2F5EA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ab conformation, ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
135
structure length
131
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 52
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5eA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5eA02
3ROUA 4IJAA 3R0JA 1KQ0A 4PGHA 3G3ZA 5LEJA 4QWQA 2O61A 1ZH5A 1IUYA 1XGOA 4Q5SF 4MEXF 1O7LA 3CUOA 2HQNA 3FZVA 4IHTA 2EWNA 1RNLA 3IHUA 3I0TA 3HRUA 2NRAC 4L9VA 1FSHA 3TDUC 2FMLA 5H20A 3QAHA 2QZ8A 2V79A 3J80Z 1HKTA 2Z99A 1HW1A 2M87A 1YQAA 4HX7A 1I6XA 5DEQA 3RPUA 5FFZA 4O6JA 2XGXA 2XAQA 2HKXA 4ESBA 1USTA 1FNNA 4CHUA 4WK8F 1Z6TA 2WTEA 1SD6A 4GO1A 2VC0A 5LHIA 2EA2A 2HOEA 1LDJA 1I1GA 1ZN2A 1JXSA 4L5IA 1G4DA 1G3TA 2IJLA 1U8RA 4LB5A 3K1MA 3WE2A 3VEPA 1D8KA 4FT8A 4G6QA 1ZG5A 1E17A 1IN6A 2DK8A 1RZ4A 5TRDA 2COMA 3LAJA 2JSCA 5FLXZ 1YO5C 2LF7A 5CVIA 3JAMK 3W6JB 3GFIA 4RB3C 3KP5A 3I5UA 2M5WA 2VE9A 2KRFA 4NB5A 2L3DA 1Z05A 3WU1B 2M8EA 1ULYA 2JRTA 1J5YA 1HSTA 3N97A 4I01A 2ISYA 1QZZA 3JW4A 3FHZA 4OIOF 3U2RA 1PDNC 3RI4A 4ENKA 1HBXG 4N9IA 2JPBA 5LEKA 4ETSA 5J8CA 3E6CC 2OZUA 1IAWA 3ABUA 1EH7A 1TQPA 2VE8A 3SZTA 3QOPA 5DDGA 3RJPA 1W5SA 4XRFA 4HQMA 4MQ9F 4EJUA 1IW7F 5D8KB 3H92A 3D0SA 4BH9A 3O2PE 3F3XA 4NHJA 1BIAA 1RUNA 4G8XA 1U78A 3WTZA 2DI3A 1FPQA 1UCRA 2H6BA 1GXPA 5ERIA 5DCFA 1MDMB 1K78B 4L9NA 1FT9A 1SMYF 1TNTA 3ULQB 1UHMA 4AVPA 2A68F 1HKSA 2STWA 3C1DA 4LK0F 3DP7A 1LJ9A 5CYVA 4EJWA 2C6YA 1QGPA 1YG2A 4LFUA 2CGPA 1RIOH 1H0MA 1MDMA 2IA0A 1K78A 2FOKA 1YLFA 2RVCA 5E1XA 2MLGA 4L18B 5LLQA 2K02A 2NNNA 2Y75A 2IVMA 3FXRA 2EB7A 1T2KA 5DYMA 2P4WA 4ENMA 2OU2A 4Q48A 1KGSA 4A5MA 4EM0B 1FP1D 3GYHX 4OINF 2EFPA 4RGSA 3W6KB 3EYYA 1EV7A 3H3ZA 1O57A 5F64A 2ACJA 1P4WA 2QM3A 1ZGJA 5AIPA 1B1BA 4KIFA 2P5LC 2IRFG 1ZYRF 1MZBA 3BPXA 2R7DA 2XUBA 3FMQA 5L3EA 1I5ZA 3VOEA 1ZREA 2B0LA 4CO8A 3TO6A 5D6FA 3HIFA 1UB9A 5LHHA 4LG0B 2F5DA 2LNBA 2HTJA 2RQPA 2KIUA 1F9NA 2Q8KA 3GF2A 1S3JA 4ZYGA 5HDNA 2ESNA 1LVAA 4UVAA 2FA5A 4KNYA 4HA8A 2GQQA 5HLHA 1HW2A 5D8LB 4UNOA 3ZMTA 2MH2A 3ML6A 3KFWX 2QBYB 3C3WA 3B02A 1BI1A 4AIKA 2EFQA 1CF7B 4ZZLA 4AIHA 2RC4A 3KP4A 5HDKA 5JVTA 1V3FA 2LSOA 2FXAA 5BS6A 3GFMA 3LSTA 3PQKA 1G3SA 2OZ6A 2CFXA 4KDPA 2BGCA 2X4HA 2IW5A 3E6BA 5LRRA 3PQJA 4KMUX 5BMZA 1YW9A 1SD5A 5HDGA 1YIOA 2HZTA 3TGNA 1P4AA 2QQ9A 3GWZA 4GYGA 2Z3YA 3FXUA 4B09A 5DUKA 4KIBA 1JHHA 1PP7U 1FZPB 2IA2A 2QYOA 4UUVA 4ZYDA 4HLYA 3GFJA 1IRFA 1FLIA 4XLNF 5H6RA 3AAFA 1TW3A 3E6MA 4ESFA 3BROA 5JFRA 4MTDA 4KMFA 4WXHA 4WX9A 2VBWA 2XKPA 3V7RA 2HTSA 4M6YA 4GCVA 4S04A 2CW0F 1FBUA 4IRIA 1L0OC 1IXRC 1FWZA 4HX4A 3HHHA 3IKVA 4ZZDA 4HDUA 1OYYA 3COAC 3GZ5A 1S8NA 3I59A 1W7PD 5J6XA 6PAXA 1SMTA 1U5TB 1IN8A 2H94A 4PZJA 1SFEA 3KEOA 2RV8A 2VT3A 3B73A 2ZKZA 4HAMA 4UV9A 1JHFA 2M1BA 2MH9A 3BOQA 1D3YA 2KJCA 3KZZA 4A12A 5LBQA 3RKXA 4YFXF 4HF0A 5A2QZ 5ILSA 4RAYA 2TDXA 2P8TA 4HYEA 4LD5A 5HS9A 2FRHA 2XAFA 5D4SA 4HLXA 3RKWA 2RGVA 1WWXA 2HR3A 4P5OA 3M8FA 2Q2EA 2W85A 1OR7A 3L00A 4M9ZA 4BHPA 4HZFA 1S6LA 5L3CA 2PMHA 3DPTA 3L7WA 2XKOA 2DPDA 3REOA 3ZMSA 3CLOA 4MNUA 2L4AA 4M9XA 4TV7A 3V8KA 4OMYA 4Q47A 2PG4A 3WGIA 2NNYA 1OYIA 3HRSA 4A0YA 2RDPA 3KZYA 2ZMEA 1J59A 3K9TA 2ZXJA 3T5XA 2HFHA 4L0YB 4WF2A 1TBXA 2W24A 2XASA 3C7JA 2EA4A 2DO7A 3EETA 1LQ1A 3NQOA 4LG0A 3ZMDA 1OPCA 4EQQA 1XMAA 2FQ3A 4HOBA 3IRQA 2VXZA 3P9CA 4N9HA 1MJAA 2FU4A 1HSJA 2J5OA 3WE3A 4I7HA 3RYRA 1H9GA 3SQNA 1J75A 4IHSA 5HOOA 2W84A 4GYIA 5D4RA 4WCGA 4O3MA 1AOYA 1R1UA 3I53A 1OMIA 2ZNYA 4ZYEA 1TTYA 3F8NA 1WSUA 2O6GE 1QO0D 5E18F 3L9FA 1ZARA 3E3VA 4M72A 1O7FA 4KICA 1SAXA 3VFZA 4F7ZA 1I27A 2LDUA 1JGSA 1BOAA 3EUHA 2V6CA 5L3DA 2CSOA 1TLHB 3EQLF 1S29A 2ZCWA 2D2WA 3TQNA 1DPRA 2GA2A 3JAMZ 4HV5A 3V7CA 2XAJA 4HV6A 1T39A 5ICFA 1XGMA 3BJAA 3HTUA 3O3KA 3ZQ7A 3F6VA 1ZRFA 1FX7A 4A0ZA 4OIPF 3R6SA 1GXQA 1ZRCA 2L01A 1IN4A 2OQRA 3ZPLA 1Q1HA 5E8IA 4HW0A 4BHCA 2A61A 5TJJA 2OQGA 2BE5F 4I0BA 2FNAA 3I54A 1KU2A 4A0XA 2Z5UA 3FMRA 5ICEA 1R5GA 1CF7A 3J7AO 3MAJA 3OOPA 3FXQA 5BQTA 1FYLA 5K1YA 3MFKA 3IKTA 2QENA 5FFXA 2O8XA 3F72A 3KP2A 3E5XA 1Z1DA 1DDNA 1IZ1A 1TQMA 2YX7A 1L3LA 1U2WA 4JK1X 4EJVA 3HTSB 1DUXC 3GO5A 4O5VA 1ODDA 1KU7A 2Y48A 3E6DA 2OA4A 3IWZA 2PN6A 1J9IA 2BBYA 4WXCA 2GA1A 4HDVA 4BQAA 3M9AA 4I98B 1W5TA 4IPAA 3U1DA 5D5WB 4N0BA 2A07F 2QUFA 5CVUA 5FO5A 3R60A 1XD7A 3RDIA 4YFNF 2UXXA 4OIQF 3ECHA 1ZG1A 5CVVA 4XLPF 1K7AA 2F5FA 4LJZF 4MGRA 1B6AA 2XIGA 4OU0A 3FX3A 5HVQC 1K79A 1HXDA 1EH8A 3ZP5A 3JTGA 1GHCA 3T1BA 4HQEA 2RNJA 1DP7P 4YG2F 2PBIA 4FHTA 2L54A 1YS6A 4ESJA 3F8BA 2AS5F 1XB4A 1F5TA 2GIVA 2NYXA 1XGSA 4JQFA 3DEUA 4A6EA 1O3SA 1LEAA 1X3UA 3RKYA 1ZG3A 4P96A 3LA7A 1QPMA 1P4XA 5FD6A 2MC3A 3V7SA 3K1PA 3R0AA 2X0LA 1MD0A 1FYMA 2UWMA 1LDKB 1G6NA 3F6OA 3WTSC 1HQCA 3BJOA 3FM5A 2ZO4A 4MHGA 4I0AA 1PP8F 1QQIA 2IA1A 4BAYA 4E70A 1IN5A 3D5LA 3KP7A 4JBAA 1XCBA 5D5UB 5J8FA 2UXNA 4LGWA 1U6GA 5BOXA 3Q9SA 2QBYA 2PJPA 5E1WA 1R22A 3F8CA 3QP5A 1R23A 5FB2A 1XCVA 4LLGF 4L5JA 2HYGD 5DD4A 4LK1F 3M7GA 1LB2A 2KKOA 3GFLA 4CXFA 2YU3A 1LEBA 2XVCA 2OD5A 3I59B 4P9FA 2FMYA 2E7WA 3IRRA 2KIFA 2PMUA 1SD4A 2M45A 2QVOA 4UHTA 3WTWC 4IF4A 4MTEA 4ENJA 1KU9A 1YW7A 4KT5C 3NEUA 5K5QA 1SFUA 4GGGA 3V4GA 3L09A 1MJ9A 4DNCA 5K5RA 2OAZA 5HS8A 3QP6A 3MEXA 3MZHA 5ICGA 3GLXA 1BC7C 1Z9CA 2P6TA 1FSEA 2UZKA 4WXDA 3LFKA 1YFHA 1BI2A 4P9UA 2Z33A 3SXYA 1B9MA 3FMSA 1W4MA 5F1RA 5FGMA 1FBQA 1G3YA 1NHAA 2O03A 3K0LA 2LF8A 2AXLA 2GAUA 4EMSA 3GVAA 3SZPA 1I1SA 5K5OA 5KVRA 3WODF 5L3FA 2FBIA 3KETA 1T38A 2KJBA 3BY6A 4G9YA 4M73A 2EV0A 1BIBA 4K2EA 3TDZC 2DT5A 1XDSA 2R3SA 1J2XA 4KFCA 3QU6A 3DV8A 4ASNA 2ZFWA 4AD9A 1FY7A 1XN7A 4I2OA 2K4JA 2VBZA 1WKMA 1ZLKA 3G73A 4IRGA 5AIQA 3I58A 3LAPA 2O3FA 1ZGAA 3J81Z 5L3GA 4RAZA 4M71A 4NQWA 1RI7A 4G94A 2CQKA 2YR2A 5BPIA 1R58A 2YX4A 5E8GA 4CZZA 2VT2A 3RYPA 4XBFA 1T98A 2MD5A 3MCZA 3LA2A 5E17F 4EV0A 2DU9A 1BJAA 1DPUA 3IC7A 3QRFF 4QLCU 2EFNA 4U7BA 1XSVA 5JR3A 4GXOA 3ABTA 3E97A 4U88A 1GVJA 4EM1A 4EGYA 5LGNA 5DCMA 3WGHA 1ZHFA 3DQVC 2DAOA 4BXUA 4G6DA 5CVJA 4IRHA 3KP3A 1J0RA 2YPRA 4U0VA 4BHBA 1TNSA 2HS5A 2A3SA 2Y0MA 3CTAA 4RGRA 3ECOA 1MGTA 3NRVA 1IRGA 3WTXC 2ZMEB 3F8MA 2VN2A 4HX8A 1ON1A 2QWWA 3J80K 3MQ0A 3EYIA 5HS7A 5D6EA 2V1UA 1T0FA 2G9WA 2ESHA 1OYWA 2XHKA 4XSZF 2V1DA 5A2QK 4YIIA 2PEXA 3WU0A 1AWCA 3MZYA 4RB2C 4LLLA 1D8JA 3HSRA 5HLGA 5HLIA 4MEYF 4CDGA 3VB2A 3BP8A 1FOKA 3CDHA 3V8LA 2E7XA 3KEQA 3E5UA 4XSXF 4PDKA 2PLYA 5FLXK 1ZRDA 4H0EA 2DBBA 4WWCA 1EH6A 1XGNA 4BYYA 3FF5A 2J5PA 1S7AA 4AWXB 1XMKA 1E2XA 2DLLA 2DK5A 4KN4X 1UHWA 5JHUA 3GX4X 4KYWA 5LGUA 3O6BB 4EGZA 2FBHA 1STZA 4MQVA 2QQBA 4HBLA 3ZN0A 4EVIA 4OOIA 3JSOA 1IXSB 3KCCA 3IWFA 4HF1A 3PFIA 2K86A 4ZH4F 3R61A 5L3BA 2XROA 4I02A 2JTVA 3WTVC 5DD8A 3DKWA 4R1HA 5DUIA 5LRSA 2A6EF 3BZ6A 3LQQA 2RKHA 1XSXA 3WTYC 5IT9K 2HKOA 3ISPA 1U3EM 3C18A 2OBPA 1PUEE 4ENNA 2MBFA 3ZMZA 2VOPA 2PFBA 2EFWA 3F23A 2G7HA 1Z7UA 1ONVA 4Z2YA 1IN7A 1D5VA 1R36A 1SD7A 4OMZA 4KIGA 1BN5A 2GXBA 3FM3A 1UFMA 1BM9A 1KQ9A 2H09A 1FP2A 3TO7A 3HUGA 3BPVA 2HGCA 3K1NA 4Q4ZF 4YFKF 1G3WA 4U0WA 2EK5A 1KU3A 3TKYA 3RPQA 5EEHA 1IXCA 1O3RA 2ZNZA 4L0ZB 3BDDA 1O3QA 1J7KA 1RUOA 1YW8A 1XDUA 3KE2A 1TW2A 1F1ZA 1LDDA 2K7LA 3RTRA 5IT3A 4CGZA 1C0WA 3CO7C 3WGGA 4Y17A 3T8RA 3I4PA 2EFOA 1MJBA 2H6CA 2P5VA 2R7FA 1CGPA 3CO6C 2H27A 2DTRA 2FNPA 4OIRF 2PI0A 4EJOA 4M9SA 4G7HF 2P6SA 2PQ8A 2D1VA 2D1HA 1VTNC 3GZ6A 1R00A 4ZYHA 1WI9A 2EV5A 3LA3A 3V8JA 5DV5A 2EJRA 2VONA 4IVNA 1FC3A 4DQ2A 2LKPA 2A5YB 2V9VA 4RB1A 3KP6A 3I64A 4P55A 2V1XA 5EEGA 2MLKA 2Z9OA 2F5EA 4UV8A 1P92A 4UXNA 5CVRA 3F21A 4PGGA 2IP2A 1WQ2A 2FF4A 1MKMA 2NS0A 3T0YA 2L02A 2QQAA 4S05A 2HQRA 1P2FA 2M30A 1OKRA 1T6SA 4G7OF 2VC1A 4BNCA 2O0YA 3R4KA 5LHGA 3GW2A 4B8XA 4FX0A 2VODA 4D0PA 2VBYA 3L2CA 3CUQC 2CO5A 3GXOA 1LNWA 1ZLJA 2BEOA 3HSFA 5ICCA 1F4KA 3DPLC 2GWRA 4L9JA 1JE8A 1W7PA 1R1VA 1HKQA 3U9GA 4A2UA 5F6FA 2RN7A 2P5KA 5LGTA 4R79A 3HHGA 2VOOA 3WTUC 1BI3A 2HEOA 2ADUA 3HRMA 1B9NA 5ED4A 3CJNA 3FWEA 3LQRA 1V4RA 2A6HF 5IT9Z 2CG4A 3KLNA 4UVCA 1W7PB 1HW5A 4KN7X 2HDCA 4A6DA 4A5NA 3GEZA 2EV6A 3F8FA 3ZN1A 3HRTA 4IXAA 3CUQB 3ZMVA 2IT0A 2K4BA 1BC8C 4R8HA 1O3TA 2JZYA 2DW4A 3BWGA 3HYIA 2DQRA 1IF1A 5D5VB 2D45A 5JI6A 2JT1A 1B4AA 1BI0A 3TOBA 3WTTC 1BBYA 4EJTA 1WRJA 4EM2A 2WC2A 3QU3A 4RB0A 4G7ZF 3CUQA 1KYZA 1FYKA 5DCMB 1K6OA 4M6XA 2KIMA 3HSEA 1QNTA 1XSDA 5E1ZB 3P9IA 3EDPA 2CYYA 3ELKA 1SFXA 2P7CB 3T8TA 1YS7A 3DXJF 2XRNA 2FBKA 3ZMUA 4AIJA 3ERED 2E1NA 1QZYA 2VBXA 2E1CA 3P9KA 2ZJ2A 3QPTA 3S2WA 4U0YA 3IL2A 1P6RA 2XAHA 2HYFA 3H3UA 2ISZA 1ON2A 2DFIA 5D5XB 2HWVA 1QBJA 4RGXA 5CLSA 4YIFA 3I71A 4PCQA 2W57A 2IPQX 4M74A 4LMYA 3N4MA 4RGUA 4Y15A 2W25A 2WV0A 2ZBKA 2FEZA 3Q9VA 2F2EA 2WWYA 2STTA 4KA4A 3RIRA 5BPDA 1Y0UA 4CYDA 1REPC 5KK1A 3QPHA 5AONA 3F22A 1YTYA 4LLNA 2DQLA 2BYVE 2GXGA 3TO9A 1R5HA 1U5TA 2YSRA 1U5TC 5ILVA 1ZAOA 3VODA 3JTHA 4LB6B 3HOTA 4ON0A 3Q5FA 3SHFA 4HF2A 2BV6A 3KLOA 2DPUA 3SFZA 2ETHA 2G7UA 2XV4S 3OV8A 1Z91A 3JSPA 2XAGA 3LWFA 4I09A 4UVBA 1USSA 1TQIA 2GZWA 2JPCA 3M8EA 3J81K 2MA3A 1H9TA 3K69A 2CWEA 1B59A 5E20A 2P7VB 2Q0OA 2ELHA 2FE3A 3K2ZA 4CICA 2K27A 1FBSA 1R7JA 4KUMA 2L4MA 5H6QA 3MWMA 3TOAA 1R1TA 1S7OA 5ILUA 1YYVA 3P7NA 4FX4A 3DFGA 1KQ8A 3DF8A 4RS8A 4L9TA 5CJ9A 5FD5A 3HOSA 3WG9A 1A04A 2FSWA 3E5QA 2QLZA 2NAZA 4U7DA 3GUDA 3M1EA 1KYWA 4Y13A 1KA8A 2F5CA 1Z6RA 2A69F 3BJ6A
chains in the Genus database with same CATH superfamily
3ROUA 3ZQQA 4HRIA 1RKWA 4KITB 3M3YJ 2E60A 4IJAA 3R0JA 3BT9A 3OIOA 1KQ0A 2KZVA 4ZC3A 4PGHA 2JVGA 4XKWA 5KNLA 3CDLA 3G3ZA 3VSLA 5LEJA 2E5ZA 4QWQA 3S1NJ 1OISA 2I5UA 1NK3P 2O61A 1ZH5A 2IS4A 1IUYA 1XGOA 1ITYA 2HU9A 4Q5SF 4MEXF 1O7LA 3HGGA 2MW8A 4B44A 3CC2I 5M3FJ 3CUOA 2ZJRF 3WHBA 2HQNA 2Y0SA 3FZVA 4DYRA 4BUPA 4IHTA 1Z67A 2EWNA 1GV2A 1RNLA 3IHUA 3K4JA 1IV6A 1ACIA 1JI8A 3I0TA 3HRUA 1D1CA 2EINH 2NVUB 2NRAC 3NWTA 4AC0A 2L2OA 1HDPA 4L9VA 1IC8A 1FSHA 3TDUC 2GIZA 4PSWA 3TBIA 2FMLA 2M7BA 3HOWJ 4XKVA 5H20A 1R4MB 3ASNH 3QAHA 3DLLF 1V5GA 1YE9A 2QZ8A 1T8IA 2V79A 3J80Z 4IEJA 2V6EA 1HKTA 2Z99A 1HW1A 2M87A 1GLNA 4KT6A 1YQAA 4HX7A 1I6XA 5DEQA 3A1YA 5M3MJ 3EUHC 3RPUA 5FFZA 4RM2A 4O6JA 1WPKA 2XGXA 2XAQA 3TEDA 2HKXA 4ESBA 1USTA 2QKMB 1FNNA 3M8JA 3F9KA 4CHUA 4WK8F 2LP0A 3GZNB 1MW7A 2IS1A 1Z6TA 3DLAA 3VYSB 4DIQA 4ITVA 2JJ7A 4XICA 2MVTA 2WTEA 1SD6A 4GO1A 2VC0A 1RETA 2W82A 5LHIA 2EA2A 5GP9A 2HOEA 3WU2C 3HKZA 1LDJA 1I1GA 1YX5A 1ZN2A 3EUAA 3K4MA 1JXSA 4HSTA 4L5IA 1EA3A 1UELB 1G4DA 1TT0A 1OFCX 2PX9A 1G3TA 2LY9A 1SFKA 2WBMA 3BG9A 4KISA 1ZK8A 3G1LA 2IJLA 3GTQJ 4IO9F 3HG9A 2EZIA 3E0JB 2K85A 2R5ZB 1U8RA 5GAGJ 4IKFA 1R5ID 2DT6A 2L9VA 4LB5A 3K1MA 3WE2A 3FISA 1W0UA 3TP3A 1X3ZB 3VEPA 1D8KA 2R92J 1R9TJ 4FT8A 4G6QA 1ZG5A 1E17A 1IN6A 2VKDA 2KL4A 1XMXA 2DK8A 1RZ4A 1OCCH 3DWLE 5TRDA 2COMA 3LAJA 2JSCA 5FLXZ 3OYCA 1YO5C 2LF7A 3PSIA 5CVIA 4XLCA 3W6JB 3JAMK 3GFIA 1AA7A 1X4PA 1I39A 4RB3C 2QGUA 4HNUA 2JA2A 3KP5A 2A6TA 3I5UA 3EUKL 1R4NB 2R4GA 2M5WA 2VE9A 3IH2A 2HVRA 2EH3A 2KRFA 4A93J 3VYUB 4NB5A 4DJAA 2L3DA 2M2EA 1Z05A 1JUSA 3WU1B 2M8EA 3AG2H 1ULYA 2JRTA 1OJLA 1J5YA 1HSTA 2JRMA 5J3LA 3N97A 2LVSA 3ZQFA 3OSFA 4I01A 3JCUC 2ISYA 3VSKA 4QTRA 1QZZA 3JW4A 4BDYA 3FHZA 4OIOF 3U2RA 1PDNC 4XR6A 3RI4A 3DEEA 2JA5J 3BQYA 4ENKA 3PIPF 1HBXG 1S9HA 3DCFA 4N9IA 2JPBA 5LEKA 1P7IA 1UMQA 2A69F 1V54H 2XF6A 4CCLA 4ETSA 4E7JA 2LMDA 2VI6A 1MBJA 2BXYA 4N4OB 2QSHX 5J8CA 2K9MA 3JRGA 2ID6A 5HNFA 3E6CC 2OZUA 1IAWA 4LIUA 5DM7F 3ABUA 1EH7A 3Q0WA 3MZ8A 1TQPA 2VE8A 3SZTA 2I8DA 3QOPA 4CCNA 5DDGA 1VQ4I 2M9HA 2EZHA 2EILH 3RJPA 1W5SA 4XRFA 4HQMA 2VIXA 1ETYA 2OPTA 4MQ9F 1D5YA 4EJUA 2MGQA 4UB8C 1IW7F 5D8KB 3H92A 1SC7A 2QKLB 3ABLH 3D0SA 1QZEA 4BH9A 5HLTA 4UUSB 3D1NI 3O2PE 2VJ5A 3F3XA 4W97A 4DBQA 1BIAA 4NHJA 1RUNA 4G8XA 4HNTA 1JKRC 1U78A 3WTZA 2DI3A 2E2JJ 5IY5H 1FPQA 1UCRA 2MFZA 2DYSH 2DMTA 2H6BA 5ERIA 5DCFA 1MDMB 3VDXA 1GXPA 1K78B 4L9NA 1FT9A 1SMYF 1TNTA 3ULQB 2LTPA 2CV1A 2P81A 1UHMA 4AVPA 2A68F 3G71I 1HKSA 2STWA 2LYCA 3C1DA 4LK0F 3VYTB 3OL4A 2VQGA 3DP7A 1OCOH 1LJ9A 3LSKA 1APLC 2A5WA 5CYVA 2AQEA 1K4TA 2CQ7A 4A3EJ 1LVKA 3OYJA 2XB5A 4EJWA 4MFDA 2R0QC 2C6YA 2EIMH 1QGPA 1YG2A 5B3SH 4LFUA 3KPHA 2CGPA 1WHUA 1RIOH 1H0MA 2HOSA 4PJNA 1MDMA 2IA0A 1K78A 2FOKA 1YLFA 2RVCA 5EZHA 5E1XA 3I4NJ 5CQEA 2MLGA 3CCUI 4L18B 3FXKA 4J19A 3OIQA 5LLQA 2K02A 2NNNA 2Y75A 2IVMA 3FXRA 2EB7A 5EG0A 2R5ZA 1T2KA 4FQGA 2HVSA 2NVTJ 2QQ8A 4YELA 5DYMA 3K10A 2P4WA 4ENMA 3BR2A 2OU2A 4Q48A 1KGSA 4A5MA 4EM0B 3FBNB 1FP1D 3GYHX 4OINF 2HYJA 2EFPA 4RGSA 4AYBN 3W6KB 3EYYA 1EV7A 3H3ZA 1I6HJ 3LSGA 1O57A 4C2TA 3G4SI 3OWTA 5F64A 2ACJA 1P4WA 2QM3A 1ZGJA 1X2NA 3MKWB 5B1BH 5AIPA 1B1BA 4KIFA 2HDDA 2P5LC 2IRFG 1ETWA 2MABA 4XNFA 1ZYRF 4XKBA 1MZBA 3BPXA 2R7DA 3OYAA 2XUBA 3FMQA 3OYKA 5L3EA 1I5ZA 3VOEA 1ZREA 2EPFA 3I4MJ 1MSEC 2B0LA 4CO8A 3AKZA 2JA8J 3TO6A 4XIDA 4CCOA 4J00A 5D6FA 1D1AA 3GTOJ 3HIFA 2CJJA 1UB9A 2VJIA 4LITA 4NDLA 4QPOA 5LHHA 1RQ6A 4LG0B 2F5DA 2LNBA 2HTJA 3K2AA 2RQPA 3AFHA 2VPLA 3DU6A 1Z3YA 4XOTA 3ESWB 5HODA 2W00A 5IYCJ 2KIUA 1F9NA 1LUJB 2Q8KA 3HOYJ 5TGTA 3GF2A 1S3JA 4RBOA 4ZYGA 5HDNA 1NH3A 1OCPA 2ESNA 1LVAA 3K4KA 3W2AA 2CFOA 2FA5A 4UVAA 4KNYA 4HA8A 3KX2A 2GQQA 5HLHA 3S1RJ 5D8LB 1F36A 1ZGWA 3ZMTA 1HW2A 4UNOA 1D1BA 2MH2A 4IHWA 1QU3A 3U21A 2TRTA 2HVQA 3ML6A 3KFWX 1B72B 3C3WA 2QBYB 3DTIA 4A3KJ 2DA7A 3B02A 1PVEA 2HPMA 1BI1A 5F0HA 4NQWB 4Y7NJ 4AIKA 2EFQA 1CF7B 4ZZLA 4AIHA 2RC4A 3J81R 4E4HA 1X4OA 4JOMA 2Y30A 3FXOA 3KP4A 5K7ZA 3GTKJ 5HDKA 1RESA 5JVTA 1V3FA 2LSOA 4PJ0C 2FXAA 3VYRB 5BS6A 5EG0B 3GFMA 3LSTA 3PQKA 1LE8A 4NUBA 1YI2I 1G3SA 2CW7A 1Y0NA 2L9SA 2OZ6A 2PJRB 2VLAA 2GLOA 2CFXA 5EJCA 2BGCA 4KDPA 3H0GJ 2R7RA 1V55H 2X4HA 2K9QA 2M8GX 2IW5A 3E6BA 5LRRA 5LFAA 3ZQCA 3OR1C 4XLEA 3PQJA 1T0FC 4KMUX 5BMZA 1YW9A 1SD5A 2PMZN 4M3DA 4NC6A 4GFBA 5HDGA 1T56A 1YIOA 3HL2A 2HZTA 3OR2C 3N05A 3TGNA 1P4AA 2DCEA 5FRNA 2QQ9A 5CKTA 3JRHA 1E0EA 3GWZA 4B4CA 1UJ8A 3HC7A 4GYGA 1YHQI 2Z3YA 3FXUA 3PNYA 4JX6A 4B09A 3Q0VA 2TCTA 2L7ZA 1I3AA 5DUKA 2KDOA 4KIBA 1TT5B 1JHHA 2CS3A 4CCMA 1PP7U 1FZPB 2IA2A 2QYOA 4UUVA 5E3OA 4LIVA 1SVMA 2FOWA 2X48A 4ZYDA 5F0FA 4HLYA 3GFJA 1IRFA 4DW6A 5EGOA 1FLIA 2IS6A 4XLNF 3BTIA 5H6RA 2NOGA 1ENHA 5FLMJ 3AAFA 1TW3A 1HA8A 2KQRA 1V5EA 3E6MA 4ESFA 3BROA 1MIJA 5JFRA 4MTDA 4KMFA 3C2GA 2M34A 5GTIC 4WXHA 2R5YA 4WX9A 1VQ6I 2VBWA 3CMAI 3SJMA 1DP3A 2Y69H 2XKPA 3V7RA 1IGNA 2HTSA 3DBRB 3PL8A 4GCVA 4M6YA 1KONA 2HPIA 1VQ7I 1KZHA 4Y3OA 4S04A 3G1OA 2CW0F 1FBUA 4IRIA 1L0OC 1IXRC 2OV7A 1FWZA 4HX4A 3S14J 3HHHA 1T08B 2R7TA 3IKVA 3KYDB 4ZZDA 4HDUA 3KZIC 2BY3A 1OYYA 1J09A 1GT0C 1N78A 3COAC 2EIKH 3CCRI 5H2FC 3GZ5A 1S8NA 3I59A 2ZXWH 4CYCB 1W7PD 5J6XA 6PAXA 1Y56A 1HOMA 1SMTA 1U5TB 2KP6A 2KPMA 1RC9A 1IN8A 4B1RA 4BJ5C 5GTHC 2H94A 2ZXIA 1SFEA 3KEOA 4PZJA 1ZELA 4IX7A 4MO7A 2QEXI 3A0HC 3K6GA 3CF5F 2RV8A 5IYDJ 2VT3A 1JKQC 3B73A 3S8PA 1JGGA 1A35A 2ZKZA 4HAMA 4AYBA 2E34A 4UV9A 2R93J 3KIOA 4PSXA 1VZ0A 3BZCA 1IDZA 1UG2A 2Y9ZA 1JHFA 2M1BA 3A01B 2MH9A 3RQIA 3BOQA 1D3YA 1WI3A 2KJCA 3HGYA 2DFEA 3KZZA 4A12A 5LBQA 4E7IA 3RKXA 4YFXF 4HF0A 4ANJA 5A2QZ 5ILSA 5KHDA 4RAYA 3ZRGA 3ZR8X 2TDXA 4IOCF 1FOYA 1YRNA 4S0HB 1X58A 2P8TA 4HYEA 2F4IA 2LBFA 4LD5A 5HS9A 1P9QC 1BR1A 2FRHA 2XAFA 3HEFA 3VWBA 3BCAA 1Z7LA 5D4SA 4HLXA 3RKWA 1AKHA 2Z1DA 2RGVA 2DA3A 1WWXA 2BW3B 2HR3A 3GTGJ 2OC6A 3PUFA 4P5OA 3M8FA 2Q2EA 2W85A 1VQOI 1OR7A 1ERDA 3L00A 1X19A 4M9ZA 4BHPA 4HZFA 1B8IB 1S6LA 2QCOA 2BHZA 2LY2A 1WJCA 5L3CA 2PMHA 2ZMEC 3DPTA 3L7WA 4AU7A 2XKOA 5CPRB 2DPDA 4EATA 4HSRA 2GM4A 3REOA 3ZMSA 4YEJA 4X0GA 3CLOA 1BW5A 1S72I 4MNUA 4ZDPA 1IDYA 3D5RC 1FJLA 2L4AA 1QPIA 4M9XA 4TV7A 3H36A 3V8KA 1NG6A 5F08A 3G6EI 4OMYA 4Q47A 2PG4A 3WGIA 2NNYA 3IAM2 1OYIA 3PFYA 2GOXB 3HRSA 2FJ1A 1WCMJ 2B7EA 2RDPA 3OMYA 3KZYA 4A0YA 2ZMEA 4CCJA 4GDFA 3M4OJ 4ZYAA 2XPWA 1J59A 3K9TA 2VXDA 2ZXJA 3T5XA 2JSPA 2HFHA 4L0YB 2L9RA 3O8HA 2M0CA 2O9LA 4WF2A 1BW6A 1Z77A 1TBXA 2W24A 1YJWI 1GUUA 2XASA 3C7JA 5IP7J 4UY8I 2MSYA 2EA4A 2DO7A 1MBFA 3EETA 5IOZA 1DGRM 1LQ1A 3CP8A 3H35A 3K4CA 3TL4X 5IYBJ 4C30A 2IBDA 4BEHB 1AKHB 3HDDA 1K83J 3NQOA 4LG0A 2UUZA 3ZMDA 1OPCA 3J7ZI 3HM5A 2CV2A 1MMGA 3ABMH 2R7OA 3BR3A 1WGXA 2EBIA 4EQQA 1XMAA 2FQ3A 4II3A 4HOBA 2VXZA 3IRQA 3P9CA 4N9HA 1MJAA 2FU4A 1HSJA 1TC3C 2J5OA 2KDZA 3WE3A 5LD2C 4I7HA 2VKHA 2MG4A 3RYRA 5CQGA 2OF7A 1Y1WJ 1H9GA 3SQNA 1J75A 1FIAA 3LL7A 5J47A 1IJWC 4IHSA 5J40A 2WY7Q 5HOOA 3S15J 2W84A 4GYIA 2R5YB 2IS2A 5D4RA 1ETVA 4NNJA 5GPAA 3J7AY 4WCGA 4O3MA 9ANTA 3EPZA 1R1UA 4C3IJ 1AOYA 3I53A 1OMIA 2NOJB 2ZNYA 4ZYEA 4CSWA 3RSNA 1TTYA 2VQCA 3B6CA 3HZJA 3F8NA 4DYCA 1WSUA 2O6GE 1IRZA 3TW7A 1UG0A 1QO0D 5E18F 2DN0A 2JA7J 3L9FA 1QVUA 1JT6A 2WADA 1OR7C 1ZARA 4X6AJ 3E3VA 4M72A 3ZQGA 1O7FA 4KICA 3OY9A 1SAXA 3VFZA 1IG7A 3OIPA 1W5CC 4F7ZA 3DKYA 3L2UA 1I27A 3L1PA 2LDUA 1JGSA 1LFUP 2E35A 3OSGA 1BOAA 3H5AA 3EUHA 2V6CA 3IUOA 1HCRA 1MMAA 5L3DA 1K6YA 4HNVA 2CSOA 1TLHB 3EQLF 1S29A 2ZCWA 4XONA 2D2WA 3TQNA 2LK2A 1DPRA 2GA2A 2LR8A 2X1CA 3JAMZ 2LFBA 3I56I 1GDTA 1VF9A 4HV5A 2WV1A 3V7CA 2XAJA 2IAIA 4HV6A 1WH7A 2RREA 1RPWA 1T39A 5ICFA 1QRYA 1XGMA 1N75A 3BJAA 3HTUA 3FKIJ 3O3KA 3HB9A 3OYIA 3ZQ7A 3F6VA 2JN6A 2LKXA 1S5LC 1ZRFA 1FX7A 4A0ZA 4OIPF 1B8IA 1VQPI 3R6SA 1GXQA 2L01A 3CLQA 1ZRCA 4XN0A 1IN4A 2NS8A 2OQRA 3ZPLA 4L5EA 2Q2EB 3W2VA 2R7SA 1Q1HA 3BC8A 5E8IA 2BW3A 4HW0A 3W2WA 4BHCA 4CYCA 3L2WA 4DBRA 2A61A 5GAHJ 3GTPJ 5TJJA 3OYDA 2LD5A 2OQGA 2LG4A 2WAQA 1D0YA 2OCCH 2BE5F 1VQLI 1LFBA 4I0BA 1ZQ3P 2FNAA 3I54A 1KU2A 4A0XA 2Z5UA 2K9NA 3FMRA 4XRMA 4PFOA 5ICEA 3Q0UA 3DTKA 1R5GA 1UZCA 1CF7A 3J7AO 3MAJA 3OOPA 3M1CA 3FXQA 5BQTA 1FYLA 5K1YA 3MFKA 3IKTA 2QENA 4KJZA 5FFXA 3CCEI 3I3LA 2O8XA 3A4CA 2VQLA 3F72A 3KP2A 3E5XA 5F1JA 1Z1DA 4A3IJ 2XB0X 4E7HA 1DDNA 1IZ1A 1TQMA 2YX7A 1M1EB 1L3LA 1U2WA 4JK1X 4EJVA 1OCTC 3HTSB 2BY2A 2DJIA 1DUXC 3GO5A 4AVZA 3FXMA 4O5VA 3S17J 1ODDA 1ZR4A 4RAGA 2HDWA 4LG3A 1KU7A 2HOTA 3RZOJ 2BXZA 2Y48A 3E6DA 3FHNA 2DA4A 4ZDLA 1EF4A 3BQZA 1ORKA 1WJ5A 2OA4A 3IWZA 2PN6A 2DA2A 1J9IA 2BBYA 4WXCA 2YUSA 2GA1A 1WFXA 4HDVA 4BQAA 3M9AA 5K7FA 1Y8RB 4I98B 1JKPC 3J7YJ 1W5TA 4IPAA 4UUSA 1A31A 4DOZA 4XN3A 2MYSA 3U1DA 5D5WB 4N0BA 2A07F 2LC2A 2QUFA 5CVUA 5FO5A 2G0EA 4C3JJ 5EDNA 3R60A 3ZGKA 3CMMA 4D7MA 1XD7A 3BR5A 2B9SA 3RDIA 4YFNF 2UXXA 3ECHA 4OIQF 3HPGA 3A02A 3J7AW 3CZ6A 4E7SA 1MBGA 5IP9J 1AU7A 2M4GA 1ZG1A 4C9YA 5CVVA 2F6CA 4XLPF 1K7AA 2F5FA 4PFPA 4LJZF 4MGRA 1B6AA 2XIGA 4OU0A 5F0CA 3FX3A 5HVQC 1K79A 1HXDA 1Z3XA 1EH8A 3FDYA 3TP0A 5EGOB 2CUZA 3O8GA 3JTGA 3ZP5A 1GHCA 3T1BA 4HQEA 2RNJA 2V7FA 1DP7P 4YG2F 1A6IA 2E2HJ 2PBIA 5JLXA 4FHTA 2L54A 2ME0A 1YS6A 4ESJA 2DA6A 3F8BA 4OWRB 3CF2A 2AS5F 1XB4A 4D5FA 3H3VK 1F5TA 2GIVA 4I76A 2NYXA 3IAS2 1XGSA 4JQFA 3DEUA 2L7FP 5DTDA 2BVLA 4A6EA 1O3SA 4HPQA 4D9JA 2X6YA 4OAZA 2WAQN 1LEAA 1X3UA 2DOAA 3RKYA 1ZG3A 5J1UA 4P96A 3LA7A 4PJLA 1SANA 1QPMA 1W1WE 2M0MA 3LFUA 1P4XA 5FD6A 2MC3A 3V7SA 4ZJZA 4DZPA 3K1PA 4ABZA 1HC8A 3R0AA 2X0LA 1MD0A 4V19K 2LKSA 2VB6A 1P7JA 3RQ4A 1FYMA 3D5SC 1YX3A 2UWMA 1LDKB 1G6NA 3F6OA 3WTSC 1D0ZA 3OL3A 2DMNA 4XMYA 1HQCA 3BJOA 2LREA 2ZJPF 3UKGA 3FM5A 2ZO4A 4MHGA 4I6ZA 1TZLA 3OOUA 4I0AA 4F52A 4BE1A 2P0TA 1PP8F 1EKEA 2K9SA 1QQIA 2IA1A 3K70C 3QPSA 4BAYA 4E70A 1IN5A 3D5LA 3KP7A 5K7HA 5GPCA 3UR3C 4JBAA 1XCBA 1T95A 5D5UB 5J8FA 2UXNA 3GMEA 4FCYA 3FXJA 4LGWA 2ID3A 3OYGA 3FBIB 3U1KA 3I55I 3CCVI 1U6GA 5BOXA 2L7MP 3Q9SA 4RMNA 1B72A 2QBYA 2QA4I 2PJPA 4W1UA 5E1WA 2R7VA 1UHSA 1MNEA 1R22A 2ELKA 4RAFA 2CUFA 4PK4A 3F8CA 3QP5A 1R23A 5FB2A 1XCVA 4LLGF 4L5JA 2HYGD 3BR6A 5DD4A 4LK1F 3M7GA 2K9LA 1LB2A 2H1KA 1O4XA 2KKOA 3GFLA 4CXFA 2YU3A 1LEBA 2XVCA 2OD5A 1I50J 4JYKA 5EYRA 3I59B 3LMMA 1NG7A 2KT0A 4P9FA 2FMYA 1Y8QB 4JX5A 2E7WA 3IRRA 2CQNA 2KIFA 2PMUA 4A3CJ 2BZTA 1SD4A 2M45A 2QVOA 2VQHA 4UHTA 3WTWC 5J4YA 2F48A 4RA2A 4IF4A 4MTEA 2KFDA 2R7QA 4ENJA 1JJ8C 1KU9A 2RAEA 4A3DJ 1YW7A 4KT5C 3NEUA 5K5QA 1SFUA 2Q1ZB 4GGGA 2ZC2A 5JHFA 2XPVA 3V4GA 5KAFC 3L09A 1MJ9A 1RR7A 4DNCA 1U0JA 3IP4B 3RPUD 1E3OC 2Y9YA 1G8XA 3M07A 4HEA2 5K5RA 2OAZA 2DDAA 3TMOA 5HS8A 3QP6A 3MEXA 3MZHA 2AXTC 2W7NA 5ICGA 3GLXA 1BC7C 1Z9CA 1FEXA 3LSRA 1Y39A 1X1BA 5IP6A 2P6TA 2Z16A 4U87A 1FSEA 2K3FA 4II2A 2UZKA 3JREA 4WXDA 2VJJA 3LFKA 1YFHA 1VQMI 1Y6IA 2M4KA 4XKCA 3TW6A 1BI2A 4M6VA 3F0CA 4P9UA 3SXYA 2Z33A 3QPLA 2IGKA 2PJRA 1B9MA 3FMSA 2WAFA 1W4MA 5F1RA 3W3CA 5E79C 2IGNA 3SYTA 5FGMA 4CZCA 1FBQA 3BG3A 1G3YA 1MH4A 1NHAA 1ZTRA 2O03A 3K0LA 2XF5A 4F55A 2LF8A 3G2BA 3SDBA 1R71A 1W0TA 1H89C 2AXLA 2GAUA 4EMSA 2VJ4A 2X6XA 3GVAA 3W6VA 3SZPA 1I1SA 1ETOA 5K5OA 3S3OA 3OYHA 2EZLA 1V5FA 2X9DA 5KVRA 3WODF 5L3FA 2LOOA 2FBIA 3KETA 3CC4I 2E1MB 1T38A 2KJBA 3BY6A 4G9YA 2KISA 2NVYJ 3KEYA 3BZKA 4M73A 2EV0A 3PNVA 2V1NA 2KMUA 1BIBA 1RKTA 2QF7A 4K2EA 1GV5A 3TDZC 3BTCA 2DT5A 4UB6C 1XDSA 2R3SA 1J2XA 4KFCA 1MBKA 3QU6A 4E7ZA 1LFPA 1QHHD 4B43A 1TP4A 3DV8A 4ASNA 2ZFWA 2VKVA 4AD9A 1HF0A 1FY7A 2OTLI 3HOVJ 1XN7A 4I2OA 2NVXJ 2DT7B 2K4JA 2VBZA 2I10A 1WKMA 1K61A 4FE4A 1ZLKA 3ZQHA 3G73A 1HDDC 4IRGA 1BR4A 4V2GA 2HOAA 2BVMA 5AIQA 2V26A 2LLKA 3I58A 1QVTA 3LAPA 2O3FA 2JWTA 3AG1H 1ZGAA 3J81Z 3LSIA 4I99C 1BR2A 5L3GA 4RAZA 2OJED 5J4VA 2FD5A 1VQNI 4M71A 4NQWA 1RI7A 4C2MJ 4BU2A 4G94A 3K70D 4D5CA 3FK6A 2CQKA 3JAMR 1YJ9I 2YR2A 5BPIA 1R58A 3E1SA 2YX4A 3CCQI 2PMZA 2Y2ZA 2BOLA 5E8GA 2XSJC 4CZZA 3FKJA 2VT2A 4DZJA 4GRIA 3RYPA 4XBFA 3K4NA 2R7XA 4C3HJ 1X1CA 5TISC 1T98A 4D1QA 2EIJH 2MD5A 2P0WA 3MCZA 4F92B 3GTJJ 5C4JJ 3LA2A 2CQQA 2N8GA 5E17F 3H9JA 4EV0A 2DU9A 1BJAA 1DPUA 3IC7A 3QRFF 4QLCU 2EFNA 1XG1A 1VQKI 5EEAA 4U7BA 2DXIA 1XSVA 1E3HA 5JR3A 4GXOA 2DA5A 2D5VA 3ABTA 3E97A 4U88A 1GVJA 4EM1A 4EGYA 5LGNA 5DCMA 3WGHA 1ZHFA 4FETA 3DQVC 2DAOA 1QHGA 3CDIA 4F3QA 1NK2P 2AQFA 4FE7A 4BXUA 2GOMA 4G6DA 5CVJA 4F91B 3HBLA 2FX0A 2AHQA 2XSDC 4IRHA 1MBEA 4BQQA 4J01A 4JP0A 4BEHA 1JJ6C 3KP3A 4IHYA 2W4SA 1J0RA 4ZTJA 2DODA 2YPRA 4U0VA 3OS1A 1TNSA 4BHBA 1DU0A 2HS5A 2A3SA 3LSJA 2Y0MA 3CTAA 2K5CA 1BL0A 2DFHA 5J1RA 4RGRA 3ECOA 2O7OA 1MGTA 3NRVA 1IRGA 3ONQA 2KZGA 2KLOA 3WTXC 4P1WA 3SFIA 2ZMEB 3J80R 2E2IJ 3F8MA 4IOAF 2B63J 2VN2A 2WA0A 1XPXA 2ZXHA 4HX8A 1ON1A 2V9KA 3ERMA 2DDBA 1H8AC 4A3FJ 2QWWA 3A2KA 3OYMA 3J80K 3BCBA 2DMUA 4M3BA 3MQ0A 3FXLA 3EYIA 2LH9A 2CU7A 2W1OA 4CUGA 5HS7A 3CCLI 5D6EA 1S7EA 1R6RA 4CCKA 2V1UA 1T0FA 3MD2A 1YOVB 1Z0XA 2G9WA 2DFFA 2ESHA 1OYWA 2XHKA 4XSZF 3CCJI 2V1DA 5A2QK 4YIIA 2PEXA 5E3LA 4G6TB 2IGMA 3WU0A 2WB1A 5KCMA 2M35A 4IQJA 4BY7J 2NS7A 4CH7A 1U9NA 3DEWA 1K4SA 1AWCA 1JKOC 3H5RA 5A2QR 2W48A 3L2QA 3MZYA 3QWLA 1YIJI 4RB2C 4A3JJ 5DM6F 4LLLA 3PSFA 2K40A 3L2RA 1D8JA 3SZGA 3HSRA 1WJFA 5HLGA 4FASD 2EQRA 4JX4A 5FLVA 3CQZJ 3A01A 5HLIA 4MEYF 4N4NB 4CDGA 3H1CA 3VB2A 1PUFB 1Z21A 3BP8A 1MMDA 2E36A 1FOKA 3CDHA 3AL0C 3V8LA 2E7XA 3QODA 3KEQA 4XLAA 5B5EC 3E5UA 4XSXF 3DKXA 4PDKA 2PLYA 5FLXK 2YS9A 3BR0A 3MMYB 3HKZN 2CRGA 1ZRDA 4H0EA 2DBBA 1WJBA 1TWAJ 4WWCA 3BG6A 1EH6A 1XGNA 5KAIC 3SEQA 2F4MB 3S3MA 1MH3A 3HXLA 1X1DA 4BYYA 2XGEA 3FF5A 3A03A 5FKOA 2NVQJ 2CQXA 2J5PA 1S7AA 4AWXB 5FJ8J 1XMKA 2HXIA 2RNGA 2VASA 1E2XA 1XTAA 1NTCA 1OCRH 2BHYA 2KIQA 5B1AH 1DU6A 2DLLA 2DK5A 5M5WJ 3JRIA 4KN4X 1UHWA 5JHUA 2LRDA 3OYFA 3GX4X 4KYWA 5FROA 5LGUA 3FIWA 3FK7A 3O6BB 2CUJA 4EGZA 3A0BC 2XGDA 2FBHA 5BNGA 1STZA 1LKXA 4MQVA 2DTZA 3CMYA 2QQBA 3DPUA 4HBLA 3ZN0A 2OTJI 2K3PA 3BTLA 4BL0B 4OOIA 4EVIA 3MVPA 4BXFA 3JSOA 1IXSB 2GBYA 3KCCA 4PUSA 3IWFA 4XRSA 3PFIA 4RM3A 3DTEA 4HF1A 4NBQA 2K86A 4ZH4F 1GVDA 5FRMA 3R61A 4BBRJ 5L3BA 2XROA 4I02A 1DGWY 2JTVA 3WTVC 5DD8A 4AUXA 3DKWA 4A3GJ 4R1HA 2MUNA 5DUIA 5LRSA 1YITI 2A6EF 2WY8Q 3X2QH 2O5RA 3BZ6A 3LQQA 1MNMC 2RKHA 1XSXA 3JRFA 3WTYC 5IT9K 2HKOA 1TWCJ 4XLHA 2KHMA 3ISPA 3ABKH 5JLWA 3BTJA 3MKZA 1U3EM 3C18A 2OBPA 4QPQA 1PUEE 3PNTA 1TL8A 1UAAA 4ENNA 2MBFA 3AG3H 3ZMZA 2VOPA 1TWGJ 2PFBA 2CV0A 2E71A 2EFWA 3F23A 2G7HA 3WHCA 1Z7UA 1ONVA 2UV1A 4Z2YA 1IN7A 4QSHA 1D5VA 1ETKA 1R36A 2LY1A 3OYEA 3A52A 4PJMA 1SD7A 4XM3A 3ASOH 4OMZA 1PJRA 4KIGA 1BN5A 2GXBA 3FM3A 4HG2A 4XOPA 1Y1VJ 2OCEA 2L0KA 1UFMA 3K7AJ 1BM9A 1KQ9A 2JA6J 4D7NA 2DOEA 1MMSA 2O8KA 2Y31A 2H09A 5J1YA 1FP2A 4B48A 1OQYA 2XAUA 3TO7A 1DQUA 3HUGA 2DA1A 1WVRA 3BPVA 4MIMA 4F93B 2HGCA 4EEFG 1N77A 1POGA 3K1NA 4Q4ZF 1RR8C 4YFKF 2HNHA 4CA0A 2WB1N 5C3EJ 2LBFB 4LOCA 2CMPA 1G3WA 4U0WA 4MFEA 2EK5A 1KU3A 3TKYA 4BJ6C 3RPQA 2WAEA 2FUG2 1U8BA 2MD0A 2V4JC 5EEHA 4BQNA 4Z6YA 1IXCA 1O3RA 2ZNZA 1VFCA 4L0ZB 3BDDA 1O3QA 4BE0A 1J7KA 1RUOA 2YU9J 5FLXR 3OYLA 1X3WB 3JRBA 1YW8A 1XDUA 3KE2A 1XS9A 1TW2A 1F1ZA 1LDDA 2JVHA 2K7LA 3RTRA 4E7KA 3S3NA 3V42A 5IT3A 3IH4A 3CD6I 4CGZA 3GTLJ 1C0WA 3CO7C 3WGGA 1X2MA 3DBHB 4Y17A 3T8RA 3I4PA 2EFOA 1MJBA 2H6CA 2XRLA 4NC7A 2CH0A 2P5VA 2R7FA 3WG7H 3LSHA 3CO6C 1CGPA 2DOFA 3C2BA 2H27A 2AO9A 3HPHA 3I9V2 2DTRA 2FNPA 4OIRF 2PI0A 4EJOA 4M9SA 1TWHJ 5B66C 4G7HF 2HZDA 2P6SA 2X1DA 3NAUA 4Y33A 4BACA 2PQ8A 1VI0A 2D1VA 3RCOA 3LSPA 4G12A 2D1HA 5F04A 3QYFA 1VTNC 3L2VA 3GZ6A 1R00A 4ZYHA 1WI9A 2QSFX 2EV5A 3LA3A 3V8JA 1X1PA 4BBSJ 5DV5A 2EJRA 4E7LA 2VONA 2IGOA 4Y4RA 4IVNA 1FC3A 3ZOBA 4DQ2A 2KRCA 2L9NA 2A5YB 2LKPA 2V9VA 4RB1A 3KP6A 3I64A 4ZTFA 4P55A 1JTYA 2V1XA 5EEGA 2L7KA 4B47A 2MLKA 3PIOF 5E3MA 2Z9OA 2F5EA 1JT0A 4UV8A 1P92A 4UXNA 5CVRA 3CJRB 3F21A 3H9QA 2XPUA 4PGGA 1PYVA 2IP2A 1WQ2A 2HQ5A 2FF4A 1MKMA 4BE2A 2NS0A 2E1OA 3T0YA 2L02A 4E6KG 2QQAA 4S05A 1I3QJ 3SDGA 2HQRA 1P2FA 5DS9A 2M30A 1OKRA 1SAUA 1T6SA 4G7OF 2A05A 2VC1A 2ZJQF 5EZGA 3CJQB 1EJ9A 4BNCA 3H5NA 2O0YA 2X6OA 3R4KA 4PJJA 2E5NA 3CCYA 5LHGA 3GW2A 3S2HJ 4B8XA 4FX0A 2L5QA 2VODA 4D0PA 2VBYA 4MLOA 3K4BA 3CUQC 3JRAA 4NC8A 3L2CA 5M5XJ 3S16J 1ETQA 2CO5A 2F4OB 3GXOA 3RKQA 4RLFA 3G1MA 2HQAA 1LNWA 1IUFA 1ZLJA 2BEOA 3HSFA 5ICCA 1F4KA 3DPLC 1VQ5I 3S2DJ 4IZZA 2M7AA 2GWRA 4L9JA 4BGDA 1JE8A 3BG7A 2R7ZJ 1W7PA 4BXXJ 1R1VA 1HKQA 1WH5A 3U9GA 4A2UA 5F6FA 2R7UA 1SVLA 2RN7A 2E1MC 4M3FA 2P5KA 3BR1A 5LGTA 3JRCA 3H9GA 1MSFC 4R79A 3Q3SA 3HHGA 2VOOA 5E3NA 1ZR2A 3WTUC 1WJAA 4IL6C 1BI3A 4XLFA 1W36D 5F27A 2HEOA 4BQOA 1WZ2A 1F43A 2ADUA 3HRMA 1B9NA 2BY0A 5ED4A 2ECCA 3CJNA 3FWEA 2IXSA 2KRHA 3LQRA 1V4RA 2A6HF 5IT9Z 1FTZA 4AM3A 2CG4A 3KLNA 3GTMJ 4UVCA 5C4XJ 2MZ4A 3H0DA 1W7PB 2ECBA 2ICWG 3BG5A 3LOCA 5IOYA 3UNGC 3CC7I 1HW5A 3S32A 4KN7X 2HDCA 1JUPA 4YRVA 4A6DA 3LSMA 1PUFA 1XC5A 2XGCA 4A5NA 2X51A 3GEZA 4RLQA 1IV8A 2EV6A 3F8FA 3ZN1A 4ZDOA 1X1AA 4M3EA 3HRTA 3ZXSA 2Y0SN 4IXAA 3CUQB 1R49A 3ZMVA 3SEZA 3CCSI 1G2HA 2Z2SB 2IT0A 2K4BA 3OS0A 1BC8C 4R8HA 3PJRA 4B3XA 4BS9A 1O3TA 2JZYA 2DYRH 2ELJA 4BKXA 4C2UA 2VKEA 2DW4A 3BWGA 3HYIA 3HOZJ 2DQRA 1IF1A 1OLTA 5D5VB 2D45A 1XX5A 5JI6A 2JT1A 1B4AA 1BI0A 3TOBA 3WTTC 1BBYA 2IEKA 3C2HA 4FISA 4B3AA 5FKNA 5FKKA 1AHDP 1LE8B 2X1EA 2JUCA 2ME6A 4EJTA 1WRJA 4EM2A 4FTHA 2WC2A 3JR9A 3QU3A 4RB0A 4G7ZF 4DYQA 5IPAA 5JVGF 3CUQA 1TWFJ 1KYZA 1FYKA 5DCMB 5FKMA 1K6OA 4M6XA 4XL9A 2KIMA 5EF6A 1SEUA 2ZSIB 3HSEA 1QNTA 1XSDA 1A36A 4BDZA 2ZFUA 5E1ZB 5C44J 3P9IA 3EDPA 2CYYA 3ELKA 1SFXA 2P7CB 3T8TA 3LNQA 3PM1A 4RDUA 1YS7A 1FOWA 3DXJF 1A6QA 1N25A 2DMPA 2XRNA 2FBKA 4X1EA 1JUMA 5FKLA 3ZMUA 4AIJA 3HOUJ 3ERED 2E1NA 1QZYA 3HUGB 1LPQA 2VBXA 4DGWB 2E1CA 3P9KA 5M5YJ 4BY1J 2MC4A 2ZJ2A 3QPTA 4UUTA 3S2WA 4U0YA 1T33A 2DJNA 2JMWA 1OCZH 3IL2A 3B6AA 1P6RA 1VNDA 1A5JA 4QIWN 4AIDA 2XAHA 4M3GA 1QA6A 2HYFA 3H3UA 2ISZA 3JRDA 3HOXJ 1JTXA 4IHVA 1ON2A 2DFIA 3OYNA 2R7WA 1YRNB 3CP2A 5D5XB 2HWVA 3ZCOA 1QBJA 4RGXA 3RZDJ 5CLSA 3NWSA 4YIFA 2JK3A 3DBLB 3QYBA 1FIPA 2F5VA 3I71A 4XQFA 3OS2A 4PCQA 2W57A 4IHXA 2IPQX 2XDVA 3KYLA 2VL8A 4M74A 2NXNB 4LMYA 3N4MA 4IQ4A 4RGUA 4Y15A 4XRSG 3S1QJ 2W25A 2WV0A 3ZQLA 2ZBKA 2FEZA 3Q9VA 2F2EA 2WWYA 2X6WA 2STTA 1FMWA 1WJEA 2EZKA 3PO3J 1MMNA 4KA4A 3RIRA 5BPDA 1Y0UA 3GBGA 4CYDA 1BJZA 1REPC 3OYBA 2JQ7A 5KK1A 3QPHA 5AONA 3F22A 1YTYA 4LLNA 2E19A 2DQLA 2BYVE 1SVOA 3MKLA 2GXGA 3TO9A 1FOXA 2BY1A 1R5HA 1RRJA 3DU5A 1U5TA 2CUEA 1BOBA 1D0XA 2CW8A 3CCMI 3MN2A 2YSRA 1U5TC 3E7LA 5ILVA 2XC7A 1ZAOA 5HNHA 1H88C 1MNDA 3VODA 3QOEA 3JTHA 4LB6B 3MKYB 3VPRA 3HOTA 4ON0A 3Q5FA 3S1MJ 3SHFA 4Y52J 2JUGA 4BJTA 4HF2A 3KYCB 2BV6A 3KLOA 1Q1VA 3P5JA 3SFZA 5GADJ 2DPUA 3QYEA 1SFOJ 2RQQA 1CQTA 4A3BJ 2ETHA 3BLYA 3HJEA 2G7UA 1YJNI 1IRXA 4XK4A 2GXAA 2XV4S 3OV8A 1Z91A 1WJDA 4A3LJ 1FMVA 2HXOA 3JSPA 4A3MJ 2FQ4A 2XAGA 3LWFA 5IT9R 2QSGX 2H8WA 4I09A 1HLVA 1BA5A 4UVBA 3ZQIA 1USSA 2ZB9A 3AL0B 1TQIA 2GZWA 1IO2A 3K4LA 3CJTB 2JPCA 3M8EA 4OAYA 5GAEJ 3J81K 2MA3A 1ZKGA 1W36C 1H9TA 3K69A 2CWEA 3CMEI 1E3PA 1B59A 3CESA 5E20A 2P7VB 2Q0OA 2ELHA 4V2FA 4XORA 2FE3A 3K2ZA 3PUBA 4CICA 2HI3A 2K27A 1FBSA 1R7JA 2X85A 4KUMA 2VUMJ 2L4MA 5H6QA 4YIRX 3IH3A 3MWMA 3TOAA 1R1TA 1S7OA 5ILUA 1YYVA 3P7NA 4FX4A 3GLLA 2V9PA 1G59A 3DFGA 1KQ8A 1VQ8I 2X98A 3DF8A 4RS8A 4L9TA 5CJ9A 1MBHA 5FD5A 3HOSA 1FTTA 2VPRA 2OUMA 3WG9A 1A04A 2FSWA 3E5QA 2QLZA 2NAZA 2H1LA 2M3AA 3S93A 4U7DA 2COBA 3GUDA 2DMQA 2XF7A 2ZSHB 2H8RA 3M1EA 1KYWA 1U9OA 3QQAA 3AG4H 1VQ9I 4H4KC 4Y13A 1KA8A 1ETXA 2F5CA 4A69C 3PO2J 1Z6RA 3GCMA 3NARA 3BJ6A 3IV5A
chains in the Genus database with same CATH topology
3ROUA 4IJAA 3R0JA 1KQ0A 4PGHA 3G3ZA 5LEJA 4QWQA 2O61A 1ZH5A 1IUYA 1XGOA 4Q5SF 4MEXF 1O7LA 3CUOA 2HQNA 3FZVA 4IHTA 2EWNA 1RNLA 3IHUA 3I0TA 3HRUA 2NRAC 4L9VA 1FSHA 3TDUC 2FMLA 5H20A 3QAHA 2QZ8A 2V79A 3J80Z 1HKTA 2Z99A 1HW1A 2M87A 1YQAA 4HX7A 1I6XA 5DEQA 3RPUA 5FFZA 4O6JA 2XGXA 2XAQA 2HKXA 4ESBA 1USTA 1FNNA 4CHUA 4WK8F 1Z6TA 2WTEA 1SD6A 4GO1A 2VC0A 5LHIA 2EA2A 2HOEA 1LDJA 1I1GA 1ZN2A 1JXSA 4L5IA 1G4DA 1G3TA 2IJLA 1U8RA 4LB5A 3K1MA 3WE2A 3VEPA 1D8KA 4FT8A 4G6QA 1ZG5A 1E17A 1IN6A 2DK8A 1RZ4A 5TRDA 2COMA 3LAJA 2JSCA 5FLXZ 1YO5C 2LF7A 5CVIA 3JAMK 3W6JB 3GFIA 4RB3C 3KP5A 3I5UA 2M5WA 2VE9A 2KRFA 4NB5A 2L3DA 1Z05A 3WU1B 2M8EA 1ULYA 2JRTA 1J5YA 1HSTA 3N97A 4I01A 2ISYA 1QZZA 3JW4A 3FHZA 4OIOF 3U2RA 1PDNC 3RI4A 4ENKA 1HBXG 4N9IA 2JPBA 5LEKA 4ETSA 5J8CA 3E6CC 2OZUA 1IAWA 3ABUA 1EH7A 1TQPA 2VE8A 3SZTA 3QOPA 5DDGA 3RJPA 1W5SA 4XRFA 4HQMA 4MQ9F 4EJUA 1IW7F 5D8KB 3H92A 3D0SA 4BH9A 3O2PE 3F3XA 4NHJA 1BIAA 1RUNA 4G8XA 1U78A 3WTZA 2DI3A 1FPQA 1UCRA 2H6BA 1GXPA 5ERIA 5DCFA 1MDMB 1K78B 4L9NA 1FT9A 1SMYF 1TNTA 3ULQB 1UHMA 4AVPA 2A68F 1HKSA 2STWA 3C1DA 4LK0F 3DP7A 1LJ9A 5CYVA 4EJWA 2C6YA 1QGPA 1YG2A 4LFUA 2CGPA 1RIOH 1H0MA 1MDMA 2IA0A 1K78A 2FOKA 1YLFA 2RVCA 5E1XA 2MLGA 4L18B 5LLQA 2K02A 2NNNA 2Y75A 2IVMA 3FXRA 2EB7A 1T2KA 5DYMA 2P4WA 4ENMA 2OU2A 4Q48A 1KGSA 4A5MA 4EM0B 1FP1D 3GYHX 4OINF 2EFPA 4RGSA 3W6KB 3EYYA 1EV7A 3H3ZA 1O57A 5F64A 2ACJA 1P4WA 2QM3A 1ZGJA 5AIPA 1B1BA 4KIFA 2P5LC 2IRFG 1ZYRF 1MZBA 3BPXA 2R7DA 2XUBA 3FMQA 5L3EA 1I5ZA 3VOEA 1ZREA 2B0LA 4CO8A 3TO6A 5D6FA 3HIFA 1UB9A 5LHHA 4LG0B 2F5DA 2LNBA 2HTJA 2RQPA 2KIUA 1F9NA 2Q8KA 3GF2A 1S3JA 4ZYGA 5HDNA 2ESNA 1LVAA 4UVAA 2FA5A 4KNYA 4HA8A 2GQQA 5HLHA 1HW2A 5D8LB 4UNOA 3ZMTA 2MH2A 3ML6A 3KFWX 2QBYB 3C3WA 3B02A 1BI1A 4AIKA 2EFQA 1CF7B 4ZZLA 4AIHA 2RC4A 3KP4A 5HDKA 5JVTA 1V3FA 2LSOA 2FXAA 5BS6A 3GFMA 3LSTA 3PQKA 1G3SA 2OZ6A 2CFXA 4KDPA 2BGCA 2X4HA 2IW5A 3E6BA 5LRRA 3PQJA 4KMUX 5BMZA 1YW9A 1SD5A 5HDGA 1YIOA 2HZTA 3TGNA 1P4AA 2QQ9A 3GWZA 4GYGA 2Z3YA 3FXUA 4B09A 5DUKA 4KIBA 1JHHA 1PP7U 1FZPB 2IA2A 2QYOA 4UUVA 4ZYDA 4HLYA 3GFJA 1IRFA 1FLIA 4XLNF 5H6RA 3AAFA 1TW3A 3E6MA 4ESFA 3BROA 5JFRA 4MTDA 4KMFA 4WXHA 4WX9A 2VBWA 2XKPA 3V7RA 2HTSA 4M6YA 4GCVA 4S04A 2CW0F 1FBUA 4IRIA 1L0OC 1IXRC 1FWZA 4HX4A 3HHHA 3IKVA 4ZZDA 4HDUA 1OYYA 3COAC 3GZ5A 1S8NA 3I59A 1W7PD 5J6XA 6PAXA 1SMTA 1U5TB 1IN8A 2H94A 4PZJA 1SFEA 3KEOA 2RV8A 2VT3A 3B73A 2ZKZA 4HAMA 4UV9A 1JHFA 2M1BA 2MH9A 3BOQA 1D3YA 2KJCA 3KZZA 4A12A 5LBQA 3RKXA 4YFXF 4HF0A 5A2QZ 5ILSA 4RAYA 2TDXA 2P8TA 4HYEA 4LD5A 5HS9A 2FRHA 2XAFA 5D4SA 4HLXA 3RKWA 2RGVA 1WWXA 2HR3A 4P5OA 3M8FA 2Q2EA 2W85A 1OR7A 3L00A 4M9ZA 4BHPA 4HZFA 1S6LA 5L3CA 2PMHA 3DPTA 3L7WA 2XKOA 2DPDA 3REOA 3ZMSA 3CLOA 4MNUA 2L4AA 4M9XA 4TV7A 3V8KA 4OMYA 4Q47A 2PG4A 3WGIA 2NNYA 1OYIA 3HRSA 4A0YA 2RDPA 3KZYA 2ZMEA 1J59A 3K9TA 2ZXJA 3T5XA 2HFHA 4L0YB 4WF2A 1TBXA 2W24A 2XASA 3C7JA 2EA4A 2DO7A 3EETA 1LQ1A 3NQOA 4LG0A 3ZMDA 1OPCA 4EQQA 1XMAA 2FQ3A 4HOBA 3IRQA 2VXZA 3P9CA 4N9HA 1MJAA 2FU4A 1HSJA 2J5OA 3WE3A 4I7HA 3RYRA 1H9GA 3SQNA 1J75A 4IHSA 5HOOA 2W84A 4GYIA 5D4RA 4WCGA 4O3MA 1AOYA 1R1UA 3I53A 1OMIA 2ZNYA 4ZYEA 1TTYA 3F8NA 1WSUA 2O6GE 1QO0D 5E18F 3L9FA 1ZARA 3E3VA 4M72A 1O7FA 4KICA 1SAXA 3VFZA 4F7ZA 1I27A 2LDUA 1JGSA 1BOAA 3EUHA 2V6CA 5L3DA 2CSOA 1TLHB 3EQLF 1S29A 2ZCWA 2D2WA 3TQNA 1DPRA 2GA2A 3JAMZ 4HV5A 3V7CA 2XAJA 4HV6A 1T39A 5ICFA 1XGMA 3BJAA 3HTUA 3O3KA 3ZQ7A 3F6VA 1ZRFA 1FX7A 4A0ZA 4OIPF 3R6SA 1GXQA 1ZRCA 2L01A 1IN4A 2OQRA 3ZPLA 1Q1HA 5E8IA 4HW0A 4BHCA 2A61A 5TJJA 2OQGA 2BE5F 4I0BA 2FNAA 3I54A 1KU2A 4A0XA 2Z5UA 3FMRA 5ICEA 1R5GA 1CF7A 3J7AO 3MAJA 3OOPA 3FXQA 5BQTA 1FYLA 5K1YA 3MFKA 3IKTA 2QENA 5FFXA 2O8XA 3F72A 3KP2A 3E5XA 1Z1DA 1DDNA 1IZ1A 1TQMA 2YX7A 1L3LA 1U2WA 4JK1X 4EJVA 3HTSB 1DUXC 3GO5A 4O5VA 1ODDA 1KU7A 2Y48A 3E6DA 2OA4A 3IWZA 2PN6A 1J9IA 2BBYA 4WXCA 2GA1A 4HDVA 4BQAA 3M9AA 4I98B 1W5TA 4IPAA 3U1DA 5D5WB 4N0BA 2A07F 2QUFA 5CVUA 5FO5A 3R60A 1XD7A 3RDIA 4YFNF 2UXXA 4OIQF 3ECHA 1ZG1A 5CVVA 4XLPF 1K7AA 2F5FA 4LJZF 4MGRA 1B6AA 2XIGA 4OU0A 3FX3A 5HVQC 1K79A 1HXDA 1EH8A 3ZP5A 3JTGA 1GHCA 3T1BA 4HQEA 2RNJA 1DP7P 4YG2F 2PBIA 4FHTA 2L54A 1YS6A 4ESJA 3F8BA 2AS5F 1XB4A 1F5TA 2GIVA 2NYXA 1XGSA 4JQFA 3DEUA 4A6EA 1O3SA 1LEAA 1X3UA 3RKYA 1ZG3A 4P96A 3LA7A 1QPMA 1P4XA 5FD6A 2MC3A 3V7SA 3K1PA 3R0AA 2X0LA 1MD0A 1FYMA 2UWMA 1LDKB 1G6NA 3F6OA 3WTSC 1HQCA 3BJOA 3FM5A 2ZO4A 4MHGA 4I0AA 1PP8F 1QQIA 2IA1A 4BAYA 4E70A 1IN5A 3D5LA 3KP7A 4JBAA 1XCBA 5D5UB 5J8FA 2UXNA 4LGWA 1U6GA 5BOXA 3Q9SA 2QBYA 2PJPA 5E1WA 1R22A 3F8CA 3QP5A 1R23A 5FB2A 1XCVA 4LLGF 4L5JA 2HYGD 5DD4A 4LK1F 3M7GA 1LB2A 2KKOA 3GFLA 4CXFA 2YU3A 1LEBA 2XVCA 2OD5A 3I59B 4P9FA 2FMYA 2E7WA 3IRRA 2KIFA 2PMUA 1SD4A 2M45A 2QVOA 4UHTA 3WTWC 4IF4A 4MTEA 4ENJA 1KU9A 1YW7A 4KT5C 3NEUA 5K5QA 1SFUA 4GGGA 3V4GA 3L09A 1MJ9A 4DNCA 5K5RA 2OAZA 5HS8A 3QP6A 3MEXA 3MZHA 5ICGA 3GLXA 1BC7C 1Z9CA 2P6TA 1FSEA 2UZKA 4WXDA 3LFKA 1YFHA 1BI2A 4P9UA 2Z33A 3SXYA 1B9MA 3FMSA 1W4MA 5F1RA 5FGMA 1FBQA 1G3YA 1NHAA 2O03A 3K0LA 2LF8A 2AXLA 2GAUA 4EMSA 3GVAA 3SZPA 1I1SA 5K5OA 5KVRA 3WODF 5L3FA 2FBIA 3KETA 1T38A 2KJBA 3BY6A 4G9YA 4M73A 2EV0A 1BIBA 4K2EA 3TDZC 2DT5A 1XDSA 2R3SA 1J2XA 4KFCA 3QU6A 3DV8A 4ASNA 2ZFWA 4AD9A 1FY7A 1XN7A 4I2OA 2K4JA 2VBZA 1WKMA 1ZLKA 3G73A 4IRGA 5AIQA 3I58A 3LAPA 2O3FA 1ZGAA 3J81Z 5L3GA 4RAZA 4M71A 4NQWA 1RI7A 4G94A 2CQKA 2YR2A 5BPIA 1R58A 2YX4A 5E8GA 4CZZA 2VT2A 3RYPA 4XBFA 1T98A 2MD5A 3MCZA 3LA2A 5E17F 4EV0A 2DU9A 1BJAA 1DPUA 3IC7A 3QRFF 4QLCU 2EFNA 4U7BA 1XSVA 5JR3A 4GXOA 3ABTA 3E97A 4U88A 1GVJA 4EM1A 4EGYA 5LGNA 5DCMA 3WGHA 1ZHFA 3DQVC 2DAOA 4BXUA 4G6DA 5CVJA 4IRHA 3KP3A 1J0RA 2YPRA 4U0VA 4BHBA 1TNSA 2HS5A 2A3SA 2Y0MA 3CTAA 4RGRA 3ECOA 1MGTA 3NRVA 1IRGA 3WTXC 2ZMEB 3F8MA 2VN2A 4HX8A 1ON1A 2QWWA 3J80K 3MQ0A 3EYIA 5HS7A 5D6EA 2V1UA 1T0FA 2G9WA 2ESHA 1OYWA 2XHKA 4XSZF 2V1DA 5A2QK 4YIIA 2PEXA 3WU0A 1AWCA 3MZYA 4RB2C 4LLLA 1D8JA 3HSRA 5HLGA 5HLIA 4MEYF 4CDGA 3VB2A 3BP8A 1FOKA 3CDHA 3V8LA 2E7XA 3KEQA 3E5UA 4XSXF 4PDKA 2PLYA 5FLXK 1ZRDA 4H0EA 2DBBA 4WWCA 1EH6A 1XGNA 4BYYA 3FF5A 2J5PA 1S7AA 4AWXB 1XMKA 1E2XA 2DLLA 2DK5A 4KN4X 1UHWA 5JHUA 3GX4X 4KYWA 5LGUA 3O6BB 4EGZA 2FBHA 1STZA 4MQVA 2QQBA 4HBLA 3ZN0A 4EVIA 4OOIA 3JSOA 1IXSB 3KCCA 3IWFA 4HF1A 3PFIA 2K86A 4ZH4F 3R61A 5L3BA 2XROA 4I02A 2JTVA 3WTVC 5DD8A 3DKWA 4R1HA 5DUIA 5LRSA 2A6EF 3BZ6A 3LQQA 2RKHA 1XSXA 3WTYC 5IT9K 2HKOA 3ISPA 1U3EM 3C18A 2OBPA 1PUEE 4ENNA 2MBFA 3ZMZA 2VOPA 2PFBA 2EFWA 3F23A 2G7HA 1Z7UA 1ONVA 4Z2YA 1IN7A 1D5VA 1R36A 1SD7A 4OMZA 4KIGA 1BN5A 2GXBA 3FM3A 1UFMA 1BM9A 1KQ9A 2H09A 1FP2A 3TO7A 3HUGA 3BPVA 2HGCA 3K1NA 4Q4ZF 4YFKF 1G3WA 4U0WA 2EK5A 1KU3A 3TKYA 3RPQA 5EEHA 1IXCA 1O3RA 2ZNZA 4L0ZB 3BDDA 1O3QA 1J7KA 1RUOA 1YW8A 1XDUA 3KE2A 1TW2A 1F1ZA 1LDDA 2K7LA 3RTRA 5IT3A 4CGZA 1C0WA 3CO7C 3WGGA 4Y17A 3T8RA 3I4PA 2EFOA 1MJBA 2H6CA 2P5VA 2R7FA 1CGPA 3CO6C 2H27A 2DTRA 2FNPA 4OIRF 2PI0A 4EJOA 4M9SA 4G7HF 2P6SA 2PQ8A 2D1VA 2D1HA 1VTNC 3GZ6A 1R00A 4ZYHA 1WI9A 2EV5A 3LA3A 3V8JA 5DV5A 2EJRA 2VONA 4IVNA 1FC3A 4DQ2A 2LKPA 2A5YB 2V9VA 4RB1A 3KP6A 3I64A 4P55A 2V1XA 5EEGA 2MLKA 2Z9OA 2F5EA 4UV8A 1P92A 4UXNA 5CVRA 3F21A 4PGGA 2IP2A 1WQ2A 2FF4A 1MKMA 2NS0A 3T0YA 2L02A 2QQAA 4S05A 2HQRA 1P2FA 2M30A 1OKRA 1T6SA 4G7OF 2VC1A 4BNCA 2O0YA 3R4KA 5LHGA 3GW2A 4B8XA 4FX0A 2VODA 4D0PA 2VBYA 3L2CA 3CUQC 2CO5A 3GXOA 1LNWA 1ZLJA 2BEOA 3HSFA 5ICCA 1F4KA 3DPLC 2GWRA 4L9JA 1JE8A 1W7PA 1R1VA 1HKQA 3U9GA 4A2UA 5F6FA 2RN7A 2P5KA 5LGTA 4R79A 3HHGA 2VOOA 3WTUC 1BI3A 2HEOA 2ADUA 3HRMA 1B9NA 5ED4A 3CJNA 3FWEA 3LQRA 1V4RA 2A6HF 5IT9Z 2CG4A 3KLNA 4UVCA 1W7PB 1HW5A 4KN7X 2HDCA 4A6DA 4A5NA 3GEZA 2EV6A 3F8FA 3ZN1A 3HRTA 4IXAA 3CUQB 3ZMVA 2IT0A 2K4BA 1BC8C 4R8HA 1O3TA 2JZYA 2DW4A 3BWGA 3HYIA 2DQRA 1IF1A 5D5VB 2D45A 5JI6A 2JT1A 1B4AA 1BI0A 3TOBA 3WTTC 1BBYA 4EJTA 1WRJA 4EM2A 2WC2A 3QU3A 4RB0A 4G7ZF 3CUQA 1KYZA 1FYKA 5DCMB 1K6OA 4M6XA 2KIMA 3HSEA 1QNTA 1XSDA 5E1ZB 3P9IA 3EDPA 2CYYA 3ELKA 1SFXA 2P7CB 3T8TA 1YS7A 3DXJF 2XRNA 2FBKA 3ZMUA 4AIJA 3ERED 2E1NA 1QZYA 2VBXA 2E1CA 3P9KA 2ZJ2A 3QPTA 3S2WA 4U0YA 3IL2A 1P6RA 2XAHA 2HYFA 3H3UA 2ISZA 1ON2A 2DFIA 5D5XB 2HWVA 1QBJA 4RGXA 5CLSA 4YIFA 3I71A 4PCQA 2W57A 2IPQX 4M74A 4LMYA 3N4MA 4RGUA 4Y15A 2W25A 2WV0A 2ZBKA 2FEZA 3Q9VA 2F2EA 2WWYA 2STTA 4KA4A 3RIRA 5BPDA 1Y0UA 4CYDA 1REPC 5KK1A 3QPHA 5AONA 3F22A 1YTYA 4LLNA 2DQLA 2BYVE 2GXGA 3TO9A 1R5HA 1U5TA 2YSRA 1U5TC 5ILVA 1ZAOA 3VODA 3JTHA 4LB6B 3HOTA 4ON0A 3Q5FA 3SHFA 4HF2A 2BV6A 3KLOA 2DPUA 3SFZA 2ETHA 2G7UA 2XV4S 3OV8A 1Z91A 3JSPA 2XAGA 3LWFA 4I09A 4UVBA 1USSA 1TQIA 2GZWA 2JPCA 3M8EA 3J81K 2MA3A 1H9TA 3K69A 2CWEA 1B59A 5E20A 2P7VB 2Q0OA 2ELHA 2FE3A 3K2ZA 4CICA 2K27A 1FBSA 1R7JA 4KUMA 2L4MA 5H6QA 3MWMA 3TOAA 1R1TA 1S7OA 5ILUA 1YYVA 3P7NA 4FX4A 3DFGA 1KQ8A 3DF8A 4RS8A 4L9TA 5CJ9A 5FD5A 3HOSA 3WG9A 1A04A 2FSWA 3E5QA 2QLZA 2NAZA 4U7DA 3GUDA 3M1EA 1KYWA 4Y13A 1KA8A 2F5CA 1Z6RA 2A69F 3BJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ROU A;  4IJA A;  3R0J A;  1KQ0 A;  4PGH A;  3G3Z A;  5LEJ A;  4QWQ A;  2O61 A;  1ZH5 A;  1IUY A;  1XGO A;  4Q5S F;  4MEX F;  1O7L A;  3CUO A;  2HQN A;  3FZV A;  4IHT A;  2EWN A;  1RNL A;  3IHU A;  3I0T A;  3HRU A;  2NRA C;  4L9V A;  1FSH A;  3TDU C;  2FML A;  5H20 A;  3QAH A;  2QZ8 A;  2V79 A;  3J80 Z;  1HKT A;  2Z99 A;  1HW1 A;  2M87 A;  1YQA A;  4HX7 A;  1I6X A;  5DEQ A;  3RPU A;  5FFZ A;  4O6J A;  2XGX A;  2XAQ A;  2HKX A;  4ESB A;  1UST A;  1FNN A;  4CHU A;  4WK8 F;  1Z6T A;  2WTE A;  1SD6 A;  4GO1 A;  2VC0 A;  5LHI A;  2EA2 A;  2HOE A;  1LDJ A;  1I1G A;  1ZN2 A;  1JXS A;  4L5I A;  1G4D A;  1G3T A;  2IJL A;  1U8R A;  4LB5 A;  3K1M A;  3WE2 A;  3VEP A;  1D8K A;  4FT8 A;  4G6Q A;  1ZG5 A;  1E17 A;  1IN6 A;  2DK8 A;  1RZ4 A;  5TRD A;  2COM A;  3LAJ A;  2JSC A;  5FLX Z;  1YO5 C;  2LF7 A;  5CVI A;  3JAM K;  3W6J B;  3GFI A;  4RB3 C;  3KP5 A;  3I5U A;  2M5W A;  2VE9 A;  2KRF A;  4NB5 A;  2L3D A;  1Z05 A;  3WU1 B;  2M8E A;  1ULY A;  2JRT A;  1J5Y A;  1HST A;  3N97 A;  4I01 A;  2ISY A;  1QZZ A;  3JW4 A;  3FHZ A;  4OIO F;  3U2R A;  1PDN C;  3RI4 A;  4ENK A;  1HBX G;  4N9I A;  2JPB A;  5LEK A;  4ETS A;  5J8C A;  3E6C C;  2OZU A;  1IAW A;  3ABU A;  1EH7 A;  1TQP A;  2VE8 A;  3SZT A;  3QOP A;  5DDG A;  3RJP A;  1W5S A;  4XRF A;  4HQM A;  4MQ9 F;  4EJU A;  1IW7 F;  5D8K B;  3H92 A;  3D0S A;  4BH9 A;  3O2P E;  3F3X A;  4NHJ A;  1BIA A;  1RUN A;  4G8X A;  1U78 A;  3WTZ A;  2DI3 A;  1FPQ A;  1UCR A;  2H6B A;  1GXP A;  5ERI A;  5DCF A;  1MDM B;  1K78 B;  4L9N A;  1FT9 A;  1SMY F;  1TNT A;  3ULQ B;  1UHM A;  4AVP A;  2A68 F;  1HKS A;  2STW A;  3C1D A;  4LK0 F;  3DP7 A;  1LJ9 A;  5CYV A;  4EJW A;  2C6Y A;  1QGP A;  1YG2 A;  4LFU A;  2CGP A;  1RIO H;  1H0M A;  1MDM A;  2IA0 A;  1K78 A;  2FOK A;  1YLF A;  2RVC A;  5E1X A;  2MLG A;  4L18 B;  5LLQ A;  2K02 A;  2NNN A;  2Y75 A;  2IVM A;  3FXR A;  2EB7 A;  1T2K A;  5DYM A;  2P4W A;  4ENM A;  2OU2 A;  4Q48 A;  1KGS A;  4A5M A;  4EM0 B;  1FP1 D;  3GYH X;  4OIN F;  2EFP A;  4RGS A;  3W6K B;  3EYY A;  1EV7 A;  3H3Z A;  1O57 A;  5F64 A;  2ACJ A;  1P4W A;  2QM3 A;  1ZGJ A;  5AIP A;  1B1B A;  4KIF A;  2P5L C;  2IRF G;  1ZYR F;  1MZB A;  3BPX A;  2R7D A;  2XUB A;  3FMQ A;  5L3E A;  1I5Z A;  3VOE A;  1ZRE A;  2B0L A;  4CO8 A;  3TO6 A;  5D6F A;  3HIF A;  1UB9 A;  5LHH A;  4LG0 B;  2F5D A;  2LNB A;  2HTJ A;  2RQP A;  2KIU A;  1F9N A;  2Q8K A;  3GF2 A;  1S3J A;  4ZYG A;  5HDN A;  2ESN A;  1LVA A;  4UVA A;  2FA5 A;  4KNY A;  4HA8 A;  2GQQ A;  5HLH A;  1HW2 A;  5D8L B;  4UNO A;  3ZMT A;  2MH2 A;  3ML6 A;  3KFW X;  2QBY B;  3C3W A;  3B02 A;  1BI1 A;  4AIK A;  2EFQ A;  1CF7 B;  4ZZL A;  4AIH A;  2RC4 A;  3KP4 A;  5HDK A;  5JVT A;  1V3F A;  2LSO A;  2FXA A;  5BS6 A;  3GFM A;  3LST A;  3PQK A;  1G3S A;  2OZ6 A;  2CFX A;  4KDP A;  2BGC A;  2X4H A;  2IW5 A;  3E6B A;  5LRR A;  3PQJ A;  4KMU X;  5BMZ A;  1YW9 A;  1SD5 A;  5HDG A;  1YIO A;  2HZT A;  3TGN A;  1P4A A;  2QQ9 A;  3GWZ A;  4GYG A;  2Z3Y A;  3FXU A;  4B09 A;  5DUK A;  4KIB A;  1JHH A;  1PP7 U;  1FZP B;  2IA2 A;  2QYO A;  4UUV A;  4ZYD A;  4HLY A;  3GFJ A;  1IRF A;  1FLI A;  4XLN F;  5H6R A;  3AAF A;  1TW3 A;  3E6M A;  4ESF A;  3BRO A;  5JFR A;  4MTD A;  4KMF A;  4WXH A;  4WX9 A;  2VBW A;  2XKP A;  3V7R A;  2HTS A;  4M6Y A;  4GCV A;  4S04 A;  2CW0 F;  1FBU A;  4IRI A;  1L0O C;  1IXR C;  1FWZ A;  4HX4 A;  3HHH A;  3IKV A;  4ZZD A;  4HDU A;  1OYY A;  3COA C;  3GZ5 A;  1S8N A;  3I59 A;  1W7P D;  5J6X A;  6PAX A;  1SMT A;  1U5T B;  1IN8 A;  2H94 A;  4PZJ A;  1SFE A;  3KEO A;  2RV8 A;  2VT3 A;  3B73 A;  2ZKZ A;  4HAM A;  4UV9 A;  1JHF A;  2M1B A;  2MH9 A;  3BOQ A;  1D3Y A;  2KJC A;  3KZZ A;  4A12 A;  5LBQ A;  3RKX A;  4YFX F;  4HF0 A;  5A2Q Z;  5ILS A;  4RAY A;  2TDX A;  2P8T A;  4HYE A;  4LD5 A;  5HS9 A;  2FRH A;  2XAF A;  5D4S A;  4HLX A;  3RKW A;  2RGV A;  1WWX A;  2HR3 A;  4P5O A;  3M8F A;  2Q2E A;  2W85 A;  1OR7 A;  3L00 A;  4M9Z A;  4BHP A;  4HZF A;  1S6L A;  5L3C A;  2PMH A;  3DPT A;  3L7W A;  2XKO A;  2DPD A;  3REO A;  3ZMS A;  3CLO A;  4MNU A;  2L4A A;  4M9X A;  4TV7 A;  3V8K A;  4OMY A;  4Q47 A;  2PG4 A;  3WGI A;  2NNY A;  1OYI A;  3HRS A;  4A0Y A;  2RDP A;  3KZY A;  2ZME A;  1J59 A;  3K9T A;  2ZXJ A;  3T5X A;  2HFH A;  4L0Y B;  4WF2 A;  1TBX A;  2W24 A;  2XAS A;  3C7J A;  2EA4 A;  2DO7 A;  3EET A;  1LQ1 A;  3NQO A;  4LG0 A;  3ZMD A;  1OPC A;  4EQQ A;  1XMA A;  2FQ3 A;  4HOB A;  3IRQ A;  2VXZ A;  3P9C A;  4N9H A;  1MJA A;  2FU4 A;  1HSJ A;  2J5O A;  3WE3 A;  4I7H A;  3RYR A;  1H9G A;  3SQN A;  1J75 A;  4IHS A;  5HOO A;  2W84 A;  4GYI A;  5D4R A;  4WCG A;  4O3M A;  1AOY A;  1R1U A;  3I53 A;  1OMI A;  2ZNY A;  4ZYE A;  1TTY A;  3F8N A;  1WSU A;  2O6G E;  1QO0 D;  5E18 F;  3L9F A;  1ZAR A;  3E3V A;  4M72 A;  1O7F A;  4KIC A;  1SAX A;  3VFZ A;  4F7Z A;  1I27 A;  2LDU A;  1JGS A;  1BOA A;  3EUH A;  2V6C A;  5L3D A;  2CSO A;  1TLH B;  3EQL F;  1S29 A;  2ZCW A;  2D2W A;  3TQN A;  1DPR A;  2GA2 A;  3JAM Z;  4HV5 A;  3V7C A;  2XAJ A;  4HV6 A;  1T39 A;  5ICF A;  1XGM A;  3BJA A;  3HTU A;  3O3K A;  3ZQ7 A;  3F6V A;  1ZRF A;  1FX7 A;  4A0Z A;  4OIP F;  3R6S A;  1GXQ A;  1ZRC A;  2L01 A;  1IN4 A;  2OQR A;  3ZPL A;  1Q1H A;  5E8I A;  4HW0 A;  4BHC A;  2A61 A;  5TJJ A;  2OQG A;  2BE5 F;  4I0B A;  2FNA A;  3I54 A;  1KU2 A;  4A0X A;  2Z5U A;  3FMR A;  5ICE A;  1R5G A;  1CF7 A;  3J7A O;  3MAJ A;  3OOP A;  3FXQ A;  5BQT A;  1FYL A;  5K1Y A;  3MFK A;  3IKT A;  2QEN A;  5FFX A;  2O8X A;  3F72 A;  3KP2 A;  3E5X A;  1Z1D A;  1DDN A;  1IZ1 A;  1TQM A;  2YX7 A;  1L3L A;  1U2W A;  4JK1 X;  4EJV A;  3HTS B;  1DUX C;  3GO5 A;  4O5V A;  1ODD A;  1KU7 A;  2Y48 A;  3E6D A;  2OA4 A;  3IWZ A;  2PN6 A;  1J9I A;  2BBY A;  4WXC A;  2GA1 A;  4HDV A;  4BQA A;  3M9A A;  4I98 B;  1W5T A;  4IPA A;  3U1D A;  5D5W B;  4N0B A;  2A07 F;  2QUF A;  5CVU A;  5FO5 A;  3R60 A;  1XD7 A;  3RDI A;  4YFN F;  2UXX A;  4OIQ F;  3ECH A;  1ZG1 A;  5CVV A;  4XLP F;  1K7A A;  2F5F A;  4LJZ F;  4MGR A;  1B6A A;  2XIG A;  4OU0 A;  3FX3 A;  5HVQ C;  1K79 A;  1HXD A;  1EH8 A;  3ZP5 A;  3JTG A;  1GHC A;  3T1B A;  4HQE A;  2RNJ A;  1DP7 P;  4YG2 F;  2PBI A;  4FHT A;  2L54 A;  1YS6 A;  4ESJ A;  3F8B A;  2AS5 F;  1XB4 A;  1F5T A;  2GIV A;  2NYX A;  1XGS A;  4JQF A;  3DEU A;  4A6E A;  1O3S A;  1LEA A;  1X3U A;  3RKY A;  1ZG3 A;  4P96 A;  3LA7 A;  1QPM A;  1P4X A;  5FD6 A;  2MC3 A;  3V7S A;  3K1P A;  3R0A A;  2X0L A;  1MD0 A;  1FYM A;  2UWM A;  1LDK B;  1G6N A;  3F6O A;  3WTS C;  1HQC A;  3BJO A;  3FM5 A;  2ZO4 A;  4MHG A;  4I0A A;  1PP8 F;  1QQI A;  2IA1 A;  4BAY A;  4E70 A;  1IN5 A;  3D5L A;  3KP7 A;  4JBA A;  1XCB A;  5D5U B;  5J8F A;  2UXN A;  4LGW A;  1U6G A;  5BOX A;  3Q9S A;  2QBY A;  2PJP A;  5E1W A;  1R22 A;  3F8C A;  3QP5 A;  1R23 A;  5FB2 A;  1XCV A;  4LLG F;  4L5J A;  2HYG D;  5DD4 A;  4LK1 F;  3M7G A;  1LB2 A;  2KKO A;  3GFL A;  4CXF A;  2YU3 A;  1LEB A;  2XVC A;  2OD5 A;  3I59 B;  4P9F A;  2FMY A;  2E7W A;  3IRR A;  2KIF A;  2PMU A;  1SD4 A;  2M45 A;  2QVO A;  4UHT A;  3WTW C;  4IF4 A;  4MTE A;  4ENJ A;  1KU9 A;  1YW7 A;  4KT5 C;  3NEU A;  5K5Q A;  1SFU A;  4GGG A;  3V4G A;  3L09 A;  1MJ9 A;  4DNC A;  5K5R A;  2OAZ A;  5HS8 A;  3QP6 A;  3MEX A;  3MZH A;  5ICG A;  3GLX A;  1BC7 C;  1Z9C A;  2P6T A;  1FSE A;  2UZK A;  4WXD A;  3LFK A;  1YFH A;  1BI2 A;  4P9U A;  2Z33 A;  3SXY A;  1B9M A;  3FMS A;  1W4M A;  5F1R A;  5FGM A;  1FBQ A;  1G3Y A;  1NHA A;  2O03 A;  3K0L A;  2LF8 A;  2AXL A;  2GAU A;  4EMS A;  3GVA A;  3SZP A;  1I1S A;  5K5O A;  5KVR A;  3WOD F;  5L3F A;  2FBI A;  3KET A;  1T38 A;  2KJB A;  3BY6 A;  4G9Y A;  4M73 A;  2EV0 A;  1BIB A;  4K2E A;  3TDZ C;  2DT5 A;  1XDS A;  2R3S A;  1J2X A;  4KFC A;  3QU6 A;  3DV8 A;  4ASN A;  2ZFW A;  4AD9 A;  1FY7 A;  1XN7 A;  4I2O A;  2K4J A;  2VBZ A;  1WKM A;  1ZLK A;  3G73 A;  4IRG A;  5AIQ A;  3I58 A;  3LAP A;  2O3F A;  1ZGA A;  3J81 Z;  5L3G A;  4RAZ A;  4M71 A;  4NQW A;  1RI7 A;  4G94 A;  2CQK A;  2YR2 A;  5BPI A;  1R58 A;  2YX4 A;  5E8G A;  4CZZ A;  2VT2 A;  3RYP A;  4XBF A;  1T98 A;  2MD5 A;  3MCZ A;  3LA2 A;  5E17 F;  4EV0 A;  2DU9 A;  1BJA A;  1DPU A;  3IC7 A;  3QRF F;  4QLC U;  2EFN A;  4U7B A;  1XSV A;  5JR3 A;  4GXO A;  3ABT A;  3E97 A;  4U88 A;  1GVJ A;  4EM1 A;  4EGY A;  5LGN A;  5DCM A;  3WGH A;  1ZHF A;  3DQV C;  2DAO A;  4BXU A;  4G6D A;  5CVJ A;  4IRH A;  3KP3 A;  1J0R A;  2YPR A;  4U0V A;  4BHB A;  1TNS A;  2HS5 A;  2A3S A;  2Y0M A;  3CTA A;  4RGR A;  3ECO A;  1MGT A;  3NRV A;  1IRG A;  3WTX C;  2ZME B;  3F8M A;  2VN2 A;  4HX8 A;  1ON1 A;  2QWW A;  3J80 K;  3MQ0 A;  3EYI A;  5HS7 A;  5D6E A;  2V1U A;  1T0F A;  2G9W A;  2ESH A;  1OYW A;  2XHK A;  4XSZ F;  2V1D A;  5A2Q K;  4YII A;  2PEX A;  3WU0 A;  1AWC A;  3MZY A;  4RB2 C;  4LLL A;  1D8J A;  3HSR A;  5HLG A;  5HLI A;  4MEY F;  4CDG A;  3VB2 A;  3BP8 A;  1FOK A;  3CDH A;  3V8L A;  2E7X A;  3KEQ A;  3E5U A;  4XSX F;  4PDK A;  2PLY A;  5FLX K;  1ZRD A;  4H0E A;  2DBB A;  4WWC A;  1EH6 A;  1XGN A;  4BYY A;  3FF5 A;  2J5P A;  1S7A A;  4AWX B;  1XMK A;  1E2X A;  2DLL A;  2DK5 A;  4KN4 X;  1UHW A;  5JHU A;  3GX4 X;  4KYW A;  5LGU A;  3O6B B;  4EGZ A;  2FBH A;  1STZ A;  4MQV A;  2QQB A;  4HBL A;  3ZN0 A;  4EVI A;  4OOI A;  3JSO A;  1IXS B;  3KCC A;  3IWF A;  4HF1 A;  3PFI A;  2K86 A;  4ZH4 F;  3R61 A;  5L3B A;  2XRO A;  4I02 A;  2JTV A;  3WTV C;  5DD8 A;  3DKW A;  4R1H A;  5DUI A;  5LRS A;  2A6E F;  3BZ6 A;  3LQQ A;  2RKH A;  1XSX A;  3WTY C;  5IT9 K;  2HKO A;  3ISP A;  1U3E M;  3C18 A;  2OBP A;  1PUE E;  4ENN A;  2MBF A;  3ZMZ A;  2VOP A;  2PFB A;  2EFW A;  3F23 A;  2G7H A;  1Z7U A;  1ONV A;  4Z2Y A;  1IN7 A;  1D5V A;  1R36 A;  1SD7 A;  4OMZ A;  4KIG A;  1BN5 A;  2GXB A;  3FM3 A;  1UFM A;  1BM9 A;  1KQ9 A;  2H09 A;  1FP2 A;  3TO7 A;  3HUG A;  3BPV A;  2HGC A;  3K1N A;  4Q4Z F;  4YFK F;  1G3W A;  4U0W A;  2EK5 A;  1KU3 A;  3TKY A;  3RPQ A;  5EEH A;  1IXC A;  1O3R A;  2ZNZ A;  4L0Z B;  3BDD A;  1O3Q A;  1J7K A;  1RUO A;  1YW8 A;  1XDU A;  3KE2 A;  1TW2 A;  1F1Z A;  1LDD A;  2K7L A;  3RTR A;  5IT3 A;  4CGZ A;  1C0W A;  3CO7 C;  3WGG A;  4Y17 A;  3T8R A;  3I4P A;  2EFO A;  1MJB A;  2H6C A;  2P5V A;  2R7F A;  1CGP A;  3CO6 C;  2H27 A;  2DTR A;  2FNP A;  4OIR F;  2PI0 A;  4EJO A;  4M9S A;  4G7H F;  2P6S A;  2PQ8 A;  2D1V A;  2D1H A;  1VTN C;  3GZ6 A;  1R00 A;  4ZYH A;  1WI9 A;  2EV5 A;  3LA3 A;  3V8J A;  5DV5 A;  2EJR A;  2VON A;  4IVN A;  1FC3 A;  4DQ2 A;  2LKP A;  2A5Y B;  2V9V A;  4RB1 A;  3KP6 A;  3I64 A;  4P55 A;  2V1X A;  5EEG A;  2MLK A;  2Z9O A;  2F5E A;  4UV8 A;  1P92 A;  4UXN A;  5CVR A;  3F21 A;  4PGG A;  2IP2 A;  1WQ2 A;  2FF4 A;  1MKM A;  2NS0 A;  3T0Y A;  2L02 A;  2QQA A;  4S05 A;  2HQR A;  1P2F A;  2M30 A;  1OKR A;  1T6S A;  4G7O F;  2VC1 A;  4BNC A;  2O0Y A;  3R4K A;  5LHG A;  3GW2 A;  4B8X A;  4FX0 A;  2VOD A;  4D0P A;  2VBY A;  3L2C A;  3CUQ C;  2CO5 A;  3GXO A;  1LNW A;  1ZLJ A;  2BEO A;  3HSF A;  5ICC A;  1F4K A;  3DPL C;  2GWR A;  4L9J A;  1JE8 A;  1W7P A;  1R1V A;  1HKQ A;  3U9G A;  4A2U A;  5F6F A;  2RN7 A;  2P5K A;  5LGT A;  4R79 A;  3HHG A;  2VOO A;  3WTU C;  1BI3 A;  2HEO A;  2ADU A;  3HRM A;  1B9N A;  5ED4 A;  3CJN A;  3FWE A;  3LQR A;  1V4R A;  2A6H F;  5IT9 Z;  2CG4 A;  3KLN A;  4UVC A;  1W7P B;  1HW5 A;  4KN7 X;  2HDC A;  4A6D A;  4A5N A;  3GEZ A;  2EV6 A;  3F8F A;  3ZN1 A;  3HRT A;  4IXA A;  3CUQ B;  3ZMV A;  2IT0 A;  2K4B A;  1BC8 C;  4R8H A;  1O3T A;  2JZY A;  2DW4 A;  3BWG A;  3HYI A;  2DQR A;  1IF1 A;  5D5V B;  2D45 A;  5JI6 A;  2JT1 A;  1B4A A;  1BI0 A;  3TOB A;  3WTT C;  1BBY A;  4EJT A;  1WRJ A;  4EM2 A;  2WC2 A;  3QU3 A;  4RB0 A;  4G7Z F;  3CUQ A;  1KYZ A;  1FYK A;  5DCM B;  1K6O A;  4M6X A;  2KIM A;  3HSE A;  1QNT A;  1XSD A;  5E1Z B;  3P9I A;  3EDP A;  2CYY A;  3ELK A;  1SFX A;  2P7C B;  3T8T A;  1YS7 A;  3DXJ F;  2XRN A;  2FBK A;  3ZMU A;  4AIJ A;  3ERE D;  2E1N A;  1QZY A;  2VBX A;  2E1C A;  3P9K A;  2ZJ2 A;  3QPT A;  3S2W A;  4U0Y A;  3IL2 A;  1P6R A;  2XAH A;  2HYF A;  3H3U A;  2ISZ A;  1ON2 A;  2DFI A;  5D5X B;  2HWV A;  1QBJ A;  4RGX A;  5CLS A;  4YIF A;  3I71 A;  4PCQ A;  2W57 A;  2IPQ X;  4M74 A;  4LMY A;  3N4M A;  4RGU A;  4Y15 A;  2W25 A;  2WV0 A;  2ZBK A;  2FEZ A;  3Q9V A;  2F2E A;  2WWY A;  2STT A;  4KA4 A;  3RIR A;  5BPD A;  1Y0U A;  4CYD A;  1REP C;  5KK1 A;  3QPH A;  5AON A;  3F22 A;  1YTY A;  4LLN A;  2DQL A;  2BYV E;  2GXG A;  3TO9 A;  1R5H A;  1U5T A;  2YSR A;  1U5T C;  5ILV A;  1ZAO A;  3VOD A;  3JTH A;  4LB6 B;  3HOT A;  4ON0 A;  3Q5F A;  3SHF A;  4HF2 A;  2BV6 A;  3KLO A;  2DPU A;  3SFZ A;  2ETH A;  2G7U A;  2XV4 S;  3OV8 A;  1Z91 A;  3JSP A;  2XAG A;  3LWF A;  4I09 A;  4UVB A;  1USS A;  1TQI A;  2GZW A;  2JPC A;  3M8E A;  3J81 K;  2MA3 A;  1H9T A;  3K69 A;  2CWE A;  1B59 A;  5E20 A;  2P7V B;  2Q0O A;  2ELH A;  2FE3 A;  3K2Z A;  4CIC A;  2K27 A;  1FBS A;  1R7J A;  4KUM A;  2L4M A;  5H6Q A;  3MWM A;  3TOA A;  1R1T A;  1S7O A;  5ILU A;  1YYV A;  3P7N A;  4FX4 A;  3DFG A;  1KQ8 A;  3DF8 A;  4RS8 A;  4L9T A;  5CJ9 A;  5FD5 A;  3HOS A;  3WG9 A;  1A04 A;  2FSW A;  3E5Q A;  2QLZ A;  2NAZ A;  4U7D A;  3GUD A;  3M1E A;  1KYW A;  4Y13 A;  1KA8 A;  2F5C A;  1Z6R A;  2A69 F;  3BJ6 A; 
#chains in the Genus database with same CATH topology
 3ROU A;  3ZQQ A;  4HRI A;  1RKW A;  4KIT B;  3M3Y J;  2E60 A;  4IJA A;  3R0J A;  3BT9 A;  3OIO A;  1KQ0 A;  2KZV A;  4ZC3 A;  4PGH A;  2JVG A;  4XKW A;  5KNL A;  3CDL A;  3G3Z A;  3VSL A;  5LEJ A;  2E5Z A;  4QWQ A;  3S1N J;  1OIS A;  2I5U A;  1NK3 P;  2O61 A;  1ZH5 A;  2IS4 A;  1IUY A;  1XGO A;  1ITY A;  2HU9 A;  4Q5S F;  4MEX F;  1O7L A;  3HGG A;  2MW8 A;  4B44 A;  3CC2 I;  5M3F J;  3CUO A;  2ZJR F;  3WHB A;  2HQN A;  2Y0S A;  3FZV A;  4DYR A;  4BUP A;  4IHT A;  1Z67 A;  2EWN A;  1GV2 A;  1RNL A;  3IHU A;  3K4J A;  1IV6 A;  1ACI A;  1JI8 A;  3I0T A;  3HRU A;  1D1C A;  2EIN H;  2NVU B;  2NRA C;  3NWT A;  4AC0 A;  2L2O A;  1HDP A;  4L9V A;  1IC8 A;  1FSH A;  3TDU C;  2GIZ A;  4PSW A;  3TBI A;  2FML A;  2M7B A;  3HOW J;  4XKV A;  5H20 A;  1R4M B;  3ASN H;  3QAH A;  3DLL F;  1V5G A;  1YE9 A;  2QZ8 A;  1T8I A;  2V79 A;  3J80 Z;  4IEJ A;  2V6E A;  1HKT A;  2Z99 A;  1HW1 A;  2M87 A;  1GLN A;  4KT6 A;  1YQA A;  4HX7 A;  1I6X A;  5DEQ A;  3A1Y A;  5M3M J;  3EUH C;  3RPU A;  5FFZ A;  4RM2 A;  4O6J A;  1WPK A;  2XGX A;  2XAQ A;  3TED A;  2HKX A;  4ESB A;  1UST A;  2QKM B;  1FNN A;  3M8J A;  3F9K A;  4CHU A;  4WK8 F;  2LP0 A;  3GZN B;  1MW7 A;  2IS1 A;  1Z6T A;  3DLA A;  3VYS B;  4DIQ A;  4ITV A;  2JJ7 A;  4XIC A;  2MVT A;  2WTE A;  1SD6 A;  4GO1 A;  2VC0 A;  1RET A;  2W82 A;  5LHI A;  2EA2 A;  5GP9 A;  2HOE A;  3WU2 C;  3HKZ A;  1LDJ A;  1I1G A;  1YX5 A;  1ZN2 A;  3EUA A;  3K4M A;  1JXS A;  4HST A;  4L5I A;  1EA3 A;  1UEL B;  1G4D A;  1TT0 A;  1OFC X;  2PX9 A;  1G3T A;  2LY9 A;  1SFK A;  2WBM A;  3BG9 A;  4KIS A;  1ZK8 A;  3G1L A;  2IJL A;  3GTQ J;  4IO9 F;  3HG9 A;  2EZI A;  3E0J B;  2K85 A;  2R5Z B;  1U8R A;  5GAG J;  4IKF A;  1R5I D;  2DT6 A;  2L9V A;  4LB5 A;  3K1M A;  3WE2 A;  3FIS A;  1W0U A;  3TP3 A;  1X3Z B;  3VEP A;  1D8K A;  2R92 J;  1R9T J;  4FT8 A;  4G6Q A;  1ZG5 A;  1E17 A;  1IN6 A;  2VKD A;  2KL4 A;  1XMX A;  2DK8 A;  1RZ4 A;  1OCC H;  3DWL E;  5TRD A;  2COM A;  3LAJ A;  2JSC A;  5FLX Z;  3OYC A;  1YO5 C;  2LF7 A;  3PSI A;  5CVI A;  4XLC A;  3W6J B;  3JAM K;  3GFI A;  1AA7 A;  1X4P A;  1I39 A;  4RB3 C;  2QGU A;  4HNU A;  2JA2 A;  3KP5 A;  2A6T A;  3I5U A;  3EUK L;  1R4N B;  2R4G A;  2M5W A;  2VE9 A;  3IH2 A;  2HVR A;  2EH3 A;  2KRF A;  4A93 J;  3VYU B;  4NB5 A;  4DJA A;  2L3D A;  2M2E A;  1Z05 A;  1JUS A;  3WU1 B;  2M8E A;  3AG2 H;  1ULY A;  2JRT A;  1OJL A;  1J5Y A;  1HST A;  2JRM A;  5J3L A;  3N97 A;  2LVS A;  3ZQF A;  3OSF A;  4I01 A;  3JCU C;  2ISY A;  3VSK A;  4QTR A;  1QZZ A;  3JW4 A;  4BDY A;  3FHZ A;  4OIO F;  3U2R A;  1PDN C;  4XR6 A;  3RI4 A;  3DEE A;  2JA5 J;  3BQY A;  4ENK A;  3PIP F;  1HBX G;  1S9H A;  3DCF A;  4N9I A;  2JPB A;  5LEK A;  1P7I A;  1UMQ A;  2A69 F;  1V54 H;  2XF6 A;  4CCL A;  4ETS A;  4E7J A;  2LMD A;  2VI6 A;  1MBJ A;  2BXY A;  4N4O B;  2QSH X;  5J8C A;  2K9M A;  3JRG A;  2ID6 A;  5HNF A;  3E6C C;  2OZU A;  1IAW A;  4LIU A;  5DM7 F;  3ABU A;  1EH7 A;  3Q0W A;  3MZ8 A;  1TQP A;  2VE8 A;  3SZT A;  2I8D A;  3QOP A;  4CCN A;  5DDG A;  1VQ4 I;  2M9H A;  2EZH A;  2EIL H;  3RJP A;  1W5S A;  4XRF A;  4HQM A;  2VIX A;  1ETY A;  2OPT A;  4MQ9 F;  1D5Y A;  4EJU A;  2MGQ A;  4UB8 C;  1IW7 F;  5D8K B;  3H92 A;  1SC7 A;  2QKL B;  3ABL H;  3D0S A;  1QZE A;  4BH9 A;  5HLT A;  4UUS B;  3D1N I;  3O2P E;  2VJ5 A;  3F3X A;  4W97 A;  4DBQ A;  1BIA A;  4NHJ A;  1RUN A;  4G8X A;  4HNT A;  1JKR C;  1U78 A;  3WTZ A;  2DI3 A;  2E2J J;  5IY5 H;  1FPQ A;  1UCR A;  2MFZ A;  2DYS H;  2DMT A;  2H6B A;  5ERI A;  5DCF A;  1MDM B;  3VDX A;  1GXP A;  1K78 B;  4L9N A;  1FT9 A;  1SMY F;  1TNT A;  3ULQ B;  2LTP A;  2CV1 A;  2P81 A;  1UHM A;  4AVP A;  2A68 F;  3G71 I;  1HKS A;  2STW A;  2LYC A;  3C1D A;  4LK0 F;  3VYT B;  3OL4 A;  2VQG A;  3DP7 A;  1OCO H;  1LJ9 A;  3LSK A;  1APL C;  2A5W A;  5CYV A;  2AQE A;  1K4T A;  2CQ7 A;  4A3E J;  1LVK A;  3OYJ A;  2XB5 A;  4EJW A;  4MFD A;  2R0Q C;  2C6Y A;  2EIM H;  1QGP A;  1YG2 A;  5B3S H;  4LFU A;  3KPH A;  2CGP A;  1WHU A;  1RIO H;  1H0M A;  2HOS A;  4PJN A;  1MDM A;  2IA0 A;  1K78 A;  2FOK A;  1YLF A;  2RVC A;  5EZH A;  5E1X A;  3I4N J;  5CQE A;  2MLG A;  3CCU I;  4L18 B;  3FXK A;  4J19 A;  3OIQ A;  5LLQ A;  2K02 A;  2NNN A;  2Y75 A;  2IVM A;  3FXR A;  2EB7 A;  5EG0 A;  2R5Z A;  1T2K A;  4FQG A;  2HVS A;  2NVT J;  2QQ8 A;  4YEL A;  5DYM A;  3K10 A;  2P4W A;  4ENM A;  3BR2 A;  2OU2 A;  4Q48 A;  1KGS A;  4A5M A;  4EM0 B;  3FBN B;  1FP1 D;  3GYH X;  4OIN F;  2HYJ A;  2EFP A;  4RGS A;  4AYB N;  3W6K B;  3EYY A;  1EV7 A;  3H3Z A;  1I6H J;  3LSG A;  1O57 A;  4C2T A;  3G4S I;  3OWT A;  5F64 A;  2ACJ A;  1P4W A;  2QM3 A;  1ZGJ A;  1X2N A;  3MKW B;  5B1B H;  5AIP A;  1B1B A;  4KIF A;  2HDD A;  2P5L C;  2IRF G;  1ETW A;  2MAB A;  4XNF A;  1ZYR F;  4XKB A;  1MZB A;  3BPX A;  2R7D A;  3OYA A;  2XUB A;  3FMQ A;  3OYK A;  5L3E A;  1I5Z A;  3VOE A;  1ZRE A;  2EPF A;  3I4M J;  1MSE C;  2B0L A;  4CO8 A;  3AKZ A;  2JA8 J;  3TO6 A;  4XID A;  4CCO A;  4J00 A;  5D6F A;  1D1A A;  3GTO J;  3HIF A;  2CJJ A;  1UB9 A;  2VJI A;  4LIT A;  4NDL A;  4QPO A;  5LHH A;  1RQ6 A;  4LG0 B;  2F5D A;  2LNB A;  2HTJ A;  3K2A A;  2RQP A;  3AFH A;  2VPL A;  3DU6 A;  1Z3Y A;  4XOT A;  3ESW B;  5HOD A;  2W00 A;  5IYC J;  2KIU A;  1F9N A;  1LUJ B;  2Q8K A;  3HOY J;  5TGT A;  3GF2 A;  1S3J A;  4RBO A;  4ZYG A;  5HDN A;  1NH3 A;  1OCP A;  2ESN A;  1LVA A;  3K4K A;  3W2A A;  2CFO A;  2FA5 A;  4UVA A;  4KNY A;  4HA8 A;  3KX2 A;  2GQQ A;  5HLH A;  3S1R J;  5D8L B;  1F36 A;  1ZGW A;  3ZMT A;  1HW2 A;  4UNO A;  1D1B A;  2MH2 A;  4IHW A;  1QU3 A;  3U21 A;  2TRT A;  2HVQ A;  3ML6 A;  3KFW X;  1B72 B;  3C3W A;  2QBY B;  3DTI A;  4A3K J;  2DA7 A;  3B02 A;  1PVE A;  2HPM A;  1BI1 A;  5F0H A;  4NQW B;  4Y7N J;  4AIK A;  2EFQ A;  1CF7 B;  4ZZL A;  4AIH A;  2RC4 A;  3J81 R;  4E4H A;  1X4O A;  4JOM A;  2Y30 A;  3FXO A;  3KP4 A;  5K7Z A;  3GTK J;  5HDK A;  1RES A;  5JVT A;  1V3F A;  2LSO A;  4PJ0 C;  2FXA A;  3VYR B;  5BS6 A;  5EG0 B;  3GFM A;  3LST A;  3PQK A;  1LE8 A;  4NUB A;  1YI2 I;  1G3S A;  2CW7 A;  1Y0N A;  2L9S A;  2OZ6 A;  2PJR B;  2VLA A;  2GLO A;  2CFX A;  5EJC A;  2BGC A;  4KDP A;  3H0G J;  2R7R A;  1V55 H;  2X4H A;  2K9Q A;  2M8G X;  2IW5 A;  3E6B A;  5LRR A;  5LFA A;  3ZQC A;  3OR1 C;  4XLE A;  3PQJ A;  1T0F C;  4KMU X;  5BMZ A;  1YW9 A;  1SD5 A;  2PMZ N;  4M3D A;  4NC6 A;  4GFB A;  5HDG A;  1T56 A;  1YIO A;  3HL2 A;  2HZT A;  3OR2 C;  3N05 A;  3TGN A;  1P4A A;  2DCE A;  5FRN A;  2QQ9 A;  5CKT A;  3JRH A;  1E0E A;  3GWZ A;  4B4C A;  1UJ8 A;  3HC7 A;  4GYG A;  1YHQ I;  2Z3Y A;  3FXU A;  3PNY A;  4JX6 A;  4B09 A;  3Q0V A;  2TCT A;  2L7Z A;  1I3A A;  5DUK A;  2KDO A;  4KIB A;  1TT5 B;  1JHH A;  2CS3 A;  4CCM A;  1PP7 U;  1FZP B;  2IA2 A;  2QYO A;  4UUV A;  5E3O A;  4LIV A;  1SVM A;  2FOW A;  2X48 A;  4ZYD A;  5F0F A;  4HLY A;  3GFJ A;  1IRF A;  4DW6 A;  5EGO A;  1FLI A;  2IS6 A;  4XLN F;  3BTI A;  5H6R A;  2NOG A;  1ENH A;  5FLM J;  3AAF A;  1TW3 A;  1HA8 A;  2KQR A;  1V5E A;  3E6M A;  4ESF A;  3BRO A;  1MIJ A;  5JFR A;  4MTD A;  4KMF A;  3C2G A;  2M34 A;  5GTI C;  4WXH A;  2R5Y A;  4WX9 A;  1VQ6 I;  2VBW A;  3CMA I;  3SJM A;  1DP3 A;  2Y69 H;  2XKP A;  3V7R A;  1IGN A;  2HTS A;  3DBR B;  3PL8 A;  4GCV A;  4M6Y A;  1KON A;  2HPI A;  1VQ7 I;  1KZH A;  4Y3O A;  4S04 A;  3G1O A;  2CW0 F;  1FBU A;  4IRI A;  1L0O C;  1IXR C;  2OV7 A;  1FWZ A;  4HX4 A;  3S14 J;  3HHH A;  1T08 B;  2R7T A;  3IKV A;  3KYD B;  4ZZD A;  4HDU A;  3KZI C;  2BY3 A;  1OYY A;  1J09 A;  1GT0 C;  1N78 A;  3COA C;  2EIK H;  3CCR I;  5H2F C;  3GZ5 A;  1S8N A;  3I59 A;  2ZXW H;  4CYC B;  1W7P D;  5J6X A;  6PAX A;  1Y56 A;  1HOM A;  1SMT A;  1U5T B;  2KP6 A;  2KPM A;  1RC9 A;  1IN8 A;  4B1R A;  4BJ5 C;  5GTH C;  2H94 A;  2ZXI A;  1SFE A;  3KEO A;  4PZJ A;  1ZEL A;  4IX7 A;  4MO7 A;  2QEX I;  3A0H C;  3K6G A;  3CF5 F;  2RV8 A;  5IYD J;  2VT3 A;  1JKQ C;  3B73 A;  3S8P A;  1JGG A;  1A35 A;  2ZKZ A;  4HAM A;  4AYB A;  2E34 A;  4UV9 A;  2R93 J;  3KIO A;  4PSX A;  1VZ0 A;  3BZC A;  1IDZ A;  1UG2 A;  2Y9Z A;  1JHF A;  2M1B A;  3A01 B;  2MH9 A;  3RQI A;  3BOQ A;  1D3Y A;  1WI3 A;  2KJC A;  3HGY A;  2DFE A;  3KZZ A;  4A12 A;  5LBQ A;  4E7I A;  3RKX A;  4YFX F;  4HF0 A;  4ANJ A;  5A2Q Z;  5ILS A;  5KHD A;  4RAY A;  3ZRG A;  3ZR8 X;  2TDX A;  4IOC F;  1FOY A;  1YRN A;  4S0H B;  1X58 A;  2P8T A;  4HYE A;  2F4I A;  2LBF A;  4LD5 A;  5HS9 A;  1P9Q C;  1BR1 A;  2FRH A;  2XAF A;  3HEF A;  3VWB A;  3BCA A;  1Z7L A;  5D4S A;  4HLX A;  3RKW A;  1AKH A;  2Z1D A;  2RGV A;  2DA3 A;  1WWX A;  2BW3 B;  2HR3 A;  3GTG J;  2OC6 A;  3PUF A;  4P5O A;  3M8F A;  2Q2E A;  2W85 A;  1VQO I;  1OR7 A;  1ERD A;  3L00 A;  1X19 A;  4M9Z A;  4BHP A;  4HZF A;  1B8I B;  1S6L A;  2QCO A;  2BHZ A;  2LY2 A;  1WJC A;  5L3C A;  2PMH A;  2ZME C;  3DPT A;  3L7W A;  4AU7 A;  2XKO A;  5CPR B;  2DPD A;  4EAT A;  4HSR A;  2GM4 A;  3REO A;  3ZMS A;  4YEJ A;  4X0G A;  3CLO A;  1BW5 A;  1S72 I;  4MNU A;  4ZDP A;  1IDY A;  3D5R C;  1FJL A;  2L4A A;  1QPI A;  4M9X A;  4TV7 A;  3H36 A;  3V8K A;  1NG6 A;  5F08 A;  3G6E I;  4OMY A;  4Q47 A;  2PG4 A;  3WGI A;  2NNY A;  3IAM 2;  1OYI A;  3PFY A;  2GOX B;  3HRS A;  2FJ1 A;  1WCM J;  2B7E A;  2RDP A;  3OMY A;  3KZY A;  4A0Y A;  2ZME A;  4CCJ A;  4GDF A;  3M4O J;  4ZYA A;  2XPW A;  1J59 A;  3K9T A;  2VXD A;  2ZXJ A;  3T5X A;  2JSP A;  2HFH A;  4L0Y B;  2L9R A;  3O8H A;  2M0C A;  2O9L A;  4WF2 A;  1BW6 A;  1Z77 A;  1TBX A;  2W24 A;  1YJW I;  1GUU A;  2XAS A;  3C7J A;  5IP7 J;  4UY8 I;  2MSY A;  2EA4 A;  2DO7 A;  1MBF A;  3EET A;  5IOZ A;  1DGR M;  1LQ1 A;  3CP8 A;  3H35 A;  3K4C A;  3TL4 X;  5IYB J;  4C30 A;  2IBD A;  4BEH B;  1AKH B;  3HDD A;  1K83 J;  3NQO A;  4LG0 A;  2UUZ A;  3ZMD A;  1OPC A;  3J7Z I;  3HM5 A;  2CV2 A;  1MMG A;  3ABM H;  2R7O A;  3BR3 A;  1WGX A;  2EBI A;  4EQQ A;  1XMA A;  2FQ3 A;  4II3 A;  4HOB A;  2VXZ A;  3IRQ A;  3P9C A;  4N9H A;  1MJA A;  2FU4 A;  1HSJ A;  1TC3 C;  2J5O A;  2KDZ A;  3WE3 A;  5LD2 C;  4I7H A;  2VKH A;  2MG4 A;  3RYR A;  5CQG A;  2OF7 A;  1Y1W J;  1H9G A;  3SQN A;  1J75 A;  1FIA A;  3LL7 A;  5J47 A;  1IJW C;  4IHS A;  5J40 A;  2WY7 Q;  5HOO A;  3S15 J;  2W84 A;  4GYI A;  2R5Y B;  2IS2 A;  5D4R A;  1ETV A;  4NNJ A;  5GPA A;  3J7A Y;  4WCG A;  4O3M A;  9ANT A;  3EPZ A;  1R1U A;  4C3I J;  1AOY A;  3I53 A;  1OMI A;  2NOJ B;  2ZNY A;  4ZYE A;  4CSW A;  3RSN A;  1TTY A;  2VQC A;  3B6C A;  3HZJ A;  3F8N A;  4DYC A;  1WSU A;  2O6G E;  1IRZ A;  3TW7 A;  1UG0 A;  1QO0 D;  5E18 F;  2DN0 A;  2JA7 J;  3L9F A;  1QVU A;  1JT6 A;  2WAD A;  1OR7 C;  1ZAR A;  4X6A J;  3E3V A;  4M72 A;  3ZQG A;  1O7F A;  4KIC A;  3OY9 A;  1SAX A;  3VFZ A;  1IG7 A;  3OIP A;  1W5C C;  4F7Z A;  3DKY A;  3L2U A;  1I27 A;  3L1P A;  2LDU A;  1JGS A;  1LFU P;  2E35 A;  3OSG A;  1BOA A;  3H5A A;  3EUH A;  2V6C A;  3IUO A;  1HCR A;  1MMA A;  5L3D A;  1K6Y A;  4HNV A;  2CSO A;  1TLH B;  3EQL F;  1S29 A;  2ZCW A;  4XON A;  2D2W A;  3TQN A;  2LK2 A;  1DPR A;  2GA2 A;  2LR8 A;  2X1C A;  3JAM Z;  2LFB A;  3I56 I;  1GDT A;  1VF9 A;  4HV5 A;  2WV1 A;  3V7C A;  2XAJ A;  2IAI A;  4HV6 A;  1WH7 A;  2RRE A;  1RPW A;  1T39 A;  5ICF A;  1QRY A;  1XGM A;  1N75 A;  3BJA A;  3HTU A;  3FKI J;  3O3K A;  3HB9 A;  3OYI A;  3ZQ7 A;  3F6V A;  2JN6 A;  2LKX A;  1S5L C;  1ZRF A;  1FX7 A;  4A0Z A;  4OIP F;  1B8I A;  1VQP I;  3R6S A;  1GXQ A;  2L01 A;  3CLQ A;  1ZRC A;  4XN0 A;  1IN4 A;  2NS8 A;  2OQR A;  3ZPL A;  4L5E A;  2Q2E B;  3W2V A;  2R7S A;  1Q1H A;  3BC8 A;  5E8I A;  2BW3 A;  4HW0 A;  3W2W A;  4BHC A;  4CYC A;  3L2W A;  4DBR A;  2A61 A;  5GAH J;  3GTP J;  5TJJ A;  3OYD A;  2LD5 A;  2OQG A;  2LG4 A;  2WAQ A;  1D0Y A;  2OCC H;  2BE5 F;  1VQL I;  1LFB A;  4I0B A;  1ZQ3 P;  2FNA A;  3I54 A;  1KU2 A;  4A0X A;  2Z5U A;  2K9N A;  3FMR A;  4XRM A;  4PFO A;  5ICE A;  3Q0U A;  3DTK A;  1R5G A;  1UZC A;  1CF7 A;  3J7A O;  3MAJ A;  3OOP A;  3M1C A;  3FXQ A;  5BQT A;  1FYL A;  5K1Y A;  3MFK A;  3IKT A;  2QEN A;  4KJZ A;  5FFX A;  3CCE I;  3I3L A;  2O8X A;  3A4C A;  2VQL A;  3F72 A;  3KP2 A;  3E5X A;  5F1J A;  1Z1D A;  4A3I J;  2XB0 X;  4E7H A;  1DDN A;  1IZ1 A;  1TQM A;  2YX7 A;  1M1E B;  1L3L A;  1U2W A;  4JK1 X;  4EJV A;  1OCT C;  3HTS B;  2BY2 A;  2DJI A;  1DUX C;  3GO5 A;  4AVZ A;  3FXM A;  4O5V A;  3S17 J;  1ODD A;  1ZR4 A;  4RAG A;  2HDW A;  4LG3 A;  1KU7 A;  2HOT A;  3RZO J;  2BXZ A;  2Y48 A;  3E6D A;  3FHN A;  2DA4 A;  4ZDL A;  1EF4 A;  3BQZ A;  1ORK A;  1WJ5 A;  2OA4 A;  3IWZ A;  2PN6 A;  2DA2 A;  1J9I A;  2BBY A;  4WXC A;  2YUS A;  2GA1 A;  1WFX A;  4HDV A;  4BQA A;  3M9A A;  5K7F A;  1Y8R B;  4I98 B;  1JKP C;  3J7Y J;  1W5T A;  4IPA A;  4UUS A;  1A31 A;  4DOZ A;  4XN3 A;  2MYS A;  3U1D A;  5D5W B;  4N0B A;  2A07 F;  2LC2 A;  2QUF A;  5CVU A;  5FO5 A;  2G0E A;  4C3J J;  5EDN A;  3R60 A;  3ZGK A;  3CMM A;  4D7M A;  1XD7 A;  3BR5 A;  2B9S A;  3RDI A;  4YFN F;  2UXX A;  3ECH A;  4OIQ F;  3HPG A;  3A02 A;  3J7A W;  3CZ6 A;  4E7S A;  1MBG A;  5IP9 J;  1AU7 A;  2M4G A;  1ZG1 A;  4C9Y A;  5CVV A;  2F6C A;  4XLP F;  1K7A A;  2F5F A;  4PFP A;  4LJZ F;  4MGR A;  1B6A A;  2XIG A;  4OU0 A;  5F0C A;  3FX3 A;  5HVQ C;  1K79 A;  1HXD A;  1Z3X A;  1EH8 A;  3FDY A;  3TP0 A;  5EGO B;  2CUZ A;  3O8G A;  3JTG A;  3ZP5 A;  1GHC A;  3T1B A;  4HQE A;  2RNJ A;  2V7F A;  1DP7 P;  4YG2 F;  1A6I A;  2E2H J;  2PBI A;  5JLX A;  4FHT A;  2L54 A;  2ME0 A;  1YS6 A;  4ESJ A;  2DA6 A;  3F8B A;  4OWR B;  3CF2 A;  2AS5 F;  1XB4 A;  4D5F A;  3H3V K;  1F5T A;  2GIV A;  4I76 A;  2NYX A;  3IAS 2;  1XGS A;  4JQF A;  3DEU A;  2L7F P;  5DTD A;  2BVL A;  4A6E A;  1O3S A;  4HPQ A;  4D9J A;  2X6Y A;  4OAZ A;  2WAQ N;  1LEA A;  1X3U A;  2DOA A;  3RKY A;  1ZG3 A;  5J1U A;  4P96 A;  3LA7 A;  4PJL A;  1SAN A;  1QPM A;  1W1W E;  2M0M A;  3LFU A;  1P4X A;  5FD6 A;  2MC3 A;  3V7S A;  4ZJZ A;  4DZP A;  3K1P A;  4ABZ A;  1HC8 A;  3R0A A;  2X0L A;  1MD0 A;  4V19 K;  2LKS A;  2VB6 A;  1P7J A;  3RQ4 A;  1FYM A;  3D5S C;  1YX3 A;  2UWM A;  1LDK B;  1G6N A;  3F6O A;  3WTS C;  1D0Z A;  3OL3 A;  2DMN A;  4XMY A;  1HQC A;  3BJO A;  2LRE A;  2ZJP F;  3UKG A;  3FM5 A;  2ZO4 A;  4MHG A;  4I6Z A;  1TZL A;  3OOU A;  4I0A A;  4F52 A;  4BE1 A;  2P0T A;  1PP8 F;  1EKE A;  2K9S A;  1QQI A;  2IA1 A;  3K70 C;  3QPS A;  4BAY A;  4E70 A;  1IN5 A;  3D5L A;  3KP7 A;  5K7H A;  5GPC A;  3UR3 C;  4JBA A;  1XCB A;  1T95 A;  5D5U B;  5J8F A;  2UXN A;  3GME A;  4FCY A;  3FXJ A;  4LGW A;  2ID3 A;  3OYG A;  3FBI B;  3U1K A;  3I55 I;  3CCV I;  1U6G A;  5BOX A;  2L7M P;  3Q9S A;  4RMN A;  1B72 A;  2QBY A;  2QA4 I;  2PJP A;  4W1U A;  5E1W A;  2R7V A;  1UHS A;  1MNE A;  1R22 A;  2ELK A;  4RAF A;  2CUF A;  4PK4 A;  3F8C A;  3QP5 A;  1R23 A;  5FB2 A;  1XCV A;  4LLG F;  4L5J A;  2HYG D;  3BR6 A;  5DD4 A;  4LK1 F;  3M7G A;  2K9L A;  1LB2 A;  2H1K A;  1O4X A;  2KKO A;  3GFL A;  4CXF A;  2YU3 A;  1LEB A;  2XVC A;  2OD5 A;  1I50 J;  4JYK A;  5EYR A;  3I59 B;  3LMM A;  1NG7 A;  2KT0 A;  4P9F A;  2FMY A;  1Y8Q B;  4JX5 A;  2E7W A;  3IRR A;  2CQN A;  2KIF A;  2PMU A;  4A3C J;  2BZT A;  1SD4 A;  2M45 A;  2QVO A;  2VQH A;  4UHT A;  3WTW C;  5J4Y A;  2F48 A;  4RA2 A;  4IF4 A;  4MTE A;  2KFD A;  2R7Q A;  4ENJ A;  1JJ8 C;  1KU9 A;  2RAE A;  4A3D J;  1YW7 A;  4KT5 C;  3NEU A;  5K5Q A;  1SFU A;  2Q1Z B;  4GGG A;  2ZC2 A;  5JHF A;  2XPV A;  3V4G A;  5KAF C;  3L09 A;  1MJ9 A;  1RR7 A;  4DNC A;  1U0J A;  3IP4 B;  3RPU D;  1E3O C;  2Y9Y A;  1G8X A;  3M07 A;  4HEA 2;  5K5R A;  2OAZ A;  2DDA A;  3TMO A;  5HS8 A;  3QP6 A;  3MEX A;  3MZH A;  2AXT C;  2W7N A;  5ICG A;  3GLX A;  1BC7 C;  1Z9C A;  1FEX A;  3LSR A;  1Y39 A;  1X1B A;  5IP6 A;  2P6T A;  2Z16 A;  4U87 A;  1FSE A;  2K3F A;  4II2 A;  2UZK A;  3JRE A;  4WXD A;  2VJJ A;  3LFK A;  1YFH A;  1VQM I;  1Y6I A;  2M4K A;  4XKC A;  3TW6 A;  1BI2 A;  4M6V A;  3F0C A;  4P9U A;  3SXY A;  2Z33 A;  3QPL A;  2IGK A;  2PJR A;  1B9M A;  3FMS A;  2WAF A;  1W4M A;  5F1R A;  3W3C A;  5E79 C;  2IGN A;  3SYT A;  5FGM A;  4CZC A;  1FBQ A;  3BG3 A;  1G3Y A;  1MH4 A;  1NHA A;  1ZTR A;  2O03 A;  3K0L A;  2XF5 A;  4F55 A;  2LF8 A;  3G2B A;  3SDB A;  1R71 A;  1W0T A;  1H89 C;  2AXL A;  2GAU A;  4EMS A;  2VJ4 A;  2X6X A;  3GVA A;  3W6V A;  3SZP A;  1I1S A;  1ETO A;  5K5O A;  3S3O A;  3OYH A;  2EZL A;  1V5F A;  2X9D A;  5KVR A;  3WOD F;  5L3F A;  2LOO A;  2FBI A;  3KET A;  3CC4 I;  2E1M B;  1T38 A;  2KJB A;  3BY6 A;  4G9Y A;  2KIS A;  2NVY J;  3KEY A;  3BZK A;  4M73 A;  2EV0 A;  3PNV A;  2V1N A;  2KMU A;  1BIB A;  1RKT A;  2QF7 A;  4K2E A;  1GV5 A;  3TDZ C;  3BTC A;  2DT5 A;  4UB6 C;  1XDS A;  2R3S A;  1J2X A;  4KFC A;  1MBK A;  3QU6 A;  4E7Z A;  1LFP A;  1QHH D;  4B43 A;  1TP4 A;  3DV8 A;  4ASN A;  2ZFW A;  2VKV A;  4AD9 A;  1HF0 A;  1FY7 A;  2OTL I;  3HOV J;  1XN7 A;  4I2O A;  2NVX J;  2DT7 B;  2K4J A;  2VBZ A;  2I10 A;  1WKM A;  1K61 A;  4FE4 A;  1ZLK A;  3ZQH A;  3G73 A;  1HDD C;  4IRG A;  1BR4 A;  4V2G A;  2HOA A;  2BVM A;  5AIQ A;  2V26 A;  2LLK A;  3I58 A;  1QVT A;  3LAP A;  2O3F A;  2JWT A;  3AG1 H;  1ZGA A;  3J81 Z;  3LSI A;  4I99 C;  1BR2 A;  5L3G A;  4RAZ A;  2OJE D;  5J4V A;  2FD5 A;  1VQN I;  4M71 A;  4NQW A;  1RI7 A;  4C2M J;  4BU2 A;  4G94 A;  3K70 D;  4D5C A;  3FK6 A;  2CQK A;  3JAM R;  1YJ9 I;  2YR2 A;  5BPI A;  1R58 A;  3E1S A;  2YX4 A;  3CCQ I;  2PMZ A;  2Y2Z A;  2BOL A;  5E8G A;  2XSJ C;  4CZZ A;  3FKJ A;  2VT2 A;  4DZJ A;  4GRI A;  3RYP A;  4XBF A;  3K4N A;  2R7X A;  4C3H J;  1X1C A;  5TIS C;  1T98 A;  4D1Q A;  2EIJ H;  2MD5 A;  2P0W A;  3MCZ A;  4F92 B;  3GTJ J;  5C4J J;  3LA2 A;  2CQQ A;  2N8G A;  5E17 F;  3H9J A;  4EV0 A;  2DU9 A;  1BJA A;  1DPU A;  3IC7 A;  3QRF F;  4QLC U;  2EFN A;  1XG1 A;  1VQK I;  5EEA A;  4U7B A;  2DXI A;  1XSV A;  1E3H A;  5JR3 A;  4GXO A;  2DA5 A;  2D5V A;  3ABT A;  3E97 A;  4U88 A;  1GVJ A;  4EM1 A;  4EGY A;  5LGN A;  5DCM A;  3WGH A;  1ZHF A;  4FET A;  3DQV C;  2DAO A;  1QHG A;  3CDI A;  4F3Q A;  1NK2 P;  2AQF A;  4FE7 A;  4BXU A;  2GOM A;  4G6D A;  5CVJ A;  4F91 B;  3HBL A;  2FX0 A;  2AHQ A;  2XSD C;  4IRH A;  1MBE A;  4BQQ A;  4J01 A;  4JP0 A;  4BEH A;  1JJ6 C;  3KP3 A;  4IHY A;  2W4S A;  1J0R A;  4ZTJ A;  2DOD A;  2YPR A;  4U0V A;  3OS1 A;  1TNS A;  4BHB A;  1DU0 A;  2HS5 A;  2A3S A;  3LSJ A;  2Y0M A;  3CTA A;  2K5C A;  1BL0 A;  2DFH A;  5J1R A;  4RGR A;  3ECO A;  2O7O A;  1MGT A;  3NRV A;  1IRG A;  3ONQ A;  2KZG A;  2KLO A;  3WTX C;  4P1W A;  3SFI A;  2ZME B;  3J80 R;  2E2I J;  3F8M A;  4IOA F;  2B63 J;  2VN2 A;  2WA0 A;  1XPX A;  2ZXH A;  4HX8 A;  1ON1 A;  2V9K A;  3ERM A;  2DDB A;  1H8A C;  4A3F J;  2QWW A;  3A2K A;  3OYM A;  3J80 K;  3BCB A;  2DMU A;  4M3B A;  3MQ0 A;  3FXL A;  3EYI A;  2LH9 A;  2CU7 A;  2W1O A;  4CUG A;  5HS7 A;  3CCL I;  5D6E A;  1S7E A;  1R6R A;  4CCK A;  2V1U A;  1T0F A;  3MD2 A;  1YOV B;  1Z0X A;  2G9W A;  2DFF A;  2ESH A;  1OYW A;  2XHK A;  4XSZ F;  3CCJ I;  2V1D A;  5A2Q K;  4YII A;  2PEX A;  5E3L A;  4G6T B;  2IGM A;  3WU0 A;  2WB1 A;  5KCM A;  2M35 A;  4IQJ A;  4BY7 J;  2NS7 A;  4CH7 A;  1U9N A;  3DEW A;  1K4S A;  1AWC A;  1JKO C;  3H5R A;  5A2Q R;  2W48 A;  3L2Q A;  3MZY A;  3QWL A;  1YIJ I;  4RB2 C;  4A3J J;  5DM6 F;  4LLL A;  3PSF A;  2K40 A;  3L2R A;  1D8J A;  3SZG A;  3HSR A;  1WJF A;  5HLG A;  4FAS D;  2EQR A;  4JX4 A;  5FLV A;  3CQZ J;  3A01 A;  5HLI A;  4MEY F;  4N4N B;  4CDG A;  3H1C A;  3VB2 A;  1PUF B;  1Z21 A;  3BP8 A;  1MMD A;  2E36 A;  1FOK A;  3CDH A;  3AL0 C;  3V8L A;  2E7X A;  3QOD A;  3KEQ A;  4XLA A;  5B5E C;  3E5U A;  4XSX F;  3DKX A;  4PDK A;  2PLY A;  5FLX K;  2YS9 A;  3BR0 A;  3MMY B;  3HKZ N;  2CRG A;  1ZRD A;  4H0E A;  2DBB A;  1WJB A;  1TWA J;  4WWC A;  3BG6 A;  1EH6 A;  1XGN A;  5KAI C;  3SEQ A;  2F4M B;  3S3M A;  1MH3 A;  3HXL A;  1X1D A;  4BYY A;  2XGE A;  3FF5 A;  3A03 A;  5FKO A;  2NVQ J;  2CQX A;  2J5P A;  1S7A A;  4AWX B;  5FJ8 J;  1XMK A;  2HXI A;  2RNG A;  2VAS A;  1E2X A;  1XTA A;  1NTC A;  1OCR H;  2BHY A;  2KIQ A;  5B1A H;  1DU6 A;  2DLL A;  2DK5 A;  5M5W J;  3JRI A;  4KN4 X;  1UHW A;  5JHU A;  2LRD A;  3OYF A;  3GX4 X;  4KYW A;  5FRO A;  5LGU A;  3FIW A;  3FK7 A;  3O6B B;  2CUJ A;  4EGZ A;  3A0B C;  2XGD A;  2FBH A;  5BNG A;  1STZ A;  1LKX A;  4MQV A;  2DTZ A;  3CMY A;  2QQB A;  3DPU A;  4HBL A;  3ZN0 A;  2OTJ I;  2K3P A;  3BTL A;  4BL0 B;  4OOI A;  4EVI A;  3MVP A;  4BXF A;  3JSO A;  1IXS B;  2GBY A;  3KCC A;  4PUS A;  3IWF A;  4XRS A;  3PFI A;  4RM3 A;  3DTE A;  4HF1 A;  4NBQ A;  2K86 A;  4ZH4 F;  1GVD A;  5FRM A;  3R61 A;  4BBR J;  5L3B A;  2XRO A;  4I02 A;  1DGW Y;  2JTV A;  3WTV C;  5DD8 A;  4AUX A;  3DKW A;  4A3G J;  4R1H A;  2MUN A;  5DUI A;  5LRS A;  1YIT I;  2A6E F;  2WY8 Q;  3X2Q H;  2O5R A;  3BZ6 A;  3LQQ A;  1MNM C;  2RKH A;  1XSX A;  3JRF A;  3WTY C;  5IT9 K;  2HKO A;  1TWC J;  4XLH A;  2KHM A;  3ISP A;  3ABK H;  5JLW A;  3BTJ A;  3MKZ A;  1U3E M;  3C18 A;  2OBP A;  4QPQ A;  1PUE E;  3PNT A;  1TL8 A;  1UAA A;  4ENN A;  2MBF A;  3AG3 H;  3ZMZ A;  2VOP A;  1TWG J;  2PFB A;  2CV0 A;  2E71 A;  2EFW A;  3F23 A;  2G7H A;  3WHC A;  1Z7U A;  1ONV A;  2UV1 A;  4Z2Y A;  1IN7 A;  4QSH A;  1D5V A;  1ETK A;  1R36 A;  2LY1 A;  3OYE A;  3A52 A;  4PJM A;  1SD7 A;  4XM3 A;  3ASO H;  4OMZ A;  1PJR A;  4KIG A;  1BN5 A;  2GXB A;  3FM3 A;  4HG2 A;  4XOP A;  1Y1V J;  2OCE A;  2L0K A;  1UFM A;  3K7A J;  1BM9 A;  1KQ9 A;  2JA6 J;  4D7N A;  2DOE A;  1MMS A;  2O8K A;  2Y31 A;  2H09 A;  5J1Y A;  1FP2 A;  4B48 A;  1OQY A;  2XAU A;  3TO7 A;  1DQU A;  3HUG A;  2DA1 A;  1WVR A;  3BPV A;  4MIM A;  4F93 B;  2HGC A;  4EEF G;  1N77 A;  1POG A;  3K1N A;  4Q4Z F;  1RR8 C;  4YFK F;  2HNH A;  4CA0 A;  2WB1 N;  5C3E J;  2LBF B;  4LOC A;  2CMP A;  1G3W A;  4U0W A;  4MFE A;  2EK5 A;  1KU3 A;  3TKY A;  4BJ6 C;  3RPQ A;  2WAE A;  2FUG 2;  1U8B A;  2MD0 A;  2V4J C;  5EEH A;  4BQN A;  4Z6Y A;  1IXC A;  1O3R A;  2ZNZ A;  1VFC A;  4L0Z B;  3BDD A;  1O3Q A;  4BE0 A;  1J7K A;  1RUO A;  2YU9 J;  5FLX R;  3OYL A;  1X3W B;  3JRB A;  1YW8 A;  1XDU A;  3KE2 A;  1XS9 A;  1TW2 A;  1F1Z A;  1LDD A;  2JVH A;  2K7L A;  3RTR A;  4E7K A;  3S3N A;  3V42 A;  5IT3 A;  3IH4 A;  3CD6 I;  4CGZ A;  3GTL J;  1C0W A;  3CO7 C;  3WGG A;  1X2M A;  3DBH B;  4Y17 A;  3T8R A;  3I4P A;  2EFO A;  1MJB A;  2H6C A;  2XRL A;  4NC7 A;  2CH0 A;  2P5V A;  2R7F A;  3WG7 H;  3LSH A;  3CO6 C;  1CGP A;  2DOF A;  3C2B A;  2H27 A;  2AO9 A;  3HPH A;  3I9V 2;  2DTR A;  2FNP A;  4OIR F;  2PI0 A;  4EJO A;  4M9S A;  1TWH J;  5B66 C;  4G7H F;  2HZD A;  2P6S A;  2X1D A;  3NAU A;  4Y33 A;  4BAC A;  2PQ8 A;  1VI0 A;  2D1V A;  3RCO A;  3LSP A;  4G12 A;  2D1H A;  5F04 A;  3QYF A;  1VTN C;  3L2V A;  3GZ6 A;  1R00 A;  4ZYH A;  1WI9 A;  2QSF X;  2EV5 A;  3LA3 A;  3V8J A;  1X1P A;  4BBS J;  5DV5 A;  2EJR A;  4E7L A;  2VON A;  2IGO A;  4Y4R A;  4IVN A;  1FC3 A;  3ZOB A;  4DQ2 A;  2KRC A;  2L9N A;  2A5Y B;  2LKP A;  2V9V A;  4RB1 A;  3KP6 A;  3I64 A;  4ZTF A;  4P55 A;  1JTY A;  2V1X A;  5EEG A;  2L7K A;  4B47 A;  2MLK A;  3PIO F;  5E3M A;  2Z9O A;  2F5E A;  1JT0 A;  4UV8 A;  1P92 A;  4UXN A;  5CVR A;  3CJR B;  3F21 A;  3H9Q A;  2XPU A;  4PGG A;  1PYV A;  2IP2 A;  1WQ2 A;  2HQ5 A;  2FF4 A;  1MKM A;  4BE2 A;  2NS0 A;  2E1O A;  3T0Y A;  2L02 A;  4E6K G;  2QQA A;  4S05 A;  1I3Q J;  3SDG A;  2HQR A;  1P2F A;  5DS9 A;  2M30 A;  1OKR A;  1SAU A;  1T6S A;  4G7O F;  2A05 A;  2VC1 A;  2ZJQ F;  5EZG A;  3CJQ B;  1EJ9 A;  4BNC A;  3H5N A;  2O0Y A;  2X6O A;  3R4K A;  4PJJ A;  2E5N A;  3CCY A;  5LHG A;  3GW2 A;  3S2H J;  4B8X A;  4FX0 A;  2L5Q A;  2VOD A;  4D0P A;  2VBY A;  4MLO A;  3K4B A;  3CUQ C;  3JRA A;  4NC8 A;  3L2C A;  5M5X J;  3S16 J;  1ETQ A;  2CO5 A;  2F4O B;  3GXO A;  3RKQ A;  4RLF A;  3G1M A;  2HQA A;  1LNW A;  1IUF A;  1ZLJ A;  2BEO A;  3HSF A;  5ICC A;  1F4K A;  3DPL C;  1VQ5 I;  3S2D J;  4IZZ A;  2M7A A;  2GWR A;  4L9J A;  4BGD A;  1JE8 A;  3BG7 A;  2R7Z J;  1W7P A;  4BXX J;  1R1V A;  1HKQ A;  1WH5 A;  3U9G A;  4A2U A;  5F6F A;  2R7U A;  1SVL A;  2RN7 A;  2E1M C;  4M3F A;  2P5K A;  3BR1 A;  5LGT A;  3JRC A;  3H9G A;  1MSF C;  4R79 A;  3Q3S A;  3HHG A;  2VOO A;  5E3N A;  1ZR2 A;  3WTU C;  1WJA A;  4IL6 C;  1BI3 A;  4XLF A;  1W36 D;  5F27 A;  2HEO A;  4BQO A;  1WZ2 A;  1F43 A;  2ADU A;  3HRM A;  1B9N A;  2BY0 A;  5ED4 A;  2ECC A;  3CJN A;  3FWE A;  2IXS A;  2KRH A;  3LQR A;  1V4R A;  2A6H F;  5IT9 Z;  1FTZ A;  4AM3 A;  2CG4 A;  3KLN A;  3GTM J;  4UVC A;  5C4X J;  2MZ4 A;  3H0D A;  1W7P B;  2ECB A;  2ICW G;  3BG5 A;  3LOC A;  5IOY A;  3UNG C;  3CC7 I;  1HW5 A;  3S32 A;  4KN7 X;  2HDC A;  1JUP A;  4YRV A;  4A6D A;  3LSM A;  1PUF A;  1XC5 A;  2XGC A;  4A5N A;  2X51 A;  3GEZ A;  4RLQ A;  1IV8 A;  2EV6 A;  3F8F A;  3ZN1 A;  4ZDO A;  1X1A A;  4M3E A;  3HRT A;  3ZXS A;  2Y0S N;  4IXA A;  3CUQ B;  1R49 A;  3ZMV A;  3SEZ A;  3CCS I;  1G2H A;  2Z2S B;  2IT0 A;  2K4B A;  3OS0 A;  1BC8 C;  4R8H A;  3PJR A;  4B3X A;  4BS9 A;  1O3T A;  2JZY A;  2DYR H;  2ELJ A;  4BKX A;  4C2U A;  2VKE A;  2DW4 A;  3BWG A;  3HYI A;  3HOZ J;  2DQR A;  1IF1 A;  1OLT A;  5D5V B;  2D45 A;  1XX5 A;  5JI6 A;  2JT1 A;  1B4A A;  1BI0 A;  3TOB A;  3WTT C;  1BBY A;  2IEK A;  3C2H A;  4FIS A;  4B3A A;  5FKN A;  5FKK A;  1AHD P;  1LE8 B;  2X1E A;  2JUC A;  2ME6 A;  4EJT A;  1WRJ A;  4EM2 A;  4FTH A;  2WC2 A;  3JR9 A;  3QU3 A;  4RB0 A;  4G7Z F;  4DYQ A;  5IPA A;  5JVG F;  3CUQ A;  1TWF J;  1KYZ A;  1FYK A;  5DCM B;  5FKM A;  1K6O A;  4M6X A;  4XL9 A;  2KIM A;  5EF6 A;  1SEU A;  2ZSI B;  3HSE A;  1QNT A;  1XSD A;  1A36 A;  4BDZ A;  2ZFU A;  5E1Z B;  5C44 J;  3P9I A;  3EDP A;  2CYY A;  3ELK A;  1SFX A;  2P7C B;  3T8T A;  3LNQ A;  3PM1 A;  4RDU A;  1YS7 A;  1FOW A;  3DXJ F;  1A6Q A;  1N25 A;  2DMP A;  2XRN A;  2FBK A;  4X1E A;  1JUM A;  5FKL A;  3ZMU A;  4AIJ A;  3HOU J;  3ERE D;  2E1N A;  1QZY A;  3HUG B;  1LPQ A;  2VBX A;  4DGW B;  2E1C A;  3P9K A;  5M5Y J;  4BY1 J;  2MC4 A;  2ZJ2 A;  3QPT A;  4UUT A;  3S2W A;  4U0Y A;  1T33 A;  2DJN A;  2JMW A;  1OCZ H;  3IL2 A;  3B6A A;  1P6R A;  1VND A;  1A5J A;  4QIW N;  4AID A;  2XAH A;  4M3G A;  1QA6 A;  2HYF A;  3H3U A;  2ISZ A;  3JRD A;  3HOX J;  1JTX A;  4IHV A;  1ON2 A;  2DFI A;  3OYN A;  2R7W A;  1YRN B;  3CP2 A;  5D5X B;  2HWV A;  3ZCO A;  1QBJ A;  4RGX A;  3RZD J;  5CLS A;  3NWS A;  4YIF A;  2JK3 A;  3DBL B;  3QYB A;  1FIP A;  2F5V A;  3I71 A;  4XQF A;  3OS2 A;  4PCQ A;  2W57 A;  4IHX A;  2IPQ X;  2XDV A;  3KYL A;  2VL8 A;  4M74 A;  2NXN B;  4LMY A;  3N4M A;  4IQ4 A;  4RGU A;  4Y15 A;  4XRS G;  3S1Q J;  2W25 A;  2WV0 A;  3ZQL A;  2ZBK A;  2FEZ A;  3Q9V A;  2F2E A;  2WWY A;  2X6W A;  2STT A;  1FMW A;  1WJE A;  2EZK A;  3PO3 J;  1MMN A;  4KA4 A;  3RIR A;  5BPD A;  1Y0U A;  3GBG A;  4CYD A;  1BJZ A;  1REP C;  3OYB A;  2JQ7 A;  5KK1 A;  3QPH A;  5AON A;  3F22 A;  1YTY A;  4LLN A;  2E19 A;  2DQL A;  2BYV E;  1SVO A;  3MKL A;  2GXG A;  3TO9 A;  1FOX A;  2BY1 A;  1R5H A;  1RRJ A;  3DU5 A;  1U5T A;  2CUE A;  1BOB A;  1D0X A;  2CW8 A;  3CCM I;  3MN2 A;  2YSR A;  1U5T C;  3E7L A;  5ILV A;  2XC7 A;  1ZAO A;  5HNH A;  1H88 C;  1MND A;  3VOD A;  3QOE A;  3JTH A;  4LB6 B;  3MKY B;  3VPR A;  3HOT A;  4ON0 A;  3Q5F A;  3S1M J;  3SHF A;  4Y52 J;  2JUG A;  4BJT A;  4HF2 A;  3KYC B;  2BV6 A;  3KLO A;  1Q1V A;  3P5J A;  3SFZ A;  5GAD J;  2DPU A;  3QYE A;  1SFO J;  2RQQ A;  1CQT A;  4A3B J;  2ETH A;  3BLY A;  3HJE A;  2G7U A;  1YJN I;  1IRX A;  4XK4 A;  2GXA A;  2XV4 S;  3OV8 A;  1Z91 A;  1WJD A;  4A3L J;  1FMV A;  2HXO A;  3JSP A;  4A3M J;  2FQ4 A;  2XAG A;  3LWF A;  5IT9 R;  2QSG X;  2H8W A;  4I09 A;  1HLV A;  1BA5 A;  4UVB A;  3ZQI A;  1USS A;  2ZB9 A;  3AL0 B;  1TQI A;  2GZW A;  1IO2 A;  3K4L A;  3CJT B;  2JPC A;  3M8E A;  4OAY A;  5GAE J;  3J81 K;  2MA3 A;  1ZKG A;  1W36 C;  1H9T A;  3K69 A;  2CWE A;  3CME I;  1E3P A;  1B59 A;  3CES A;  5E20 A;  2P7V B;  2Q0O A;  2ELH A;  4V2F A;  4XOR A;  2FE3 A;  3K2Z A;  3PUB A;  4CIC A;  2HI3 A;  2K27 A;  1FBS A;  1R7J A;  2X85 A;  4KUM A;  2VUM J;  2L4M A;  5H6Q A;  4YIR X;  3IH3 A;  3MWM A;  3TOA A;  1R1T A;  1S7O A;  5ILU A;  1YYV A;  3P7N A;  4FX4 A;  3GLL A;  2V9P A;  1G59 A;  3DFG A;  1KQ8 A;  1VQ8 I;  2X98 A;  3DF8 A;  4RS8 A;  4L9T A;  5CJ9 A;  1MBH A;  5FD5 A;  3HOS A;  1FTT A;  2VPR A;  2OUM A;  3WG9 A;  1A04 A;  2FSW A;  3E5Q A;  2QLZ A;  2NAZ A;  2H1L A;  2M3A A;  3S93 A;  4U7D A;  2COB A;  3GUD A;  2DMQ A;  2XF7 A;  2ZSH B;  2H8R A;  3M1E A;  1KYW A;  1U9O A;  3QQA A;  3AG4 H;  1VQ9 I;  4H4K C;  4Y13 A;  1KA8 A;  1ETX A;  2F5C A;  4A69 C;  3PO2 J;  1Z6R A;  3GCM A;  3NAR A;  3BJ6 A;  3IV5 A; 
#chains in the Genus database with same CATH homology
 3ROU A;  4IJA A;  3R0J A;  1KQ0 A;  4PGH A;  3G3Z A;  5LEJ A;  4QWQ A;  2O61 A;  1ZH5 A;  1IUY A;  1XGO A;  4Q5S F;  4MEX F;  1O7L A;  3CUO A;  2HQN A;  3FZV A;  4IHT A;  2EWN A;  1RNL A;  3IHU A;  3I0T A;  3HRU A;  2NRA C;  4L9V A;  1FSH A;  3TDU C;  2FML A;  5H20 A;  3QAH A;  2QZ8 A;  2V79 A;  3J80 Z;  1HKT A;  2Z99 A;  1HW1 A;  2M87 A;  1YQA A;  4HX7 A;  1I6X A;  5DEQ A;  3RPU A;  5FFZ A;  4O6J A;  2XGX A;  2XAQ A;  2HKX A;  4ESB A;  1UST A;  1FNN A;  4CHU A;  4WK8 F;  1Z6T A;  2WTE A;  1SD6 A;  4GO1 A;  2VC0 A;  5LHI A;  2EA2 A;  2HOE A;  1LDJ A;  1I1G A;  1ZN2 A;  1JXS A;  4L5I A;  1G4D A;  1G3T A;  2IJL A;  1U8R A;  4LB5 A;  3K1M A;  3WE2 A;  3VEP A;  1D8K A;  4FT8 A;  4G6Q A;  1ZG5 A;  1E17 A;  1IN6 A;  2DK8 A;  1RZ4 A;  5TRD A;  2COM A;  3LAJ A;  2JSC A;  5FLX Z;  1YO5 C;  2LF7 A;  5CVI A;  3JAM K;  3W6J B;  3GFI A;  4RB3 C;  3KP5 A;  3I5U A;  2M5W A;  2VE9 A;  2KRF A;  4NB5 A;  2L3D A;  1Z05 A;  3WU1 B;  2M8E A;  1ULY A;  2JRT A;  1J5Y A;  1HST A;  3N97 A;  4I01 A;  2ISY A;  1QZZ A;  3JW4 A;  3FHZ A;  4OIO F;  3U2R A;  1PDN C;  3RI4 A;  4ENK A;  1HBX G;  4N9I A;  2JPB A;  5LEK A;  4ETS A;  5J8C A;  3E6C C;  2OZU A;  1IAW A;  3ABU A;  1EH7 A;  1TQP A;  2VE8 A;  3SZT A;  3QOP A;  5DDG A;  3RJP A;  1W5S A;  4XRF A;  4HQM A;  4MQ9 F;  4EJU A;  1IW7 F;  5D8K B;  3H92 A;  3D0S A;  4BH9 A;  3O2P E;  3F3X A;  4NHJ A;  1BIA A;  1RUN A;  4G8X A;  1U78 A;  3WTZ A;  2DI3 A;  1FPQ A;  1UCR A;  2H6B A;  1GXP A;  5ERI A;  5DCF A;  1MDM B;  1K78 B;  4L9N A;  1FT9 A;  1SMY F;  1TNT A;  3ULQ B;  1UHM A;  4AVP A;  2A68 F;  1HKS A;  2STW A;  3C1D A;  4LK0 F;  3DP7 A;  1LJ9 A;  5CYV A;  4EJW A;  2C6Y A;  1QGP A;  1YG2 A;  4LFU A;  2CGP A;  1RIO H;  1H0M A;  1MDM A;  2IA0 A;  1K78 A;  2FOK A;  1YLF A;  2RVC A;  5E1X A;  2MLG A;  4L18 B;  5LLQ A;  2K02 A;  2NNN A;  2Y75 A;  2IVM A;  3FXR A;  2EB7 A;  1T2K A;  5DYM A;  2P4W A;  4ENM A;  2OU2 A;  4Q48 A;  1KGS A;  4A5M A;  4EM0 B;  1FP1 D;  3GYH X;  4OIN F;  2EFP A;  4RGS A;  3W6K B;  3EYY A;  1EV7 A;  3H3Z A;  1O57 A;  5F64 A;  2ACJ A;  1P4W A;  2QM3 A;  1ZGJ A;  5AIP A;  1B1B A;  4KIF A;  2P5L C;  2IRF G;  1ZYR F;  1MZB A;  3BPX A;  2R7D A;  2XUB A;  3FMQ A;  5L3E A;  1I5Z A;  3VOE A;  1ZRE A;  2B0L A;  4CO8 A;  3TO6 A;  5D6F A;  3HIF A;  1UB9 A;  5LHH A;  4LG0 B;  2F5D A;  2LNB A;  2HTJ A;  2RQP A;  2KIU A;  1F9N A;  2Q8K A;  3GF2 A;  1S3J A;  4ZYG A;  5HDN A;  2ESN A;  1LVA A;  4UVA A;  2FA5 A;  4KNY A;  4HA8 A;  2GQQ A;  5HLH A;  1HW2 A;  5D8L B;  4UNO A;  3ZMT A;  2MH2 A;  3ML6 A;  3KFW X;  2QBY B;  3C3W A;  3B02 A;  1BI1 A;  4AIK A;  2EFQ A;  1CF7 B;  4ZZL A;  4AIH A;  2RC4 A;  3KP4 A;  5HDK A;  5JVT A;  1V3F A;  2LSO A;  2FXA A;  5BS6 A;  3GFM A;  3LST A;  3PQK A;  1G3S A;  2OZ6 A;  2CFX A;  4KDP A;  2BGC A;  2X4H A;  2IW5 A;  3E6B A;  5LRR A;  3PQJ A;  4KMU X;  5BMZ A;  1YW9 A;  1SD5 A;  5HDG A;  1YIO A;  2HZT A;  3TGN A;  1P4A A;  2QQ9 A;  3GWZ A;  4GYG A;  2Z3Y A;  3FXU A;  4B09 A;  5DUK A;  4KIB A;  1JHH A;  1PP7 U;  1FZP B;  2IA2 A;  2QYO A;  4UUV A;  4ZYD A;  4HLY A;  3GFJ A;  1IRF A;  1FLI A;  4XLN F;  5H6R A;  3AAF A;  1TW3 A;  3E6M A;  4ESF A;  3BRO A;  5JFR A;  4MTD A;  4KMF A;  4WXH A;  4WX9 A;  2VBW A;  2XKP A;  3V7R A;  2HTS A;  4M6Y A;  4GCV A;  4S04 A;  2CW0 F;  1FBU A;  4IRI A;  1L0O C;  1IXR C;  1FWZ A;  4HX4 A;  3HHH A;  3IKV A;  4ZZD A;  4HDU A;  1OYY A;  3COA C;  3GZ5 A;  1S8N A;  3I59 A;  1W7P D;  5J6X A;  6PAX A;  1SMT A;  1U5T B;  1IN8 A;  2H94 A;  4PZJ A;  1SFE A;  3KEO A;  2RV8 A;  2VT3 A;  3B73 A;  2ZKZ A;  4HAM A;  4UV9 A;  1JHF A;  2M1B A;  2MH9 A;  3BOQ A;  1D3Y A;  2KJC A;  3KZZ A;  4A12 A;  5LBQ A;  3RKX A;  4YFX F;  4HF0 A;  5A2Q Z;  5ILS A;  4RAY A;  2TDX A;  2P8T A;  4HYE A;  4LD5 A;  5HS9 A;  2FRH A;  2XAF A;  5D4S A;  4HLX A;  3RKW A;  2RGV A;  1WWX A;  2HR3 A;  4P5O A;  3M8F A;  2Q2E A;  2W85 A;  1OR7 A;  3L00 A;  4M9Z A;  4BHP A;  4HZF A;  1S6L A;  5L3C A;  2PMH A;  3DPT A;  3L7W A;  2XKO A;  2DPD A;  3REO A;  3ZMS A;  3CLO A;  4MNU A;  2L4A A;  4M9X A;  4TV7 A;  3V8K A;  4OMY A;  4Q47 A;  2PG4 A;  3WGI A;  2NNY A;  1OYI A;  3HRS A;  4A0Y A;  2RDP A;  3KZY A;  2ZME A;  1J59 A;  3K9T A;  2ZXJ A;  3T5X A;  2HFH A;  4L0Y B;  4WF2 A;  1TBX A;  2W24 A;  2XAS A;  3C7J A;  2EA4 A;  2DO7 A;  3EET A;  1LQ1 A;  3NQO A;  4LG0 A;  3ZMD A;  1OPC A;  4EQQ A;  1XMA A;  2FQ3 A;  4HOB A;  3IRQ A;  2VXZ A;  3P9C A;  4N9H A;  1MJA A;  2FU4 A;  1HSJ A;  2J5O A;  3WE3 A;  4I7H A;  3RYR A;  1H9G A;  3SQN A;  1J75 A;  4IHS A;  5HOO A;  2W84 A;  4GYI A;  5D4R A;  4WCG A;  4O3M A;  1AOY A;  1R1U A;  3I53 A;  1OMI A;  2ZNY A;  4ZYE A;  1TTY A;  3F8N A;  1WSU A;  2O6G E;  1QO0 D;  5E18 F;  3L9F A;  1ZAR A;  3E3V A;  4M72 A;  1O7F A;  4KIC A;  1SAX A;  3VFZ A;  4F7Z A;  1I27 A;  2LDU A;  1JGS A;  1BOA A;  3EUH A;  2V6C A;  5L3D A;  2CSO A;  1TLH B;  3EQL F;  1S29 A;  2ZCW A;  2D2W A;  3TQN A;  1DPR A;  2GA2 A;  3JAM Z;  4HV5 A;  3V7C A;  2XAJ A;  4HV6 A;  1T39 A;  5ICF A;  1XGM A;  3BJA A;  3HTU A;  3O3K A;  3ZQ7 A;  3F6V A;  1ZRF A;  1FX7 A;  4A0Z A;  4OIP F;  3R6S A;  1GXQ A;  1ZRC A;  2L01 A;  1IN4 A;  2OQR A;  3ZPL A;  1Q1H A;  5E8I A;  4HW0 A;  4BHC A;  2A61 A;  5TJJ A;  2OQG A;  2BE5 F;  4I0B A;  2FNA A;  3I54 A;  1KU2 A;  4A0X A;  2Z5U A;  3FMR A;  5ICE A;  1R5G A;  1CF7 A;  3J7A O;  3MAJ A;  3OOP A;  3FXQ A;  5BQT A;  1FYL A;  5K1Y A;  3MFK A;  3IKT A;  2QEN A;  5FFX A;  2O8X A;  3F72 A;  3KP2 A;  3E5X A;  1Z1D A;  1DDN A;  1IZ1 A;  1TQM A;  2YX7 A;  1L3L A;  1U2W A;  4JK1 X;  4EJV A;  3HTS B;  1DUX C;  3GO5 A;  4O5V A;  1ODD A;  1KU7 A;  2Y48 A;  3E6D A;  2OA4 A;  3IWZ A;  2PN6 A;  1J9I A;  2BBY A;  4WXC A;  2GA1 A;  4HDV A;  4BQA A;  3M9A A;  4I98 B;  1W5T A;  4IPA A;  3U1D A;  5D5W B;  4N0B A;  2A07 F;  2QUF A;  5CVU A;  5FO5 A;  3R60 A;  1XD7 A;  3RDI A;  4YFN F;  2UXX A;  4OIQ F;  3ECH A;  1ZG1 A;  5CVV A;  4XLP F;  1K7A A;  2F5F A;  4LJZ F;  4MGR A;  1B6A A;  2XIG A;  4OU0 A;  3FX3 A;  5HVQ C;  1K79 A;  1HXD A;  1EH8 A;  3ZP5 A;  3JTG A;  1GHC A;  3T1B A;  4HQE A;  2RNJ A;  1DP7 P;  4YG2 F;  2PBI A;  4FHT A;  2L54 A;  1YS6 A;  4ESJ A;  3F8B A;  2AS5 F;  1XB4 A;  1F5T A;  2GIV A;  2NYX A;  1XGS A;  4JQF A;  3DEU A;  4A6E A;  1O3S A;  1LEA A;  1X3U A;  3RKY A;  1ZG3 A;  4P96 A;  3LA7 A;  1QPM A;  1P4X A;  5FD6 A;  2MC3 A;  3V7S A;  3K1P A;  3R0A A;  2X0L A;  1MD0 A;  1FYM A;  2UWM A;  1LDK B;  1G6N A;  3F6O A;  3WTS C;  1HQC A;  3BJO A;  3FM5 A;  2ZO4 A;  4MHG A;  4I0A A;  1PP8 F;  1QQI A;  2IA1 A;  4BAY A;  4E70 A;  1IN5 A;  3D5L A;  3KP7 A;  4JBA A;  1XCB A;  5D5U B;  5J8F A;  2UXN A;  4LGW A;  1U6G A;  5BOX A;  3Q9S A;  2QBY A;  2PJP A;  5E1W A;  1R22 A;  3F8C A;  3QP5 A;  1R23 A;  5FB2 A;  1XCV A;  4LLG F;  4L5J A;  2HYG D;  5DD4 A;  4LK1 F;  3M7G A;  1LB2 A;  2KKO A;  3GFL A;  4CXF A;  2YU3 A;  1LEB A;  2XVC A;  2OD5 A;  3I59 B;  4P9F A;  2FMY A;  2E7W A;  3IRR A;  2KIF A;  2PMU A;  1SD4 A;  2M45 A;  2QVO A;  4UHT A;  3WTW C;  4IF4 A;  4MTE A;  4ENJ A;  1KU9 A;  1YW7 A;  4KT5 C;  3NEU A;  5K5Q A;  1SFU A;  4GGG A;  3V4G A;  3L09 A;  1MJ9 A;  4DNC A;  5K5R A;  2OAZ A;  5HS8 A;  3QP6 A;  3MEX A;  3MZH A;  5ICG A;  3GLX A;  1BC7 C;  1Z9C A;  2P6T A;  1FSE A;  2UZK A;  4WXD A;  3LFK A;  1YFH A;  1BI2 A;  4P9U A;  2Z33 A;  3SXY A;  1B9M A;  3FMS A;  1W4M A;  5F1R A;  5FGM A;  1FBQ A;  1G3Y A;  1NHA A;  2O03 A;  3K0L A;  2LF8 A;  2AXL A;  2GAU A;  4EMS A;  3GVA A;  3SZP A;  1I1S A;  5K5O A;  5KVR A;  3WOD F;  5L3F A;  2FBI A;  3KET A;  1T38 A;  2KJB A;  3BY6 A;  4G9Y A;  4M73 A;  2EV0 A;  1BIB A;  4K2E A;  3TDZ C;  2DT5 A;  1XDS A;  2R3S A;  1J2X A;  4KFC A;  3QU6 A;  3DV8 A;  4ASN A;  2ZFW A;  4AD9 A;  1FY7 A;  1XN7 A;  4I2O A;  2K4J A;  2VBZ A;  1WKM A;  1ZLK A;  3G73 A;  4IRG A;  5AIQ A;  3I58 A;  3LAP A;  2O3F A;  1ZGA A;  3J81 Z;  5L3G A;  4RAZ A;  4M71 A;  4NQW A;  1RI7 A;  4G94 A;  2CQK A;  2YR2 A;  5BPI A;  1R58 A;  2YX4 A;  5E8G A;  4CZZ A;  2VT2 A;  3RYP A;  4XBF A;  1T98 A;  2MD5 A;  3MCZ A;  3LA2 A;  5E17 F;  4EV0 A;  2DU9 A;  1BJA A;  1DPU A;  3IC7 A;  3QRF F;  4QLC U;  2EFN A;  4U7B A;  1XSV A;  5JR3 A;  4GXO A;  3ABT A;  3E97 A;  4U88 A;  1GVJ A;  4EM1 A;  4EGY A;  5LGN A;  5DCM A;  3WGH A;  1ZHF A;  3DQV C;  2DAO A;  4BXU A;  4G6D A;  5CVJ A;  4IRH A;  3KP3 A;  1J0R A;  2YPR A;  4U0V A;  4BHB A;  1TNS A;  2HS5 A;  2A3S A;  2Y0M A;  3CTA A;  4RGR A;  3ECO A;  1MGT A;  3NRV A;  1IRG A;  3WTX C;  2ZME B;  3F8M A;  2VN2 A;  4HX8 A;  1ON1 A;  2QWW A;  3J80 K;  3MQ0 A;  3EYI A;  5HS7 A;  5D6E A;  2V1U A;  1T0F A;  2G9W A;  2ESH A;  1OYW A;  2XHK A;  4XSZ F;  2V1D A;  5A2Q K;  4YII A;  2PEX A;  3WU0 A;  1AWC A;  3MZY A;  4RB2 C;  4LLL A;  1D8J A;  3HSR A;  5HLG A;  5HLI A;  4MEY F;  4CDG A;  3VB2 A;  3BP8 A;  1FOK A;  3CDH A;  3V8L A;  2E7X A;  3KEQ A;  3E5U A;  4XSX F;  4PDK A;  2PLY A;  5FLX K;  1ZRD A;  4H0E A;  2DBB A;  4WWC A;  1EH6 A;  1XGN A;  4BYY A;  3FF5 A;  2J5P A;  1S7A A;  4AWX B;  1XMK A;  1E2X A;  2DLL A;  2DK5 A;  4KN4 X;  1UHW A;  5JHU A;  3GX4 X;  4KYW A;  5LGU A;  3O6B B;  4EGZ A;  2FBH A;  1STZ A;  4MQV A;  2QQB A;  4HBL A;  3ZN0 A;  4EVI A;  4OOI A;  3JSO A;  1IXS B;  3KCC A;  3IWF A;  4HF1 A;  3PFI A;  2K86 A;  4ZH4 F;  3R61 A;  5L3B A;  2XRO A;  4I02 A;  2JTV A;  3WTV C;  5DD8 A;  3DKW A;  4R1H A;  5DUI A;  5LRS A;  2A6E F;  3BZ6 A;  3LQQ A;  2RKH A;  1XSX A;  3WTY C;  5IT9 K;  2HKO A;  3ISP A;  1U3E M;  3C18 A;  2OBP A;  1PUE E;  4ENN A;  2MBF A;  3ZMZ A;  2VOP A;  2PFB A;  2EFW A;  3F23 A;  2G7H A;  1Z7U A;  1ONV A;  4Z2Y A;  1IN7 A;  1D5V A;  1R36 A;  1SD7 A;  4OMZ A;  4KIG A;  1BN5 A;  2GXB A;  3FM3 A;  1UFM A;  1BM9 A;  1KQ9 A;  2H09 A;  1FP2 A;  3TO7 A;  3HUG A;  3BPV A;  2HGC A;  3K1N A;  4Q4Z F;  4YFK F;  1G3W A;  4U0W A;  2EK5 A;  1KU3 A;  3TKY A;  3RPQ A;  5EEH A;  1IXC A;  1O3R A;  2ZNZ A;  4L0Z B;  3BDD A;  1O3Q A;  1J7K A;  1RUO A;  1YW8 A;  1XDU A;  3KE2 A;  1TW2 A;  1F1Z A;  1LDD A;  2K7L A;  3RTR A;  5IT3 A;  4CGZ A;  1C0W A;  3CO7 C;  3WGG A;  4Y17 A;  3T8R A;  3I4P A;  2EFO A;  1MJB A;  2H6C A;  2P5V A;  2R7F A;  1CGP A;  3CO6 C;  2H27 A;  2DTR A;  2FNP A;  4OIR F;  2PI0 A;  4EJO A;  4M9S A;  4G7H F;  2P6S A;  2PQ8 A;  2D1V A;  2D1H A;  1VTN C;  3GZ6 A;  1R00 A;  4ZYH A;  1WI9 A;  2EV5 A;  3LA3 A;  3V8J A;  5DV5 A;  2EJR A;  2VON A;  4IVN A;  1FC3 A;  4DQ2 A;  2LKP A;  2A5Y B;  2V9V A;  4RB1 A;  3KP6 A;  3I64 A;  4P55 A;  2V1X A;  5EEG A;  2MLK A;  2Z9O A;  2F5E A;  4UV8 A;  1P92 A;  4UXN A;  5CVR A;  3F21 A;  4PGG A;  2IP2 A;  1WQ2 A;  2FF4 A;  1MKM A;  2NS0 A;  3T0Y A;  2L02 A;  2QQA A;  4S05 A;  2HQR A;  1P2F A;  2M30 A;  1OKR A;  1T6S A;  4G7O F;  2VC1 A;  4BNC A;  2O0Y A;  3R4K A;  5LHG A;  3GW2 A;  4B8X A;  4FX0 A;  2VOD A;  4D0P A;  2VBY A;  3L2C A;  3CUQ C;  2CO5 A;  3GXO A;  1LNW A;  1ZLJ A;  2BEO A;  3HSF A;  5ICC A;  1F4K A;  3DPL C;  2GWR A;  4L9J A;  1JE8 A;  1W7P A;  1R1V A;  1HKQ A;  3U9G A;  4A2U A;  5F6F A;  2RN7 A;  2P5K A;  5LGT A;  4R79 A;  3HHG A;  2VOO A;  3WTU C;  1BI3 A;  2HEO A;  2ADU A;  3HRM A;  1B9N A;  5ED4 A;  3CJN A;  3FWE A;  3LQR A;  1V4R A;  2A6H F;  5IT9 Z;  2CG4 A;  3KLN A;  4UVC A;  1W7P B;  1HW5 A;  4KN7 X;  2HDC A;  4A6D A;  4A5N A;  3GEZ A;  2EV6 A;  3F8F A;  3ZN1 A;  3HRT A;  4IXA A;  3CUQ B;  3ZMV A;  2IT0 A;  2K4B A;  1BC8 C;  4R8H A;  1O3T A;  2JZY A;  2DW4 A;  3BWG A;  3HYI A;  2DQR A;  1IF1 A;  5D5V B;  2D45 A;  5JI6 A;  2JT1 A;  1B4A A;  1BI0 A;  3TOB A;  3WTT C;  1BBY A;  4EJT A;  1WRJ A;  4EM2 A;  2WC2 A;  3QU3 A;  4RB0 A;  4G7Z F;  3CUQ A;  1KYZ A;  1FYK A;  5DCM B;  1K6O A;  4M6X A;  2KIM A;  3HSE A;  1QNT A;  1XSD A;  5E1Z B;  3P9I A;  3EDP A;  2CYY A;  3ELK A;  1SFX A;  2P7C B;  3T8T A;  1YS7 A;  3DXJ F;  2XRN A;  2FBK A;  3ZMU A;  4AIJ A;  3ERE D;  2E1N A;  1QZY A;  2VBX A;  2E1C A;  3P9K A;  2ZJ2 A;  3QPT A;  3S2W A;  4U0Y A;  3IL2 A;  1P6R A;  2XAH A;  2HYF A;  3H3U A;  2ISZ A;  1ON2 A;  2DFI A;  5D5X B;  2HWV A;  1QBJ A;  4RGX A;  5CLS A;  4YIF A;  3I71 A;  4PCQ A;  2W57 A;  2IPQ X;  4M74 A;  4LMY A;  3N4M A;  4RGU A;  4Y15 A;  2W25 A;  2WV0 A;  2ZBK A;  2FEZ A;  3Q9V A;  2F2E A;  2WWY A;  2STT A;  4KA4 A;  3RIR A;  5BPD A;  1Y0U A;  4CYD A;  1REP C;  5KK1 A;  3QPH A;  5AON A;  3F22 A;  1YTY A;  4LLN A;  2DQL A;  2BYV E;  2GXG A;  3TO9 A;  1R5H A;  1U5T A;  2YSR A;  1U5T C;  5ILV A;  1ZAO A;  3VOD A;  3JTH A;  4LB6 B;  3HOT A;  4ON0 A;  3Q5F A;  3SHF A;  4HF2 A;  2BV6 A;  3KLO A;  2DPU A;  3SFZ A;  2ETH A;  2G7U A;  2XV4 S;  3OV8 A;  1Z91 A;  3JSP A;  2XAG A;  3LWF A;  4I09 A;  4UVB A;  1USS A;  1TQI A;  2GZW A;  2JPC A;  3M8E A;  3J81 K;  2MA3 A;  1H9T A;  3K69 A;  2CWE A;  1B59 A;  5E20 A;  2P7V B;  2Q0O A;  2ELH A;  2FE3 A;  3K2Z A;  4CIC A;  2K27 A;  1FBS A;  1R7J A;  4KUM A;  2L4M A;  5H6Q A;  3MWM A;  3TOA A;  1R1T A;  1S7O A;  5ILU A;  1YYV A;  3P7N A;  4FX4 A;  3DFG A;  1KQ8 A;  3DF8 A;  4RS8 A;  4L9T A;  5CJ9 A;  5FD5 A;  3HOS A;  3WG9 A;  1A04 A;  2FSW A;  3E5Q A;  2QLZ A;  2NAZ A;  4U7D A;  3GUD A;  3M1E A;  1KYW A;  4Y13 A;  1KA8 A;  2F5C A;  1Z6R A;  2A69 F;  3BJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...