE A;  3FXJ A;  3FXO A;  5J47 A;  1F43 A;  3SZT A;  1W36 C;  3KPH A;  4RB1 A;  3QP6 A;  4M6X A;  2V1U A;  3AKZ A;  2HDC A;  1YOV B;  4KIG A;  5E1Z B;  4BGD A;  2W25 A;  2JRM A;  4ITV A;  2DA1 A;  5L3B A;  1KQ0 A;  4UUV A;  1Y1W J;  3LQR A;  3AG1 H;  3RI4 A;  2CU7 A;  3S16 J;  1S5L C;  1LNW A;  1TWF J;  2PBI A;  2Y48 A;  3GO5 A;  4A69 C;  2TDX A;  2QZ8 A;  5CQE A;  2HWV A;  3H5R A;  3OV8 A;  3T5X A;  1XGO A;  4RDU A;  1J2X A;  2E5N A;  3GFI A;  1ETQ A;  5GPC A;  3LWF A;  4LG0 A;  3HOX J;  2W00 A;  3KIO A;  5ICE A;  2YPR A;  1H8A C;  4XON A;  5EG0 A;  3F21 A;  3K4C A;  3RZD J;  3IKT A;  3E5X A;  2Z99 A;  3ESW B;  3GTL J;  1LFP A;  4IO9 F;  1GUU A;  5E8G A;  2LYC A;  1G2H A;  1ZRC A;  5IT9 Z;  4JOM A;  2OJE D;  4IHW A;  1ZHF A;  3KYC B;  4NHJ A;  2D2W A;  4Y13 A;  1S9H A;  3KX2 A;  3CF5 F;  1ZQ3 P;  3HTS B;  4ZDL A;  1VQL I;  2H6C A;  4LK0 F;  3G2B A;  1EH7 A;  2KIS A;  3A0B C;  3SEQ A;  1OR7 C;  1Y8Q B;  2MYS A;  3H9J A;  5LBQ A;  1JKQ C;  2LRE A;  2LRD A;  1TL8 A;  3BOQ A;  2DOD A;  2ESH A;  2ZB9 A;  4B3X A;  3WG9 A;  2HQ5 A;  3CC4 I;  4HW0 A;  4LG0 B;  5D5W B;  1TWH J;  4GYI A;  5DDG A;  1Y6I A;  3IRR A;  2EFW A;  3BPX A;  2KRH A;  4A3E J;  4G7Z F;  2VLA A;  2VKV A;  1K61 A;  3ZP5 A;  3V8L A;  3ZMV A;  3HHG A;  4ENM A;  3FKJ A;  3ZN0 A;  1BR1 A;  3OYC A;  1YFH A;  3S17 J;  1D5Y A;  4GRI A;  2Z16 A;  1ZG3 A;  4HQM A;  1HDP A;  2EV5 A;  4U0Y A;  4QWQ A;  2LBF B;  5IP7 J;  1ZH5 A;  2CUE A;  2FA5 A;  3FK7 A;  3I5U A;  3A4C A;  2P0T A;  1YHQ I;  4IOA F;  1S7O A;  4KNY A;  2WB1 A;  1Y1V J;  5DM7 F;  2MGQ A;  2ZFU A;  2E5Z A;  4XN0 A;  3CDL A;  1JTX A;  1D5V A;  1BC8 C;  2M0M A;  3VWB A;  1K4T A;  3K7A J;  1YIO A;  4EAT A;  2JA2 A;  3BG5 A;  5HS8 A;  4JBA A;  2IS1 A;  2M30 A;  2FQ3 A;  1XTA A;  2A68 F;  4E4H A;  1LEA A;  1IV6 A;  1ZRD A;  3PO2 J;  5HLG A;  4XLF A;  2XGC A;  2OAZ A;  3K2A A;  4MGR A;  4RGU A;  1WGX A;  3DPT A;  4U7D A;  4A3I J;  3J7A W;  3BR6 A;  3KCC A;  3V7C A;  2P6S A;  3K6G A;  4IHS A;  2X6X A;  4MFE A;  1QZY A;  3J7Z I;  1MMD A;  2JSP A;  4CO8 A;  3CMA I;  1U9O A;  1SD5 A;  3L2C A;  4RB3 C;  2JA6 J;  2RNG A;  1HW1 A;  3TMO A;  3M9A A;  4N9H A;  5EJC A;  2ZJQ F;  2DYS H;  1EV7 A;  2O9L A;  3I54 A;  3OYA A;  3J81 Z;  1TW3 A;  1X1B A;  3VPR A;  1C0W A;  1N75 A;  1TT0 A;  2YS9 A;  1NG6 A;  3TO7 A;  4ZJZ A;  1H89 C;  1Z0X A;  5K5O A;  1ZG1 A;  1BOB A;  1SFX A;  2Z33 A;  2EIM H;  2FMY A;  1ZTR A;  2V9P A;  2CFO A;  1R6R A;  2R7X A;  5D5X B;  4B09 A;  2ZNY A;  1FLI A;  2HKO A;  5M5Y J;  4DNC A;  5B1A H;  4Y33 A;  5FLX K;  3HG9 A;  3K9T A;  2ELJ A;  1DU0 A;  4A3J J;  1ZAO A;  3H0D A;  3DTK A;  3S2W A;  2FUG 2;  2OTJ I;  1HA8 A;  2LP0 A;  4EMS A;  2Q2E A;  3LL7 A;  5E3M A;  4BE0 A;  1V5G A;  1D0Z A;  2VC0 A;  4GCV A;  3V7S A;  3CJR B;  2DN0 A;  1R58 A;  4BXU A;  1LQ1 A;  2X0L A;  2M34 A;  2F5F A;  4Q4Z F;  2F5D A;  2CG4 A;  4XKV A;  4B48 A;  1OYY A;  2ZXW H;  3CES A;  3VDX A;  2L02 A;  3HPG A;  1MBG A;  2CW7 A;  3E97 A;  3ECH A;  2R7V A;  3CMY A;  1FSH A;  4A3F J;  1SVO A;  5FO5 A;  2DFH A;  4XN3 A;  4XLE A;  2M4K A;  1FOY A;  4PSX A;  4NQW B;  1LUJ B;  2XIG A;  3BJO A;  2L9N A;  2L9R A;  1SD6 A;  4ENN A;  3J81 K;  2ZC2 A;  4CSW A;  1LE8 A;  2NAZ A;  2D5V A;  3L2Q A;  3GFM A;  1A36 A;  1JHF A;  1E3H A;  3IRQ A;  4YIR X;  5FRO A;  1KU3 A;  1W0U A;  3DEW A;  1MNE A;  2W1O A;  2H09 A;  3CCR I;  1YTY A;  3FDY A;  4HG2 A;  3OYH A;  2VQG A;  1LDD A;  4F3Q A;  2B7E A;  2KRC A;  4YII A;  3WTZ A;  3LOC A;  1FMW A;  4KUM A;  3I3L A;  3KEO A;  2YU9 J;  3V4G A;  2PLY A;  3GCM A;  1EH6 A;  3PO3 J;  2H8R A;  2OF7 A;  1HC8 A;  2FU4 A;  3B6A A;  2CQK A;  3CMM A;  3LNQ A;  3R4K A;  4FQG A;  1ORK A;  3FX3 A;  4KIT B;  2DT5 A;  4RAG A;  3VSL A;  3BR1 A;  4RAZ A;  3ZMU A;  2E1C A;  1ZLK A;  2ICW G;  2K9M A;  1CF7 A;  4WCG A;  4DBQ A;  3F23 A;  2I5U A;  2JN6 A;  3DTE A;  3JRA A;  5BPI A;  1QVT A;  3F8B A;  4IVN A;  1QHG A;  3VB2 A;  2KIM A;  3H1C A;  3G4S I;  1GVD A;  2KPM A;  1U8R A;  1DUX C;  5AIP A;  2F6C A;  2E34 A;  5M3F J;  4B47 A;  2QSG X;  3FXR A;  1A04 A;  2KIF A;  3RYP A;  2BVL A;  4C3J J;  3SFI A;  4ZYE A;  3LA2 A;  2K02 A;  5L3C A;  5M3M J;  2FNP A;  1ZR2 A;  3M4O J;  1EJ9 A;  3ABT A;  2L7M P;  3OL4 A;  3OOU A;  2G7H A;  1VQ5 I;  1X4P A;  2O8X A;  2V6C A;  4C9Y A;  3DKX A;  3OS0 A;  1CF7 B;  1U0J A;  3CCJ I;  3RKQ A;  2CRG A;  3BTC A;  2CH0 A;  2VN2 A;  1E2X A;  2FRH A;  1I3A A;  5K5R A;  3MVP A;  1FOX A;  2DJN A;  4LLN A;  2VT2 A;  3R6S A;  3QRF F;  1X3Z B;  3HYI A;  3REO A;  1P7J A;  2A05 A;  1BIB A;  4ENK A;  1AKH B;  4NBQ A;  2DTR A;  1Y0U A;  2FX0 A;  4QPQ A;  3CME I;  3K4J A;  4AC0 A;  2DPU A;  1BM9 A;  1YLF A;  3TDU C;  4AU7 A;  3CDH A;  3GYH X;  3HOW J;  4YFK F;  1RPW A;  5TIS C;  4YFN F;  2KRF A;  4I02 A;  2X51 A;  1HST A;  1FTT A;  1HBX G;  2Q8K A;  3OS1 A;  4LIU A;  3BJA A;  1MBE A;  4MQ9 F;  1VQK I;  2XGE A;  2PMZ A;  4L5E A;  1J59 A;  5EEA A;  4WXD A;  4HRI A;  3K10 A;  4Q47 A;  3SXY A;  1D8K A;  4M3B A;  1AHD P;  4CYC B;  2PMU A;  5B5E C;  2R5Y A;  3ABL H;  6PAX A;  2A69 F;  1GLN A;  3ECO A;  2AQE A;  3HRS A;  4EGY A;  5GAH J;  2STW A;  3HGG A;  5JHU A;  1UMQ A;  4D9J A;  3G71 I;  2HEO A;  2H1L A;  2NVY J;  2HPM A;  4XBF A;  3TED A;  3M8E A;  4O5V A;  1TT5 B;  2EA4 A;  3M1C A;  1A6I A;  2MG4 A;  1R5H A;  3I4P A;  1MJA A;  3M1E A;  2RC4 A;  1OQY A;  2XVC A;  2K40 A;  3BP8 A;  3O2P E;  5BQT A;  2NS8 A;  3FF5 A;  3KET A;  1Y56 A;  4K2E A;  4V2F A;  3ZQI A;  4MHG A;  1K7A A;  4PFO A;  3IL2 A;  2Y2Z A;  4I7H A;  4ZYH A;  3JAM R;  3OIP A;  2HNH A;  2K3P A;  4Q5S F;  4XKC A;  2PI0 A;  4BH9 A;  5FRN A;  3O3K A;  1KYW A;  2EIK H;  4II2 A;  1VQM I;  4DZJ A;  4RBO A;  3FXM A;  1KU2 A;  2E2J J;  5EEG A;  3B73 A;  1PJR A;  1GXP A;  4Y4R A;  3C7J A;  2L2O A;  4O6J A;  2R7Z J;  1V5E A;  2VXZ A;  3S93 A;  2LKX A;  3OYG A;  3H36 A;  2G7U A;  2BHZ A;  2ZKZ A;  1G3Y A;  3A52 A;  5J40 A;  4XMY A;  2E2H J;  3HB9 A;  1RUN A;  2JA7 J;  4IRI A;  1UJ8 A;  4E7I A;  5IOY A;  1H0M A;  4MQV A;  1Z77 A;  1JKR C;  2HKX A;  4L18 B;  4BS9 A;  3FXQ A;  1TWG J;  1MBJ A;  2XUB A;  3IHU A;  4WXC A;  1XSD A;  5FRM A;  1K78 B;  4RGR A;  3DXJ F;  2J5O A;  3EUA A;  2WAE A;  2LY1 A;  1UB9 A;  3H9G A;  4MIM A;  5GTH C;  1XB4 A;  2Y9Z A;  3GTO J;  2E60 A;  1H9G A;  4DQ2 A;  1Z3X A;  2ISY A;  3E0J B;  4V19 K;  1X3W B;  1ZK8 A;  2WV1 A;  3SZP A;  5E17 F;  4Y15 A;  1I1S A;  2WY7 Q;  2X6W A;  4YIF A;  3CC7 I;  2CV1 A;  5F1J A;  2EZH A;  3T8T A;  2L9S A;  3A0H C;  1X4O A;  2HR3 A;  3F8C A;  1HKT A;  3A02 A;  1SFK A;  4E7L A;  2V1N A;  2MFZ A;  1WCM J;  1ODD A;  4BQQ A;  3F8N A;  4BXX J;  3L2W A;  3L1P A;  3MN2 A;  2BVM A;  5FB2 A;  2CUF A;  4DIQ A;  4G12 A;  5E3O A;  2E2I J;  3M8J A;  5KAF C;  1F1Z A;  2BZT A;  5E3N A;  1MZB A;  1Z1D A;  2CV0 A;  1KON A;  4YRV A;  2HFH A;  2ID3 A;  1QRY A;  4G9Y A;  1HKQ A;  1J9I A;  2BYV E;  3H3U A;  2MBF A;  1Q1V A;  4G94 A;  4DBR A;  3CCU I;  1ENH A;  2ZCW A;  2DA7 A;  3NQO A;  2YR2 A;  1ETX A;  2I10 A;  2JJ7 A;  2DOF A;  3HRT A;  1REP C;  1V4R A;  3MKY B;  2NVU B;  2CUJ A;  4B4C A;  1U8B A;  3I0T A;  4X1E A;  1I3Q J;  1WH7 A;  4MNU A;  2BXY A;  3GWZ A;  2VJ4 A;  1YW9 A;  2FML A;  2P7C B;  1SVM A;  4F7Z A;  3GTG J;  4DZP A;  1OKR A;  2DW4 A;  1VQN I;  5C4X J;  2BW3 A;  1O7L A;  4E7H A;  2BGC A;  5H6R A;  2DDA A;  3HRM A;  4DJA A;  1FTZ A;  2XRL A;  3WOD F;  2VBZ A;  2KL4 A;  3MQ0 A;  3I59 B;  3CCV I;  3ASO H;  1B4A A;  1ONV A;  3MMY B;  5HDK A;  3CCQ I;  2B9S A;  2P81 A;  4I99 C;  4XM3 A;  4NB5 A;  5C44 J;  2KP6 A;  3ELK A;  2E7X A;  2ME0 A;  3HSR A;  3WTT C;  4M71 A;  5J1Y A;  5KCM A;  3U2R A;  1FBQ A;  1YIJ I;  4L0Z B;  1WJ5 A;  4XKW A;  4A12 A;  3TQN A;  2ADU A;  5ICF A;  3ZGK A;  1VQ7 I;  1XSV A;  2XHK A;  5DCF A;  2RQP A;  2LOO A;  4AVP A;  4HF0 A;  2ACJ A;  3F8F A;  3CP8 A;  2DQL A;  2MC3 A;  2Z1D A;  2L4M A;  2E1N A;  1JHH A;  1QQI A;  2A5W A;  1U2W A;  2VJI A;  1L3L A;  2JSC A;  4HNU A;  1TNS A;  4IQ4 A;  1TW2 A;  1R7J A;  2Y0S N;  1VZ0 A;  2KT0 A;  1IC8 A;  1A6Q A;  2HZD A;  4PUS A;  3FKI J;  3IAS 2;  3F9K A;  3VFZ A;  2EFO A;  3K4N A;  4WWC A;  1B72 A;  3PM1 A;  3Q0U A;  2ZXI A;  1MD0 A;  2HI3 A;  2Z3Y A;  1LDK B;  3OYF A;  4ABZ A;  2OPT A;  1JTY A;  4AUX A;  4KA4 A;  1O4X A;  3L2R A;  3JSO A;  1MNM C;  5EGO A;  3P9K A;  4GGG A;  4IEJ A;  2KZV A;  2XKP A;  1LVA A;  2R0Q C;  4Q48 A;  5E3L A;  5HLH A;  1X3U A;  4CH7 A;  3DWL E;  4MTE A;  2OUM A;  3OR2 C;  4W1U A;  2RRE A;  3KLO A;  2RKH A;  5DUK A;  2R7Q A;  4BAC A;  2K4B A;  3KEY A;  3JAM Z;  3JRC A;  4BQA A;  3RKY A;  3JSP A;  2XDV A;  1JUS A;  2OD5 A;  4RM2 A;  3MZY A;  1XGM A;  2YX7 A;  2UUZ A;  1OYI A;  1G8X A;  3EYY A;  4MEX F;  1Y39 A;  2PJR A;  5AON A;  3PIO F;  1IXR C;  4I0A A;  1B72 B;  3Q9V A;  1TQP A;  2LKP A;  1PP8 F;  3OYJ A;  4RA2 A;  3NWT A;  3IC7 A;  2HVQ A;  5J1U A;  4IKF A;  3CJN A;  4L9T A;  2KIQ A;  1I6H J;  3GX4 X;  2BOL A;  1TZL A;  3HRU A;  4IL6 C;  2KDZ A;  2JWT A;  4PCQ A;  2IJL A;  2M9H A;  2RAE A;  4WF2 A;  1IDZ A;  3HOZ J;  3TKY A;  1IF1 A;  3DLL F;  3BLY A;  2WAF A;  5HS7 A;  4KMF A;  2XAF A;  1FBU A;  1FOW A;  2XPU A;  1WI3 A;  1DQU A;  1J0R A;  1D1C A;  3DBL B;  1ZRF A;  4I76 A;  4BQO A;  1J09 A;  4OMZ A;  2QA4 I;  1D0Y A;  3DF8 A;  5F04 A;  4ESF A;  3EDP A;  3M3Y J;  1R9T J;  1B9N A;  4XNF A;  4ETS A;  2X1C A;  3BZ6 A;  2HQN A;  1Z7U A;  1TWA J;  2IW5 A;  2PJR B;  2XAJ A;  1YS7 A;  3PFY A;  4QSH A;  5FKO A;  3D5R C;  3HOY J;  3NAU A;  1FIP A;  2QUF A;  3ABU A;  3EUH A;  2VKH A;  2JUG A;  2F48 A;  2VPR A;  3HSF A;  2JZY A;  4RB2 C;  1WWX A;  3ZXS A;  1RET A;  3FM3 A;  4BAY A;  3CZ6 A;  2VKD A;  2NVQ J;  5K7Z A;  3O8G A;  1I6X A;  3KP2 A;  2W7N A;  2ISZ A;  2CW8 A;  3JAM K;  1W36 D;  4CHU A;  1P92 A;  5LGU A;  3S8P A;  4X0G A;  4RS8 A;  3W6J B;  3DP7 A;  2MD0 A;  2DMU A;  2QBY B;  3T8R A;  2NVX J;  2XGD A;  1O3T A;  4XOR A;  2HTJ A;  4G6D A;  3PUF A;  1XPX A;  1ON1 A;  2PMZ N;  4U88 A;  3TO6 A;  1FP2 A;  4DYQ A;  5LHI A;  3HOT A;  2YX4 A;  2GZW A;  3L9F A;  1U3E M;  1FYL A;  3C2B A;  1EF4 A;  1EA3 A;  3FBN B;  3IWF A;  2HGC A;  3VOE A;  3HTU A;  3HKZ A;  3BWG A;  4A0X A;  1QHH D;  1Y0N A;  3G3Z A;  4EQQ A;  1ZLJ A;  1HDD C;  2GA2 A;  2H27 A;  1RC9 A;  4XSZ F;  2CQ7 A;  2LBF A;  1O3R A;  4DGW B;  5CYV A;  1WKM A;  3EUK L;  5L3D A;  5E8I A;  3GTP J;  3LA7 A;  1O57 A;  1ZEL A;  2Z5U A;  2TCT A;  4MEY F;  5E1X A;  2QM3 A;  3LAJ A;  1FEX A;  3JRD A;  5F0C A;  3GFJ A;  4BJT A;  1FWZ A;  3HJE A;  4G6Q A;  5CLS A;  2K27 A;  3NAR A;  2A07 F;  2MA3 A;  4E7K A;  4AIH A;  3H5A A;  5IYC J;  1YJN I;  2ZJR F;  3B6C A;  4HQE A;  3W6K B;  4G7O F;  1BBY A;  1I5Z A;  1IW7 F;  4B8X A;  3F22 A;  4ESJ A;  5HVQ C;  2DFE A;  2EV0 A;  5HNH A;  1BL0 A;  3WHC A;  1ZKG A;  2DYR H;  4UUS B;  3OYI A;  2RNJ A;  5IP6 A;  5KK1 A;  3KYL A;  4AYB A;  2CW0 F;  3IH4 A;  3HBL A;  3OIQ A;  1XX5 A;  2K3F A;  2FE3 A;  2F4M B;  1YJ9 I;  2DT7 B;  3H0G J;  3H9Q A;  2CJJ A;  3R60 A;  2DLL A;  2VKE A;  3BTL A;  4FHT A;  4XR6 A;  4PJ0 C;  1WZ2 A;  2IEK A;  5K7F A;  1LB2 A;  4EGZ A;  3OYK A;  2HYF A;  1G3S A;  1HW5 A;  3WGI A;  4EEF G;  2BE5 F;  3X2Q H;  4BBR J;  1AWC A;  4L5I A;  5CKT A;  1ETV A;  4PGH A;  5IT9 K;  4IJA A;  2OZU A;  3HOU J;  4M6V A;  3G6E I;  4PJN A;  1XC5 A;  3G1O A;  1SEU A;  2OQG A;  3WE3 A;  3BQZ A;  2ZME B;  4U7B A;  5J6X A;  1JT6 A;  4F55 A;  4ASN A;  3CD6 I;  1V5F A;  2KKO A;  2O03 A;  3I71 A;  1B8I B;  1YE9 A;  4HDV A;  3PNY A;  3WHB A;  3NWS A;  1PUF B;  4WXH A;  1ZN2 A;  2XB5 A;  3FZV A;  2CWE A;  4RMN A;  4Y7N J;  3FXL A;  2XRN A;  3K1P A;  5DEQ A;  2MSY A;  5D5V B;  3OS2 A;  1MMN A;  5ILV A;  3P7N A;  1QNT A;  3LSR A;  2QYO A;  3OR1 C;  3ZQH A;  4C2M J;  2Y9Y A;  2NRA C;  3ULQ B;  1XGN A;  1HF0 A;  4ZDP A;  3RPU D;  2XRO A;  1UHM A;  3D5L A;  3I58 A;  2VPL A;  5DD4 A;  1DP3 A;  1XDS A;  3WTS C;  4UNO A;  4UXN A;  4A3K J;  1D0X A;  3K4L A;  1SFE A;  1X58 A;  4NQW A;  4J00 A;  3S1M J;  4E7Z A;  3KEQ A;  4R8H A;  4DW6 A;  5D4R A;  3IH2 A;  4UHT A;  3P9I A;  2JUC A;  5D8K B;  1IRF A;  2K4J A;  5HNF A;  4P96 A;  4V2G A;  2DPD A;  1RES A;  2UZK A;  3JCU C;  3TL4 X;  2MLK A;  5CVJ A;  4AM3 A;  4I0B A;  4N9I A;  3DQV C;  3GTK J;  4QIW N;  1QU3 A;  4B44 A;  1ZGW A;  3TO9 A;  3ZQQ A;  3BPV A;  1T6S A;  2GWR A;  2HYJ A;  2UV1 A;  1SD7 A;  2STT A;  1MH3 A;  9ANT A;  4HX4 A;  2ECC A;  2BY1 A;  1OCT C;  3I4M J;  3G1M A;  4XQF A;  2X1D A;  3CP2 A;  3HM5 A;  3W2V A;  3HPH A;  2BY2 A;  1TWC J;  3W6V A;  4OIQ F;  3K4M A;  4XRS G;  5TGT A;  1RR7 A;  1X1P A;  2L7K A;  2O61 A;  3K1N A;  2JPC A;  4QTR A;  2NXN B;  2IAI A;  3I64 A;  5HDN A;  1TTY A;  5IT3 A;  2YSR A;  1UST A;  1JUM A;  4XLC A;  2DTZ A;  3BR2 A;  3DEU A;  1V3F A;  2NNY A;  2ESN A;  2L9V A;  2XC7 A;  4EM0 B;  5FKK A;  2JQ7 A;  3OOP A;  4OAZ A;  2LG4 A;  3Q0W A;  3E6D A;  2JMW A;  1OIS A;  4M72 A;  1X1A A;  2F5C A;  2DDB A;  2HZT A;  1M1E B;  4A93 J;  1T56 A;  3LA3 A;  2HQA A;  5KVR A;  3KP3 A;  1E3O C;  3VYT B;  1S7A A;  4RAF A;  3AL0 C;  1J7K A;  3PL8 A;  2O3F A;  3PSI A;  3MKL A;  4IQJ A;  5D6E A;  2LTP A;  3WU2 C;  3VYR B;  2CS3 A;  2F2E A;  2FOK A;  2KJB A;  2YU3 A;  1QO0 D;  1R1T A;  2EPF A;  2KJC A;  5DYM A;  5FD5 A;  4YEL A;  4UVB A;  4YEJ A;  1IJW C;  1K6Y A;  5EEH A;  1MDM B;  3LFU A;  5CVR A;  3TOB A;  3KP7 A;  4XLA A;  4JYK A;  2H6B A;  5IYB J;  5B1B H;  3J80 R;  2WBM A;  3GLX A;  3WTX C;  4HDU A;  1ERD A;  4WX9 A;  2WY8 Q;  1AKH A;  3S14 J;  2IS2 A;  1W5S A;  1MSE C;  4OOI A;  3V42 A;  2ZSI B;  4XOP A;  1DP7 P;  2UWM A;  4Y52 J;  5HOD A;  3QYE A;  2K85 A;  1R4N B;  1OLT A;  1X19 A;  1YG2 A;  4FET A;  2D1H A;  1N77 A;  2E7W A;  1ETK A;  4RGX A;  2KMU A;  4CCJ A;  2W57 A;  4CZC A;  4IOC F;  3W2A A;  3KFW X;  4FTH A;  4KT6 A;  4ZYA A;  2IXS A;  4L5J A;  3V8J A;  1USS A;  2KZG A;  4KFC A;  2ZME C;  1SC7 A;  2RGV A;  2VIX A;  2EA2 A;  2R4G A;  1SVL A;  2M87 A;  3FM5 A;  3SZG A;  1FZP B;  1IG7 A;  4CYC A;  1MBK A;  1TP4 A;  2W24 A;  3ZQC A;  2XAG A;  3GZ5 A;  2DMP A;  1BI2 A;  3LST A;  2VAS A;  1YX5 A;  5J8C A;  4XK4 A;  2E35 A;  3D0S A;  4OAY A;  4S05 A;  4HSR A;  1Y8R B;  3S1Q J;  5CPR B;  1FNN A;  1W5T A;  2VB6 A;  1ON2 A;  1XCV A;  1DGW Y;  3GW2 A;  3SHF A;  4D5F A;  1XN7 A;  3GTM J;  4B43 A;  1ULY A;  1P2F A;  2FQ4 A;  4HBL A;  5GTI C;  2VBW A;  2A6E F;  5LGT A;  4A3L J;  1NG7 A;  3MZH A;  3BCA A;  5J8F A;  2W82 A;  4HA8 A;  2HOA A;  5DUI A;  4IZZ A;  1J75 A;  4HNV A;  4XLN F;  5HS9 A;  3COA C;  1BR4 A;  2IS6 A;  1D3Y A;  2DMQ A;  2IPQ X;  1F36 A;  2K9N A;  5IP9 J;  2IGO A;  3KLN A;  3LSP A;  3CCE I;  4MFD A;  5KNL A;  4EM2 A;  1WSU A;  4CYD A;  1QPI A;  1SD4 A;  2L7Z A;  5H6Q A;  2CFX A;  1IN5 A;  4EVI A;  2MW8 A;  2NS7 A;  3UR3 C;  5BNG A;  3CCM I;  2EFP A;  3TDZ C;  2ZNZ A;  2QEN A;  2Y75 A;  5FJ8 J;  3VEP A;  3RSN A;  3I56 I;  2JVG A;  1WHU A;  1HKS A;  3FMS A;  1TC3 C;  2LF7 A;  4BJ6 C;  2JVH A;  1VI0 A;  1W5C C;  1LFB A;  2O7O A;  2V79 A;  2RDP A;  5ED4 A;  2HXO A;  3QOP A;  2I8D A;  1XG1 A;  1VQ8 I;  4OWR B;  4KIF A;  1K78 A;  2DMN A;  2RN7 A;  1UCR A;  4D0P A;  5A2Q R;  1CQT A;  3L7W A;  3HKZ N;  1WJF A;  2DU9 A;  3JR9 A;  2DAO A;  5CJ9 A;  3AFH A;  1IRZ A;  3K0L A;  2NS0 A;  2P7V B;  3K70 C;  2L4A A;  3LSI A;  2O0Y A;  1G6N A;  3Q9S A;  4RLQ A;  2Y69 H;  1LPQ A;  5LRS A;  5B3S H;  2MH2 A;  2DA2 A;  2GQQ A;  2WAQ A;  4OMY A;  1XS9 A;  3ZN1 A;  2GAU A;  1WVR A;  1YYV A;  2DFI A;  2XAH A;  5BMZ A;  1JE8 A;  2IA2 A;  3RKW A;  1P4A A;  1EH8 A;  2P5V A;  3CUQ C;  3P9C A;  3BZC A;  4UB8 C;  5GPA A;  1G59 A;  4A3G J;  1OMI A;  3W3C A;  2M8E A;  4KN7 X;  1AU7 A;  1I39 A;  1RIO H;  2H8W A;  5BOX A;  2IGK A;  4AYB N;  1R49 A;  3RQ4 A;  1BC7 C;  2WC2 A;  3FMR A;  3H5N A;  1SAX A;  4PJM A;  1K4S A;  2R93 J;  4GDF A;  3HC7 A;  2WB1 N;  3OYD A;  3O8H A;  1W7P B;  1I27 A;  2DMT A;  2GA1 A;  2HU9 A;  4F92 B;  2ID6 A;  2VE8 A;  2X9D A;  5BS6 A;  4FE7 A;  1SAN A;  1JJ8 C;  2VQH A;  2PN6 A;  4XL9 A;  4YFX F;  1X2M A;  2PX9 A;  2LY2 A;  3PNV A;  2VON A;  4NUB A;  4CCL A;  1FOK A;  1Z6R A;  5HDG A;  1JKP C;  1IAW A;  3DBR B;  4P1W A;  2PG4 A;  5KHD A;  3KYD B;  4CA0 A;  1S72 I;  2LNB A;  2JTV A;  2WA0 A;  1JGS A;  3I59 A;  4BEH B;  2EFQ A;  4GO1 A;  4HZF A;  2M1B A;  2K9L A;  3DTI A;  1YS6 A;  1JXS A;  3WTU C;  1W0T A;  1KYZ A;  1KU7 A;  1FIA A;  3T1B A;  2KLO A;  1SAU A;  2M7B A;  3HXL A;  3IWZ A;  1YX3 A;  2PJP A;  3S1N J;  4I2O A;  4DYC A;  2KQR A;  1MMA A;  5E79 C;  4F93 B;  2QSH X;  3J80 Z;  4LLL A;  3FWE A;  3BR0 A;  4QPO A;  2DJI A;  1OR7 A;  5LGN A;  3E7L A;  4BNC A;  3Q5F A;  3IAM 2;  2YUS A;  3IV5 A;  2ME6 A;  3ZMD A;  1JUP A;  5LHG A;  1FC3 A;  3E6M A;  2R3S A;  2GOM A;  4F91 B;  3J81 R;  4JK1 X;  4LGW A;  4BDZ A;  1YRN B;  2X6O A;  3QYB A;  4BDY A;  3E1S A;  3E5U A;  4HOB A;  2OZ6 A;  4S04 A;  3GF2 A;  4ANJ A;  3RZO J;  1T95 A;  2OTL I;  3JRF A;  3RCO A;  3RIR A;  1DGR M;  3H3Z A;  1YQA A;  3VYU B;  2M0C A;  1P9Q C;  4E7S A;  1FJL A;  3J7A O;  3TBI A;  1R5I D;  1R4M B;  1Z67 A;  3S2D J;  1BN5 A;  1KQ9 A;  3I9V 2;  4IHV A;  3ZMS A;  3BTJ A;  2VI6 A;  5ERI A;  3SDG A;  2R7U A;  2E1M B;  2MC4 A;  1IZ1 A;  2B63 J;  1NK3 P;  4D5C A;  1U78 A;  1MSF C;  1NH3 A;  3WU0 A;  5TRD A;  2XSJ C;  4PJJ A;  5EDN A;  3H92 A;  4NDL A;  3L2U A;  4OIN F;  4GYG A;  3LFK A;  2KHM A;  1OYW A;  3N05 A;  5HOO A;  4ZYD A;  1RKT A;  3BR5 A;  1U5T B;  3QP5 A;  5C3E J;  1BR2 A;  1VQO I;  5HLT A;  1VFC A;  5GAE J;  3JRB A;  4D7M A;  3ZQL A;  4U87 A;  1JT0 A;  4ZC3 A;  4CDG A;  1CGP A;  1T08 B;  2EV6 A;  1WJE A;  2GOX B;  3SEZ A;  1FP1 D;  3RPU A;  3J80 K;  3GEZ A;  4MLO A;  3LQQ A;  2FXA A;  2OV7 A;  5GAG J;  1D1A A;  1KA8 A;  2A6H F;  2L0K A;  2WTE A;  2HQR A;  4A3B J;  4AID A;  3VSK A;  2R7W A;  2AO9 A;  3PSF A;  5DD8 A;  3ZQF A;  1HW2 A;  3CJT B;  2O6G E;  3N97 A;  1QPM A;  2V9V A;  2EJR A;  2VBY A;  5F08 A;  3GUD A;  5GAD J;  5K7H A;  1ETY A;  2HYG D;  4A3C J;  2IT0 A;  2VXD A;  4XRS A;  4BL0 B;  1OCZ H;  4JX6 A;  1A35 A;  2F5V A;  5E1W A;  2IS4 A;  4GFB A;  4U0W A;  3NRV A;  1IO2 A;  1Z7L A;  3BTI A;  3OYM A;  3FIS A;  1MBF A;  5IPA A;  2FNA A;  3BC8 A;  2IBD A;  3SDB A;  4QLC U;  2P0W A;  4UV8 A;  5E18 F;  3I4N J;  1B59 A;  2BY3 A;  5J1R A;  4OIO F;  1X1D A;  4AWX B;  4BUP A;  1LKX A;  2GIV A;  4YG2 F;  3A1Y A;  2K86 A;  3QPL A;  2NVT J;  4HNT A;  4PK4 A;  1R5G A;  1T0F C;  2JPB A;  4KIS A;  4PSW A;  4ESB A;  4B1R A;  3BT9 A;  1MBH A;  3L2V A;  2LD5 A;  5H2F C;  1STZ A;  2VOP A;  5A2Q Z;  2Z9O A;  1WI9 A;  4P55 A;  3LSH A;  5FFX A;  4BHP A;  1ZAR A;  1BOA A;  1HXD A;  2MLG A;  3JTG A;  3VOD A;  3P5J A;  4RB0 A;  1R22 A;  5JLW A;  1NHA A;  2VC1 A;  2BV6 A;  3M07 A;  1VTN C;  3KZY A;  2XB0 X;  3HSE A;  1K83 J;  2M5W A;  2QBY A;  3DU5 A;  4I98 B;  4LB5 A;  1QZZ A;  5J4Y A;  2M4G A;  5L3E A;  4BE1 A;  3ERE D;  2LVS A;  3LSK A;  1KQ8 A;  3MEX A;  3QPS A;  5ILS A;  4BY1 J;  4UY8 I;  2IGN A;  1IN4 A;  3GFL A;  1W7P D;  4A6E A;  3WTW C;  2R5Z B;  5CVV A;  4Y17 A;  4M9Z A;  4IXA A;  4Z6Y A;  1RQ6 A;  4KJZ A;  2QGU A;  1UG0 A;  4J01 A;  4KMU X;  1PDN C;  3J7Y J;  4EJU A;  1BI3 A;  1WJD A;  2COM A;  3CC2 I;  4ZTJ A;  2VL8 A;  4HPQ A;  1I50 J;  2DBB A;  2V9K A;  4LLG F;  1Z9C A;  3PIP F;  3T0Y A;  2DK8 A;  2HXI A;  2GXB A;  2AHQ A;  5F0H A;  3MWM A;  3F6O A;  3FMQ A;  2PFB A;  4HF1 A;  4IHT A;  2ZFW A;  3ISP A;  1RKW A;  3PJR A;  3C3W A;  5A2Q K;  4L9J A;  3F3X A;  4M9X A;  3KP6 A;  3OYN A;  1XD7 A;  2LMD A;  5DS9 A;  2FSW A;  4HST A;  3QQA A;  2HPI A;  1ZRE A;  2KDO A;  3QOE A;  2XPW A;  4JQF A;  1O7F A;  4RLF A;  4UUS A;  1APL C;  2QQ8 A;  3WGG A;  2GM4 A;  4C3H J;  4ENJ A;  3OYB A;  2LK2 A;  4KIC A;  4A0Y A;  2IGM A;  1W1W E;  1S8N A;  4I01 A;  1S29 A;  2M35 A;  2E1M C;  4EJV A;  5L3F A;  1AOY A;  1E0E A;  1RUO A;  3RTR A;  5ICC A;  3JTH A;  1W4M A;  3PQK A;  3DPL C;  3G73 A;  2L7F P;  2XV4 S;  2OA4 A;  1QA6 A;  3OIO A;  1FYM A;  2VQL A;  3N4M A;  4A5M A;  2HOE A;  1PP7 U;  3AL0 B;  1DDN A;  2DK5 A;  3A03 A;  3GTJ J;  1WRJ A;  2MUN A;  5CQG A;  4I6Z A;  3D1N I;  1U5T C;  2BEO A;  2E71 A;  3CO6 C;  1VQ9 I;  2ZME A;  1R36 A;  1RI7 A;  4G6T B;  2O5R A;  5LLQ A;  3HGY A;  3CCS I;  2MAB A;  2QF7 A;  3QPT A;  2NOG A;  3BG9 A;  1B8I A;  1S6L A;  3HHH A;  2Q0O A;  3SYT A;  4IHY A;  2BHY A;  4EV0 A;  4HX8 A;  4HLX A;  2WAD A;  4Z2Y A;  2P5L C;  2X6Y A;  1PUF A;  4BQN A;  5LEK A;  3FXK A;  2DI3 A;  2EK5 A;  1MND A;  4RM3 A;  1XCB A;  3K2Z A;  1ACI A;  2VT3 A;  1WPK A;  3ABM H;  5K1Y A;  3E5Q A;  5EG0 B;  3C2H A;  3BQY A;  2LFB A;  1OPC A;  3QAH A;  2XAS A;  3E6C C;  4AIJ A;  4AD9 A;  1IN8 A;  2V6E A;  2OBP A;  2CUZ A;  4FAS D;  3R0J A;  2WAQ N;  1D8J A;  1QGP A;  3RPQ A;  5EYR A;  4XIC A;  5HLI A;  1SMT A;  2R7F A;  4NC7 A;  5FLX Z;  3OSG A;  1ITY A;  1DU6 A;  1U9N A;  2K5C A;  1PYV A;  1MMG A;  5IOZ A;  3RQI A;  3Q0V A;  1I1G A;  3AG4 H;  2VE9 A;  1NTC A;  3CQZ J;  1OCR H;  1R00 A;  1JI8 A;  2AS5 F;  2V1X A;  3AAF A;  2ETH A;  5DCM A;  1K79 A;  1IUF A;  1P4W A;  3MKW B;  3I53 A;  3WU1 B;  1OCP A;  1T98 A;  5JVG F;  3HDD A;  4WK8 F;  1LDJ A;  2TRT A;  3S15 J;  2HVS A;  3HZJ A;  1BA5 A;  1WH5 A;  3CCL I;  4A3D J;  4LIT A;  4BYY A;  2J5P A;  2CV2 A;  3QPH A;  4H4K C;  1LJ9 A;  2W48 A;  3M7G A;  4E7J A;  4LMY A;  1H88 C;  3PNT A;  4E70 A;  1O3S A;  1D1B A;  2ZXH A;  4FT8 A;  3DFG A;  1DPR A;  5DM6 F;  1JJ6 C;  4II3 A;  3QU6 A;  3C18 A;  3F72 A;  3FHZ A;  4B3A A;  2AXT C;  2IP2 A;  3DKW A;  1ZGA A;  5F64 A;  2DCE A;  1MMS A;  2DOA A;  1HCR A;  1GXQ A;  5DCM B;  1FT9 A;  4DYR A;  5C4J J;  1V55 H;  2QQ9 A;  3OY9 A;  1R71 A;  5FKM A;  4ZZD A;  2Y0M A;  3MD2 A;  2ZJP F;  4HV6 A;  2XF7 A;  3ABK H;  3KZI C;  3BCB A;  1XMX A;  1B1B A;  4BY7 J;  2M7A A;  2HTS A;  4TV7 A;  4OIP F;  1UHW A;  1HSJ A;  3ZOB A;  2LY9 A;  2R7D A;  1VQ6 I;  3DEE A;  3CUQ A;  2UXN A;  4XID A;  5EF6 A;  2IRF G;  5FD6 A;  3K1M A;  3ZRG A;  1ZG5 A;  2JA8 J;  1IN7 A;  4JP0 A;  5TJJ A;  4M3E A;  3ZQG A;  2XSD C;  3IH3 A;  4R79 A;  3CF2 A;  1MDM A;  4HV5 A;  3HOS A;  4HF2 A;  3BJ6 A;  1OCO H;  3SJM A;  4PGG A;  5FKN A;  3S3O A;  1HLV A;  5JFR A;  4CGZ A;  3GZ6 A;  4L9V A;  1YW7 A;  2XAQ A;  3M8F A;  5D5U B;  2ZBK A;  1WJC A;  2MH9 A;  2Y0S A;  2DA5 A;  2BY0 A;  2Q2E B;  2L54 A;  4CCK A;  3F8M A;  5EZH A;  1F9N A;  4HYE A;  2G9W A;  4PZJ A;  2EZL A;  2ELK A;  4LOC A;  3S3N A;  3CUQ B;  1P4X A;  3UKG A;  1GHC A;  3MAJ A;  2R92 J;  1X1C A;  2X4H A;  3EUH C;  1A5J A;  3U21 A;  1YIT I;  1ZGJ A;  4XOT A;  1XDU A;  1OJL A;  3I55 I;  2P5K A;  2C6Y A;  1IXC A;  2MD5 A;  1F5T A;  1IN6 A;  2V1D A;  3OSF A;  1TLH B;  2L5Q A;  3RYR A;  4CIC A;  2HDD A;  4UV9 A;  4AVZ A;  2JK3 A;  2IA0 A;  4LG3 A;  3TW6 A;  5JVT A;  2CYY A;  1IRG A;  1LE8 B;  1RZ4 A;  1PUE E;  3O6B B;  2BXZ A;  2CMP A;  3BZK A;  3EPZ A;  3KP5 A;  4FE4 A;  4LB6 B;  2ELH A;  2L3D A;  2M8G X;  2BBY A;  1X2N A;  2EIJ H;  4IX7 A;  1R1V A;  3DPU A;  2EZK A;  2DT6 A;  3BDD A;  4CCO A;  1BW6 A;  3BG7 A;  1T33 A;  2D1V A;  2A5Y B;  4G8X A;  2W4S A;  4ZH4 F;  3FIW A;  1XSX A;  2AQF A;  3OL3 A;  3HL2 A;  1P6R A;  2K9S A;  2PMH A;  3K4K A;  2VJJ A;  2EIN H;  4IPA A;  3G1L A;  1UZC A;  2OQR A;  3GME A;  3TP0 A;  4L9N A;  5D6F A;  1NK2 P;  5L3G A;  2OU2 A;  4BHC A;  5F6F A;  2WWY A;  1GVJ A;  1DPU A;  1XGS A;  4NNJ A;  2V7F A;  1N25 A;  2QKL B;  2XGX A;  1BIA A;  2AXL A;  2FBI A;  4KN4 X;  2JT1 A;  2WV0 A;  4A5N A;  3WTV C;  4C2T A;  3D5S C;  5ILU A;  5LD2 C;  1UG2 A;  4ZTF A;  1BI0 A;  2FEZ A;  3FHN A;  1YI2 I;  1K6O A;  1RRJ A;  2DA3 A;  4S0H B;  2ECB A;  3MFK A;  2X98 A;  4PJL A;  3SQN A;  1T2K A;  3ZPL A;  4IHX A;  5D4S A;  3GTQ J;  4G7H F;  4R1H A;  1T39 A;  1T38 A;  1E3P A;  2GXA A;  2H94 A;  1FBS A;  1BJA A;  3QOD A;  3HIF A;  4LIV A;  5B66 C;  5GP9 A;  2MVT A;  1GV5 A;  2CO5 A;  1BI1 A;  3GLL A;  4FX0 A;  2HS5 A;  1WQ2 A;  5IYD J;  3K4B A;  3KP4 A;  1IXS B;  2CQN A;  2K7L A;  2XPV A;  1BJZ A;  4N4N B;  5M5X J;  2E19 A;  1IGN A;  4HEA 2;  4IRH A;  2M45 A;  1IUY A;  1ETO A;  1G3T A;  2QSF X;  2X1E A;  3HUG A;  4W97 A;  3RJP A;  2OC6 A;  1S7E A;  1WJB A;  4KYW A;  1FSE A;  2GBY A;  1F4K A;  4CCN A;  4MTD A;  5DV5 A;  2A61 A;  2PEX A;  4BE2 A;  1GDT A;  2FD5 A;  3Q3S A;  4OIR F;  1T0F A;  1R23 A;  1U6G A;  3DV8 A;  5H20 A;  3WG7 H;  1VND A;  4O3M A;  1B9M A;  4P9U A;  1MKM A;  1N78 A;  2V4J C;  4BBS J;  4M3F A;  1HQC A;  1XMA A;  3TP3 A;  2DO7 A;  2PQ8 A;  4C3I J;  3OMY A;  1H9T A;  4L0Y B;  1RNL A;  2FBK A;  4D1Q A;  2UXX A;  5JHF A;  3MCZ A;  1BW5 A;  2ZJ2 A;  3BG6 A;  1FX7 A;  5CVU A;  2D45 A;  4CXF A;  3HUG B;  2LC2 A;  1W7P A;  1UHS A;  2NYX A;  2R5Y B;  2DQR A;  2EQR A;  4OU0 A;  1MJ9 A;  2MZ4 A;  4M6Y A;  2F5E A;  4UUT A;  3CCY A;  1MH4 A;  3S2H J;  4ZZL A;  3ONQ A;  2JA5 J;  2N8G A;  2X48 A;  2XKO A;  2R7T A;  4LD5 A;  2R7O A;  2M2E A;  3K70 D;  3OYE A;  5JI6 A;  1LFU P;  2QWW A;  4F52 A;  3OWT A;  4X6A J;  5KAI C;  2Z2S B;  3OYL A;  2LSO A;  2ZXJ A;  4IF4 A;  4BEH A;  1WJA A;  3ASN H;  3S32 A;  3TGN A;  1YJW I;  4C2U A;  1SMY F;  2EIL H;  1TNT A;  3BG3 A;  1VF9 A;  3JRE A;  1Z91 A;  4M9S A;  4XSX F;  5J3L A;  3HOV J;  2M3A A;  3WGH A;  5FLM J;  5M5W J;  1P7I A;  3CLQ A;  1G3W A;  2G0E A;  3FBI B;  3RDI A;  2FOW A;  4C30 A;  5ICG A;  1ETW A;  2QQA A;  2V26 A;  2QLZ A;  4EJT A;  4HAM A;  1J5Y A;  2LDU A;  4BU2 A;  2VOO A;  2P8T A;  5JR3 A;  1TBX A;  3A01 A;  1RR8 C;  1YRN A;  3K69 A;  5F27 A;  5AIQ A;  1FMV A;  4M74 A;  3NEU A;  2QKM B;  2B0L A;  3GBG A;  4Y3O A;  4BHB A;  3ROU A;  3V7R A;  4UVC A;  4N0B A;  3ERM A;  1MIJ A;  1UFM A;  2FF4 A;  2W84 A;  3DBH B;  4UB6 C;  3HEF A;  1SFU A;  5E20 A;  1TQM A;  3LMM A;  1IRX A;  3FXU A;  4XRM A;  1Z3Y A;  2XAU A;  4FIS A;  2VBX A;  3BR3 A;  3JRI A;  3B02 A;  3BY6 A;  4EM1 A;  2A3S A;  2LLK A;  3JRG A;  1Z05 A;  2QVO A;  2HVR A;  4EJO A;  3LAP A;  3QWL A;  4A3M J;  4GXO A;  2R7R A;  4DOZ A;  4A0Z A;  4CCM A;  1FYK A;  2EH3 A;  1WFX A;  1G4D A;  2VJ5 A;  5IT9 R;  5DTD A;  5EZG A;  3C2G A;  2DFF A;  2LH9 A;  2A6T A;  5FFZ A;  3A01 B;  2COB A;  2LF8 A;  1O3Q A;  5F1R A;  3ZMZ A;  1UAA A;  1U5T A;  2CQX A;  3J7A Y;  3U1K A;  4FCY A;  2E36 A;  5FKL A;  1QBJ A;  4XLH A;  2Y30 A;  4XRF A;  4LFU A;  1VQ4 I;  1YO5 C;  4JX5 A;  2FBH A;  3QYF A;  3SFZ A;  1V54 H;  1OCC H;  4KT5 C;  2OCE A;  5FGM A;  4P5O A;  2VUM J;  1OFC X;  2LKS A;  4AIK A;  5LEJ A;  3AG2 H;  3LSJ A;  4IRG A;  3H35 A;  4ON0 A;  1UEL B;  3W2W A;  5IY5 H;  1SFO J;  1PVE A;  1FPQ A;  5LRR A;  2QQB A;  4BXF A;  2Y31 A;  3IKV A;  2GIZ A;  2EZI A;  3DCF A;  2O8K A;  3EET A;  1POG A;  3EYI A;  2F4I A;  3PQJ A;  4CZZ A;  1QZE A;  3DKY A;  1GT0 C;  1XMK A;  1YW8 A;  4PFP A;  5F0F A;  2KFD A;  3GVA A;  3L09 A;  5FLX R;  2HDW A;  1E17 A;  1MJB A;  3A2K A;  3UNG C;  5K5Q A;  2CGP A;  3C1D A;  2H1K A;  1S3J A;  2EBI A;  3ML6 A;  1LVK A;  4RAY A;  5JLX A;  2EB7 A;  3CLO A;  1ZYR F;  1MGT A;  3IUO A;  3PFI A;  2NNN A;  1KZH A;  2KIU A;  4LK1 F;  2JRT A;  2RVC A;  1FY7 A;  4M3G A;  3LSG A;  2BW3 B;  1KGS A;  1GV2 A;  2Q1Z B;  4N4O B;  5LFA A;  4I09 A;  4FX4 A;  2RQQ A;  1Z6T A;  1Z21 A;  1TQI A;  3CJQ B;  4U0V A;  2K9Q A;  3F6V A;  4M3D A;  3TOA A;  1LEB A;  3CDI A;  3CUO A;  3VYS B;  3E6B A;  4PDK A;  4D7N A;  2FJ1 A;  2P4W A;  5BPD A;  2DXI A;  1B6A A;  2CSO A;  3MZ8 A;  5FLV A;  1AA7 A;  2ZO4 A;  1Q1H A;  3ZR8 X;  5J4V A;  3TW7 A;  4RGS A;  1VQP I;  3U1D A;  4UVA A;  5D8L B;  2RV8 A;  2DA4 A;  2XF5 A;  2DA6 A;  4E6K G;  4ZDO A;  2QEX I; 
#chains in the Genus database with same CATH homology
 3EQL F;  4XLP F;  4M73 A;  2EWN A;  5CVI A;  3V8K A;  4A6D A;  4A2U A;  5LHH A;  3GXO A;  3L00 A;  2IVM A;  3R61 A;  1KU9 A;  4HX7 A;  4LJZ F;  4P9F A;  3CO7 C;  3BRO A;  2IA1 A;  2P6T A;  4HLY A;  2VOD A;  3KE2 A;  3QU3 A;  3WE2 A;  4H0E A;  2L01 A;  3WTY C;  2EFN A;  1L0O C;  3E3V A;  3JW4 A;  3RKX A;  3U9G A;  3CTA A;  3KZZ A;  4ZYG A;  3ZQ7 A;  3ZMT A;  3R0A A;  4KDP A;  2GXG A;  4KIB A;  4EJW A;  1R1U A;  2W85 A;  3SZT A;  4RB1 A;  3QP6 A;  4M6X A;  2V1U A;  2HDC A;  4KIG A;  5E1Z B;  2W25 A;  5L3B A;  1KQ0 A;  4UUV A;  3LQR A;  3RI4 A;  1LNW A;  2PBI A;  2Y48 A;  3GO5 A;  2TDX A;  2QZ8 A;  2HWV A;  3OV8 A;  3T5X A;  1XGO A;  1J2X A;  3GFI A;  3LWF A;  4LG0 A;  5ICE A;  2YPR A;  3F21 A;  3IKT A;  3E5X A;  2Z99 A;  5E8G A;  1ZRC A;  5IT9 Z;  1ZHF A;  4NHJ A;  2D2W A;  4Y13 A;  3HTS B;  2H6C A;  4LK0 F;  1EH7 A;  5LBQ A;  3BOQ A;  2ESH A;  3WG9 A;  4HW0 A;  4LG0 B;  5D5W B;  4GYI A;  5DDG A;  3IRR A;  2EFW A;  3BPX A;  4G7Z F;  3ZP5 A;  3V8L A;  3ZMV A;  3HHG A;  4ENM A;  3ZN0 A;  1YFH A;  1ZG3 A;  4HQM A;  2EV5 A;  4U0Y A;  4QWQ A;  1ZH5 A;  2FA5 A;  3I5U A;  1S7O A;  4KNY A;  1D5V A;  1BC8 C;  1YIO A;  5HS8 A;  4JBA A;  2M30 A;  2A68 F;  2FQ3 A;  1ZRD A;  1LEA A;  5HLG A;  2OAZ A;  4MGR A;  4RGU A;  3DPT A;  4U7D A;  3KCC A;  3V7C A;  2P6S A;  4IHS A;  1QZY A;  4CO8 A;  1SD5 A;  3L2C A;  4RB3 C;  1HW1 A;  3M9A A;  4N9H A;  1EV7 A;  3I54 A;  3J81 Z;  1TW3 A;  1C0W A;  3TO7 A;  5K5O A;  1ZG1 A;  1SFX A;  2Z33 A;  2FMY A;  5D5X B;  4B09 A;  2ZNY A;  1FLI A;  2HKO A;  4DNC A;  5FLX K;  3K9T A;  1ZAO A;  3S2W A;  4EMS A;  2Q2E A;  2VC0 A;  4GCV A;  3V7S A;  1R58 A;  4BXU A;  1LQ1 A;  2X0L A;  2F5F A;  4Q4Z F;  2F5D A;  2CG4 A;  1OYY A;  2L02 A;  3ECH A;  3E97 A;  1FSH A;  5FO5 A;  2XIG A;  3BJO A;  1SD6 A;  4ENN A;  3J81 K;  2NAZ A;  3GFM A;  1JHF A;  3IRQ A;  1KU3 A;  2H09 A;  1YTY A;  1LDD A;  4YII A;  3WTZ A;  4KUM A;  3KEO A;  3V4G A;  2PLY A;  1EH6 A;  2FU4 A;  2CQK A;  3R4K A;  3FX3 A;  2DT5 A;  4RAZ A;  3ZMU A;  2E1C A;  1ZLK A;  1CF7 A;  4WCG A;  3F23 A;  5BPI A;  3F8B A;  4IVN A;  3VB2 A;  2KIM A;  1U8R A;  1DUX C;  5AIP A;  3FXR A;  1A04 A;  2KIF A;  3RYP A;  4ZYE A;  3LA2 A;  2K02 A;  5L3C A;  2FNP A;  3ABT A;  2G7H A;  2O8X A;  2V6C A;  1CF7 B;  2VN2 A;  1E2X A;  2FRH A;  5K5R A;  4LLN A;  2VT2 A;  3R6S A;  3QRF F;  3HYI A;  3REO A;  1BIB A;  4ENK A;  2DTR A;  1Y0U A;  2DPU A;  1BM9 A;  1YLF A;  3TDU C;  3CDH A;  3GYH X;  4YFK F;  4YFN F;  2KRF A;  4I02 A;  1HST A;  1HBX G;  2Q8K A;  3BJA A;  4MQ9 F;  1J59 A;  4WXD A;  4Q47 A;  3SXY A;  1D8K A;  2PMU A;  6PAX A;  2A69 F;  3ECO A;  3HRS A;  4EGY A;  2STW A;  5JHU A;  2HEO A;  4XBF A;  3M8E A;  4O5V A;  2EA4 A;  3I4P A;  1R5H A;  3M1E A;  1MJA A;  2RC4 A;  2XVC A;  3BP8 A;  3O2P E;  5BQT A;  3FF5 A;  3KET A;  4K2E A;  4MHG A;  1K7A A;  3IL2 A;  4I7H A;  4ZYH A;  4Q5S F;  2PI0 A;  4BH9 A;  3O3K A;  1KYW A;  1KU2 A;  5EEG A;  3B73 A;  1GXP A;  3C7J A;  4O6J A;  2VXZ A;  2G7U A;  2ZKZ A;  1G3Y A;  1RUN A;  4IRI A;  1H0M A;  4MQV A;  2HKX A;  4L18 B;  3FXQ A;  2XUB A;  3IHU A;  1XSD A;  4WXC A;  1K78 B;  4RGR A;  3DXJ F;  2J5O A;  1UB9 A;  1XB4 A;  1H9G A;  4DQ2 A;  2ISY A;  5E17 F;  3SZP A;  4Y15 A;  1I1S A;  4YIF A;  3T8T A;  2HR3 A;  3F8C A;  1HKT A;  1ODD A;  3F8N A;  5FB2 A;  1F1Z A;  1MZB A;  1Z1D A;  2HFH A;  4G9Y A;  1HKQ A;  1J9I A;  2BYV E;  3H3U A;  2MBF A;  4G94 A;  2ZCW A;  3NQO A;  2YR2 A;  3HRT A;  1REP C;  1V4R A;  3I0T A;  4MNU A;  3GWZ A;  1YW9 A;  2FML A;  2P7C B;  4F7Z A;  1OKR A;  2DW4 A;  1O7L A;  2BGC A;  5H6R A;  3HRM A;  3WOD F;  2VBZ A;  3MQ0 A;  3I59 B;  1B4A A;  1ONV A;  5HDK A;  4NB5 A;  3ELK A;  2E7X A;  3HSR A;  3WTT C;  4M71 A;  3U2R A;  1FBQ A;  4L0Z B;  4A12 A;  3TQN A;  2ADU A;  5ICF A;  1XSV A;  2XHK A;  5DCF A;  2RQP A;  4AVP A;  4HF0 A;  2ACJ A;  3F8F A;  2DQL A;  2MC3 A;  2L4M A;  2E1N A;  1JHH A;  1QQI A;  1U2W A;  1L3L A;  2JSC A;  1TNS A;  1TW2 A;  1R7J A;  3VFZ A;  2EFO A;  4WWC A;  1MD0 A;  2Z3Y A;  1LDK B;  4KA4 A;  3JSO A;  3P9K A;  4GGG A;  2XKP A;  1LVA A;  4Q48 A;  5HLH A;  1X3U A;  4MTE A;  3KLO A;  2RKH A;  5DUK A;  2K4B A;  3JAM Z;  4BQA A;  3RKY A;  3JSP A;  2OD5 A;  3MZY A;  1XGM A;  2YX7 A;  1OYI A;  3EYY A;  4MEX F;  5AON A;  1IXR C;  4I0A A;  3Q9V A;  1TQP A;  2LKP A;  1PP8 F;  3IC7 A;  3CJN A;  4L9T A;  3GX4 X;  3HRU A;  4PCQ A;  2IJL A;  4WF2 A;  3TKY A;  1IF1 A;  4KMF A;  5HS7 A;  2XAF A;  1FBU A;  1J0R A;  1ZRF A;  4OMZ A;  4ESF A;  3DF8 A;  3EDP A;  1B9N A;  4ETS A;  3BZ6 A;  2HQN A;  1Z7U A;  2IW5 A;  2XAJ A;  1YS7 A;  2QUF A;  3ABU A;  3EUH A;  3HSF A;  2JZY A;  4RB2 C;  1WWX A;  4BAY A;  3FM3 A;  1I6X A;  3KP2 A;  2ISZ A;  3JAM K;  4CHU A;  1P92 A;  5LGU A;  4RS8 A;  3W6J B;  3DP7 A;  2QBY B;  3T8R A;  1O3T A;  2HTJ A;  4G6D A;  1ON1 A;  4U88 A;  3TO6 A;  1FP2 A;  5LHI A;  3HOT A;  1U3E M;  2YX4 A;  2GZW A;  3L9F A;  1FYL A;  3IWF A;  2HGC A;  3VOE A;  3HTU A;  3BWG A;  4A0X A;  3G3Z A;  4EQQ A;  1ZLJ A;  2GA2 A;  2H27 A;  4XSZ F;  1O3R A;  5CYV A;  1WKM A;  5L3D A;  5E8I A;  3LA7 A;  1O57 A;  2Z5U A;  4MEY F;  5E1X A;  2QM3 A;  3LAJ A;  3GFJ A;  1FWZ A;  4G6Q A;  5CLS A;  2K27 A;  2A07 F;  2MA3 A;  4AIH A;  4HQE A;  3W6K B;  4G7O F;  1BBY A;  1I5Z A;  1IW7 F;  4B8X A;  3F22 A;  4ESJ A;  5HVQ C;  2EV0 A;  2RNJ A;  5KK1 A;  2CW0 F;  2FE3 A;  3R60 A;  2DLL A;  4FHT A;  1LB2 A;  4EGZ A;  2HYF A;  1G3S A;  1HW5 A;  3WGI A;  2BE5 F;  1AWC A;  4L5I A;  4PGH A;  5IT9 K;  4IJA A;  2OZU A;  2OQG A;  3WE3 A;  2ZME B;  4U7B A;  5J6X A;  4ASN A;  2O03 A;  2KKO A;  3I71 A;  4HDV A;  4WXH A;  1ZN2 A;  3FZV A;  2CWE A;  2XRN A;  3K1P A;  5DEQ A;  5D5V B;  5ILV A;  3P7N A;  1QNT A;  2QYO A;  2NRA C;  3ULQ B;  1XGN A;  2XRO A;  1UHM A;  3D5L A;  3I58 A;  5DD4 A;  1XDS A;  3WTS C;  4UNO A;  4UXN A;  1SFE A;  4NQW A;  3KEQ A;  4R8H A;  5D4R A;  4UHT A;  3P9I A;  5D8K B;  1IRF A;  2K4J A;  4P96 A;  2DPD A;  2UZK A;  2MLK A;  5CVJ A;  4I0B A;  4N9I A;  3DQV C;  3TO9 A;  3BPV A;  1T6S A;  2GWR A;  1SD7 A;  2STT A;  4HX4 A;  4OIQ F;  2O61 A;  3K1N A;  2JPC A;  3I64 A;  5HDN A;  1TTY A;  5IT3 A;  2YSR A;  1UST A;  3DEU A;  1V3F A;  2NNY A;  2ESN A;  4EM0 B;  3OOP A;  3E6D A;  4M72 A;  2F5C A;  2HZT A;  3LA3 A;  5KVR A;  3KP3 A;  1S7A A;  1J7K A;  2O3F A;  5D6E A;  2F2E A;  2FOK A;  2KJB A;  2YU3 A;  1QO0 D;  1R1T A;  2KJC A;  5DYM A;  5FD5 A;  4UVB A;  5EEH A;  1MDM B;  5CVR A;  3TOB A;  3KP7 A;  2H6B A;  4HDU A;  3GLX A;  3WTX C;  4WX9 A;  1W5S A;  4OOI A;  1DP7 P;  2UWM A;  1YG2 A;  2D1H A;  2E7W A;  4RGX A;  2W57 A;  3KFW X;  4L5J A;  3V8J A;  1USS A;  4KFC A;  2RGV A;  2EA2 A;  2M87 A;  3FM5 A;  1FZP B;  2W24 A;  2XAG A;  3GZ5 A;  1BI2 A;  3LST A;  5J8C A;  3D0S A;  4S05 A;  1FNN A;  1W5T A;  1ON2 A;  1XCV A;  3GW2 A;  3SHF A;  1XN7 A;  1ULY A;  1P2F A;  4HBL A;  2VBW A;  2A6E F;  5LGT A;  3MZH A;  5J8F A;  4HA8 A;  5DUI A;  1J75 A;  4XLN F;  5HS9 A;  3COA C;  1D3Y A;  2IPQ X;  3KLN A;  4EM2 A;  1WSU A;  4CYD A;  1SD4 A;  5H6Q A;  2CFX A;  1IN5 A;  4EVI A;  2EFP A;  3TDZ C;  2ZNZ A;  2QEN A;  2Y75 A;  3VEP A;  1HKS A;  3FMS A;  2LF7 A;  2V79 A;  2RDP A;  5ED4 A;  3QOP A;  4KIF A;  1K78 A;  2RN7 A;  1UCR A;  4D0P A;  3L7W A;  2DU9 A;  2DAO A;  5CJ9 A;  3K0L A;  2NS0 A;  2P7V B;  2L4A A;  2O0Y A;  1G6N A;  3Q9S A;  5LRS A;  2MH2 A;  2GQQ A;  4OMY A;  3ZN1 A;  2GAU A;  1YYV A;  2DFI A;  2XAH A;  5BMZ A;  1JE8 A;  2IA2 A;  3RKW A;  1P4A A;  1EH8 A;  2P5V A;  3CUQ C;  3P9C A;  1OMI A;  2M8E A;  4KN7 X;  1RIO H;  5BOX A;  1BC7 C;  2WC2 A;  3FMR A;  1SAX A;  1W7P B;  1I27 A;  2GA1 A;  2VE8 A;  5BS6 A;  2PN6 A;  4YFX F;  2VON A;  1FOK A;  1Z6R A;  5HDG A;  1IAW A;  2PG4 A;  2LNB A;  2JTV A;  1JGS A;  3I59 A;  2EFQ A;  4GO1 A;  4HZF A;  2M1B A;  1YS6 A;  1JXS A;  3WTU C;  1KYZ A;  1KU7 A;  3T1B A;  3IWZ A;  2PJP A;  4I2O A;  3J80 Z;  4LLL A;  3FWE A;  1OR7 A;  5LGN A;  4BNC A;  3Q5F A;  3ZMD A;  5LHG A;  1FC3 A;  3E6M A;  2R3S A;  4JK1 X;  4LGW A;  3E5U A;  4HOB A;  2OZ6 A;  4S04 A;  3GF2 A;  3RIR A;  3H3Z A;  1YQA A;  3J7A O;  1BN5 A;  1KQ9 A;  3ZMS A;  5ERI A;  1IZ1 A;  1U78 A;  3WU0 A;  5TRD A;  3H92 A;  4OIN F;  4GYG A;  3LFK A;  1OYW A;  5HOO A;  4ZYD A;  1U5T B;  3QP5 A;  1CGP A;  4CDG A;  2EV6 A;  1FP1 D;  3RPU A;  3J80 K;  3GEZ A;  3LQQ A;  2FXA A;  1KA8 A;  2A6H F;  2WTE A;  2HQR A;  2O6G E;  5DD8 A;  1HW2 A;  3N97 A;  1QPM A;  2V9V A;  2EJR A;  2VBY A;  3GUD A;  2HYG D;  2IT0 A;  5E1W A;  4U0W A;  3NRV A;  2FNA A;  4QLC U;  4UV8 A;  5E18 F;  1B59 A;  4OIO F;  4AWX B;  4YG2 F;  2GIV A;  2K86 A;  1R5G A;  2JPB A;  4ESB A;  2VOP A;  1STZ A;  5A2Q Z;  2Z9O A;  1WI9 A;  4P55 A;  5FFX A;  4BHP A;  1ZAR A;  1BOA A;  1HXD A;  2MLG A;  3JTG A;  3VOD A;  4RB0 A;  1R22 A;  1NHA A;  2VC1 A;  2BV6 A;  1VTN C;  3KZY A;  3HSE A;  2M5W A;  2QBY A;  4I98 B;  4LB5 A;  1QZZ A;  5L3E A;  3ERE D;  1KQ8 A;  3MEX A;  5ILS A;  1IN4 A;  3GFL A;  1W7P D;  4A6E A;  3WTW C;  5CVV A;  4Y17 A;  4M9Z A;  4IXA A;  4KMU X;  1PDN C;  4EJU A;  1BI3 A;  2COM A;  2DBB A;  4LLG F;  1Z9C A;  3T0Y A;  2DK8 A;  2GXB A;  3MWM A;  3F6O A;  3FMQ A;  2PFB A;  4HF1 A;  4IHT A;  2ZFW A;  3ISP A;  3C3W A;  5A2Q K;  4L9J A;  3F3X A;  4M9X A;  3KP6 A;  1XD7 A;  2FSW A;  1ZRE A;  4JQF A;  1O7F A;  3WGG A;  4ENJ A;  4KIC A;  4A0Y A;  1S8N A;  4I01 A;  1S29 A;  4EJV A;  5L3F A;  1AOY A;  1RUO A;  3RTR A;  5ICC A;  3JTH A;  1W4M A;  3PQK A;  3DPL C;  3G73 A;  2XV4 S;  2OA4 A;  1FYM A;  3N4M A;  4A5M A;  2HOE A;  1PP7 U;  1DDN A;  2DK5 A;  1WRJ A;  1U5T C;  2BEO A;  3CO6 C;  2ZME A;  1R36 A;  1RI7 A;  5LLQ A;  3QPT A;  1S6L A;  3HHH A;  2Q0O A;  4EV0 A;  4HX8 A;  4HLX A;  4Z2Y A;  2P5L C;  5LEK A;  2DI3 A;  2EK5 A;  1XCB A;  3K2Z A;  2VT3 A;  5K1Y A;  3E5Q A;  1OPC A;  3QAH A;  2XAS A;  3E6C C;  4AIJ A;  4AD9 A;  1IN8 A;  2OBP A;  3R0J A;  1D8J A;  1QGP A;  3RPQ A;  5HLI A;  1SMT A;  2R7F A;  5FLX Z;  1I1G A;  2VE9 A;  1R00 A;  2AS5 F;  2V1X A;  3AAF A;  2ETH A;  5DCM A;  1K79 A;  1P4W A;  3I53 A;  3WU1 B;  1T98 A;  4WK8 F;  1LDJ A;  4BYY A;  2J5P A;  3QPH A;  1LJ9 A;  3M7G A;  4LMY A;  4E70 A;  1O3S A;  4FT8 A;  3DFG A;  1DPR A;  3QU6 A;  3C18 A;  3F72 A;  3FHZ A;  2IP2 A;  3DKW A;  1ZGA A;  5F64 A;  1GXQ A;  5DCM B;  1FT9 A;  2QQ9 A;  4ZZD A;  2Y0M A;  4HV6 A;  1B1B A;  4TV7 A;  2HTS A;  4OIP F;  1UHW A;  1HSJ A;  2R7D A;  3CUQ A;  2UXN A;  2IRF G;  5FD6 A;  3K1M A;  1ZG5 A;  1IN7 A;  5TJJ A;  4R79 A;  1MDM A;  4HV5 A;  3HOS A;  4HF2 A;  3BJ6 A;  4PGG A;  4CGZ A;  5JFR A;  3GZ6 A;  4L9V A;  1YW7 A;  2XAQ A;  3M8F A;  5D5U B;  2ZBK A;  2MH9 A;  2L54 A;  3F8M A;  1F9N A;  4HYE A;  2G9W A;  4PZJ A;  3CUQ B;  1P4X A;  1GHC A;  3MAJ A;  2X4H A;  1ZGJ A;  1XDU A;  2P5K A;  2C6Y A;  1IXC A;  2MD5 A;  1F5T A;  1IN6 A;  2V1D A;  1TLH B;  3RYR A;  4CIC A;  4UV9 A;  2IA0 A;  5JVT A;  2CYY A;  1IRG A;  1RZ4 A;  1PUE E;  3O6B B;  3KP5 A;  4LB6 B;  2ELH A;  2L3D A;  2BBY A;  1R1V A;  3BDD A;  2D1V A;  2A5Y B;  4G8X A;  4ZH4 F;  1XSX A;  1P6R A;  2PMH A;  4IPA A;  2OQR A;  4L9N A;  5D6F A;  5L3G A;  2OU2 A;  4BHC A;  5F6F A;  2WWY A;  1GVJ A;  1DPU A;  1XGS A;  4KN4 X;  2XGX A;  1BIA A;  2AXL A;  2FBI A;  2JT1 A;  2WV0 A;  4A5N A;  3WTV C;  5ILU A;  1BI0 A;  2FEZ A;  1K6O A;  3MFK A;  3SQN A;  1T2K A;  3ZPL A;  5D4S A;  4G7H F;  4R1H A;  1T39 A;  1T38 A;  2H94 A;  1FBS A;  1BJA A;  3HIF A;  2CO5 A;  1BI1 A;  4FX0 A;  2HS5 A;  1WQ2 A;  3KP4 A;  1IXS B;  2K7L A;  4IRH A;  2M45 A;  1IUY A;  1G3T A;  3HUG A;  3RJP A;  4KYW A;  1FSE A;  1F4K A;  4MTD A;  5DV5 A;  2A61 A;  2PEX A;  4OIR F;  1T0F A;  1R23 A;  1U6G A;  3DV8 A;  5H20 A;  4O3M A;  1B9M A;  4P9U A;  1MKM A;  1HQC A;  1XMA A;  2DO7 A;  2PQ8 A;  1H9T A;  4L0Y B;  1RNL A;  2FBK A;  2UXX A;  3MCZ A;  2ZJ2 A;  1FX7 A;  5CVU A;  2D45 A;  4CXF A;  1W7P A;  2NYX A;  2DQR A;  4OU0 A;  1MJ9 A;  4M6Y A;  2F5E A;  4ZZL A;  2XKO A;  4LD5 A;  5JI6 A;  2QWW A;  2LSO A;  2ZXJ A;  4IF4 A;  3TGN A;  1SMY F;  1TNT A;  1Z91 A;  4M9S A;  4XSX F;  3WGH A;  1G3W A;  3RDI A;  5ICG A;  2QQA A;  2QLZ A;  4EJT A;  4HAM A;  1J5Y A;  2LDU A;  2VOO A;  2P8T A;  5JR3 A;  1TBX A;  3K69 A;  5AIQ A;  4M74 A;  3NEU A;  2B0L A;  4BHB A;  3ROU A;  3V7R A;  4UVC A;  4N0B A;  1UFM A;  2FF4 A;  2W84 A;  1SFU A;  5E20 A;  1TQM A;  3FXU A;  2VBX A;  3B02 A;  3BY6 A;  4EM1 A;  2A3S A;  1Z05 A;  2QVO A;  4EJO A;  3LAP A;  4GXO A;  4A0Z A;  1FYK A;  1G4D A;  5FFZ A;  2LF8 A;  1O3Q A;  5F1R A;  3ZMZ A;  1U5T A;  1QBJ A;  4XRF A;  4LFU A;  1YO5 C;  2FBH A;  3SFZ A;  4KT5 C;  5FGM A;  4P5O A;  4AIK A;  5LEJ A;  4IRG A;  4ON0 A;  1FPQ A;  5LRR A;  2QQB A;  3IKV A;  3EET A;  3EYI A;  3PQJ A;  4CZZ A;  1XMK A;  1YW8 A;  3GVA A;  3L09 A;  1E17 A;  1MJB A;  5K5Q A;  2CGP A;  3C1D A;  1S3J A;  3ML6 A;  4RAY A;  2EB7 A;  3CLO A;  1ZYR F;  1MGT A;  3PFI A;  2NNN A;  2KIU A;  4LK1 F;  2JRT A;  2RVC A;  1FY7 A;  4FX4 A;  1KGS A;  4I09 A;  1Z6T A;  1TQI A;  4U0V A;  3F6V A;  3TOA A;  1LEB A;  3CUO A;  3E6B A;  4PDK A;  2P4W A;  5BPD A;  1B6A A;  2CSO A;  2ZO4 A;  1Q1H A;  4RGS A;  3U1D A;  4UVA A;  5D8L B;  2RV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...